254780710

254780710

diaminopimelate epimerase

GeneID in NCBI database:8209715Locus tag:CLIBASIA_02985
Protein GI in NCBI database:254780710Protein Accession:YP_003065123.1
Gene range:+(555450, 556340)Protein Length:296aa
Gene description:diaminopimelate epimerase
COG prediction:[E] Diaminopimelate epimerase
KEGG prediction:dapF; diaminopimelate epimerase (EC:5.1.1.7); K01778 diaminopimelate epimerase [EC:5.1.1.7]
SEED prediction:Diaminopimelate epimerase (EC 5.1.1.7)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Subsystem involved in SEED:Lysine Biosynthesis DAP Pathway;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY
ccccEEEEEEEccccccEEEEEcccccccccHHHHHHHHHcccccccEEEEEEccccccccEEEEEEEccccHHcccHHHHHHHHHHHHHHHcccEEEEEEcccEEEEEEccccEEEEEccccEEcHHHccccccccccccccEEEccccccEEcccEEEEccccEEEEEEcccHHcccHHHHHHHHHccccccccccEEEEEEccccEEEEEEEEEccccccccccHHHHHHHHHHHHccccccEEEEccccEEEEEEccccEEEEEccEEEEEEEEEEEcccHHHHcccccccc
cccHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHcccccccEEEEEEccccccccEEEEEEEccccEEccccccHHHHHHHHHccccccEEEEEEcccEEEEEEccccEEEEccccccccccccccccHHHHHcccccEEccccccEEEEEEEEEccccEEEEEEccccccccHHHHHHHHHcccccccccEEEEEEEEEccEEEEEEEEcccEEccccHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEEcccccEEEccccEEEEcEEEEccccEEEccccHcccc
MQSSMVDFAKMEGIGNKILVIDMrgchdnitsdainalstddnthfdQIMLIHDFQDASVDAFIRIIncdgsevqscgngmRCVVRFLTSrmkrksftFETIRGILVAKenrdgsisvdmgepildwkliplarsfdkmdrdrfhigpvnhlflrnpfvvsmgnphaiffveddlyhydlasfgnllakhpmfsegvnlsIARVtslesldlrtwergvgltaaCGSAACASVVASGCLHKTNRAVSVKMLGGGlliewhdnnhvfmtgeakkewegkldiktgkwikkneddeay
MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCdgsevqscgngMRCVVRFLtsrmkrksftfetirgilvakenrdgsisvdmgepildWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTgeakkewegkldiktgkwikkneddeay
MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTaacgsaacasvvasgcLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY
****MVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG************
MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY
MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY
MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY
MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target296 diaminopimelate epimerase [Candidatus Liberibacter asia
315121875289 diaminopimelate epimerase [Candidatus Liberibacter sola 1 1e-111
260464163294 diaminopimelate epimerase [Mesorhizobium opportunistum 1 2e-77
218682290301 diaminopimelate epimerase [Rhizobium etli CIAT 894] Len 1 7e-77
327190189351 diaminopimelate epimerase protein [Rhizobium etli CNPAF 1 1e-76
190893802301 diaminopimelate epimerase [Rhizobium etli CIAT 652] Len 1 2e-76
110635719293 diaminopimelate epimerase [Mesorhizobium sp. BNC1] Leng 1 2e-76
209551319301 diaminopimelate epimerase [Rhizobium leguminosarum bv. 1 2e-76
163757348292 diaminopimelate epimerase [Hoeflea phototrophica DFL-43 1 2e-76
306843382300 diaminopimelate epimerase [Brucella sp. BO1] Length = 3 1 2e-76
241206755301 diaminopimelate epimerase [Rhizobium leguminosarum bv. 1 2e-76
>gi|315121875|ref|YP_004062364.1| diaminopimelate epimerase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 289 Back     alignment and organism information
 Score =  404 bits (1038), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 213/288 (73%), Positives = 238/288 (82%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV 60
           MQ SMV FAKMEGIGNKILV+DMR   DNIT +AIN LST+DN  FDQIM IH+ Q+   
Sbjct: 1   MQESMVGFAKMEGIGNKILVVDMRDRSDNITLEAINFLSTNDNFPFDQIMAIHNSQNKLA 60

