254780708

254780708

intracellular septation protein A

GeneID in NCBI database:8209713Locus tag:CLIBASIA_02975
Protein GI in NCBI database:254780708Protein Accession:YP_003065121.1
Gene range:+(557500, 558114)Protein Length:204aa
Gene description:intracellular septation protein A
COG prediction:[D] Intracellular septation protein A
KEGG prediction:intracellular septation protein A; K06190 intracellular septation protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED6 TM-Helix
HMMTOP6 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLINKHTILPEERK
ccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEHHHcccEEEEccccHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MSRSQSQSKIVCFLLEFSPGIAFWLCNfygeklffyfpmlsnlggiiFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWlrdeslikmkptFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLinkhtilpeerk
MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLINkhtilpeerk
MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTffyfvfsvvlfvgylsGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAigifpiflifgiVQMNLINKHTILPEERK
***********CFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLI***********
********KIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLINKHTILPEERK
***SQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLINKHTIL*****
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
iiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLINKHTILPEERK
MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLINKHTILPEERK
MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQMNLINKHTILPEERK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target204 intracellular septation protein A [Candidatus Liberibac
315121873205 intracellular septation protein A [Candidatus Liberibac 1 3e-76
153008259220 intracellular septation protein A [Ochrobactrum anthrop 1 1e-43
256059909220 intracellular septation protein A [Brucella neotomae 5K 1 4e-43
90421122220 intracellular septation protein A [Aurantimonas mangano 1 5e-43
110635716220 intracellular septation protein A [Mesorhizobium sp. BN 1 5e-43
225853373220 intracellular septation protein A [Brucella melitensis 1 5e-43
325294063216 Intracellular septation protein A [Agrobacterium sp. H1 1 6e-43
161511166220 intracellular septation protein A [Brucella melitensis 1 2e-42
326409936220 ATP/GTP-binding site motif A (P-loop) [Brucella meliten 1 2e-42
23502785220 intracellular septation protein A [Brucella suis 1330] 1 2e-42
>gi|315121873|ref|YP_004062362.1| intracellular septation protein A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 205 Back     alignment and organism information
 Score =  288 bits (738), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 164/204 (80%)

Query: 1   MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGGIIFVSTLLFMVLTAV 60
           MS SQSQ K++ FLLEF+PGI FWLCN YG +L   +P+LS  GG+IF ST+L MVLT +
Sbjct: 1   MSASQSQHKLIRFLLEFAPGIIFWLCNLYGNQLILRYPVLSQFGGVIFFSTVLLMVLTGI 60

Query: 61  SLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPTFFYFVFSVVLFVGYLS 120
           SLG+FW  F E R++P+VSGV VLV G LTVW RDE+ IKMKPT FYF+FS+ LF+GYL 
Sbjct: 61  SLGVFWVLFHEIRIMPIVSGVFVLVLGGLTVWFRDEAFIKMKPTLFYFIFSITLFIGYLF 120

Query: 121 GKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNFSTETWIFFKAIGIFP 180
            KSFV+  LSQV+ LDSIGWRKLTLRWAFF LFLSF NEIVWRNFSTETW+FFK +G FP
Sbjct: 121 KKSFVKLLLSQVMSLDSIGWRKLTLRWAFFSLFLSFLNEIVWRNFSTETWVFFKTVGTFP 180

Query: 181 IFLIFGIVQMNLINKHTILPEERK 204
           I LIF I Q+N+INKH+I  EE +
Sbjct: 181 ILLIFSIAQINIINKHSISCEEER 204


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|153008259|ref|YP_001369474.1| intracellular septation protein A [Ochrobactrum anthropi ATCC 49188] Length = 220 Back     alignment and organism information
>gi|256059909|ref|ZP_05450095.1| intracellular septation protein A [Brucella neotomae 5K33] Length = 220 Back     alignment and organism information
>gi|90421122|ref|ZP_01229024.1| intracellular septation protein A [Aurantimonas manganoxydans SI85-9A1] Length = 220 Back     alignment and organism information
>gi|110635716|ref|YP_675924.1| intracellular septation protein A [Mesorhizobium sp. BNC1] Length = 220 Back     alignment and organism information
>gi|225853373|ref|YP_002733606.1| intracellular septation protein A [Brucella melitensis ATCC 23457] Length = 220 Back     alignment and organism information
>gi|325294063|ref|YP_004279927.1| Intracellular septation protein A [Agrobacterium sp. H13-3] Length = 216 Back     alignment and organism information
>gi|161511166|ref|NP_539048.2| intracellular septation protein A [Brucella melitensis bv. 1 str. 16M] Length = 220 Back     alignment and organism information
>gi|326409936|gb|ADZ67001.1| ATP/GTP-binding site motif A (P-loop) [Brucella melitensis M28] Length = 220 Back     alignment and organism information
>gi|23502785|ref|NP_698912.1| intracellular septation protein A [Brucella suis 1330] Length = 220 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target204 intracellular septation protein A [Candidatus Liberibac
PRK00259179 PRK00259, PRK00259, intracellular septation protein A; 4e-33
COG2917180 COG2917, COG2917, Intracellular septation protein A [Ce 4e-27
TIGR00997178 TIGR00997, ispZ, intracellular septation protein A 5e-23
pfam04279176 pfam04279, IspA, Intracellular septation protein A 2e-33
>gnl|CDD|178950 PRK00259, PRK00259, intracellular septation protein A; Reviewed Back     alignment and domain information
>gnl|CDD|32741 COG2917, COG2917, Intracellular septation protein A [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|130070 TIGR00997, ispZ, intracellular septation protein A Back     alignment and domain information
>gnl|CDD|146751 pfam04279, IspA, Intracellular septation protein A Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 204 intracellular septation protein A [Candidatus Liberibac
PRK00259181 intracellular septation protein A; Reviewed 100.0
COG2917180 Intracellular septation protein A [Cell division and ch 100.0
TIGR00997187 ispZ intracellular septation protein A; InterPro: IPR00 100.0
pfam04279176 IspA Intracellular septation protein A. 100.0
pfam11361188 DUF3159 Protein of unknown function (DUF3159). Some mem 97.28
COG4648201 Predicted membrane protein [Function unknown] 98.31
>PRK00259 intracellular septation protein A; Reviewed Back     alignment and domain information
>COG2917 Intracellular septation protein A [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00997 ispZ intracellular septation protein A; InterPro: IPR006008 Intracellular septation protein A is a family of proteins which are essential for both normal cell division and bacterial virulence and are believed to play a role in the septation process Back     alignment and domain information
>pfam04279 IspA Intracellular septation protein A Back     alignment and domain information
>pfam11361 DUF3159 Protein of unknown function (DUF3159) Back     alignment and domain information
>COG4648 Predicted membrane protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00