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           DAFIRIIN DGSE QSCGNGMRCVVRFL+S+ K+K+F FETIRGIL AKEN DGSISVDM
Sbjct: 61  DAFIRIINRDGSEAQSCGNGMRCVVRFLSSKTKKKTFIFETIRGILQAKENDDGSISVDM 120

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
           GEPILDW+ IPLA+ FD  D  +F+IGP+N+ FLR+P +VSMGNPHAIFFVEDD+Y YDL
Sbjct: 121 GEPILDWQHIPLAKPFDDTDSAQFYIGPINNSFLRSPSIVSMGNPHAIFFVEDDIYRYDL 180

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           + FG LL  + MF EGVNLSIARVTS+ SLDLRTWERG GLTAACGSAACASVVAS    
Sbjct: 181 SGFGKLLENNFMFPEGVNLSIARVTSISSLDLRTWERGAGLTAACGSAACASVVASARSG 240

Query: 241 KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIK 288
            T+R VSV MLGG LLIEWH NNHVFM+G A K+W+G LDIKTGKW K
Sbjct: 241 NTDRIVSVNMLGGELLIEWHHNNHVFMSGGADKQWDGNLDIKTGKWTK 288


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|260464163|ref|ZP_05812356.1| diaminopimelate epimerase [Mesorhizobium opportunistum WSM2075] Length = 294 Back     alignment and organism information
>gi|218682290|ref|ZP_03529891.1| diaminopimelate epimerase [Rhizobium etli CIAT 894] Length = 301 Back     alignment and organism information
>gi|327190189|gb|EGE57294.1| diaminopimelate epimerase protein [Rhizobium etli CNPAF512] Length = 351 Back     alignment and organism information
>gi|190893802|ref|YP_001980344.1| diaminopimelate epimerase [Rhizobium etli CIAT 652] Length = 301 Back     alignment and organism information
>gi|110635719|ref|YP_675927.1| diaminopimelate epimerase [Mesorhizobium sp. BNC1] Length = 293 Back     alignment and organism information
>gi|209551319|ref|YP_002283236.1| diaminopimelate epimerase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 301 Back     alignment and organism information
>gi|163757348|ref|ZP_02164437.1| diaminopimelate epimerase [Hoeflea phototrophica DFL-43] Length = 292 Back     alignment and organism information
>gi|306843382|ref|ZP_07475983.1| diaminopimelate epimerase [Brucella sp. BO1] Length = 300 Back     alignment and organism information
>gi|241206755|ref|YP_002977851.1| diaminopimelate epimerase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 301 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target296 diaminopimelate epimerase [Candidatus Liberibacter asia
PRK00450274 PRK00450, dapF, diaminopimelate epimerase; Provisional 2e-80
TIGR00652268 TIGR00652, DapF, diaminopimelate epimerase 4e-50
PRK13577281 PRK13577, PRK13577, diaminopimelate epimerase; Provisio 7e-33
COG0253272 COG0253, DapF, Diaminopimelate epimerase [Amino acid tr 3e-67
PLN02536267 PLN02536, PLN02536, diaminopimelate epimerase 4e-43
pfam01678121 pfam01678, DAP_epimerase, Diaminopimelate epimerase 3e-18
pfam01678121 pfam01678, DAP_epimerase, Diaminopimelate epimerase 6e-12
>gnl|CDD|179032 PRK00450, dapF, diaminopimelate epimerase; Provisional Back     alignment and domain information
>gnl|CDD|129737 TIGR00652, DapF, diaminopimelate epimerase Back     alignment and domain information
>gnl|CDD|184158 PRK13577, PRK13577, diaminopimelate epimerase; Provisional Back     alignment and domain information
>gnl|CDD|30602 COG0253, DapF, Diaminopimelate epimerase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178151 PLN02536, PLN02536, diaminopimelate epimerase Back     alignment and domain information
>gnl|CDD|145037 pfam01678, DAP_epimerase, Diaminopimelate epimerase Back     alignment and domain information
>gnl|CDD|145037 pfam01678, DAP_epimerase, Diaminopimelate epimerase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 296 diaminopimelate epimerase [Candidatus Liberibacter asia
PRK00450278 dapF diaminopimelate epimerase; Provisional 100.0
TIGR00652294 DapF diaminopimelate epimerase; InterPro: IPR001653 Bac 100.0
PRK13577281 diaminopimelate epimerase; Provisional 100.0
COG0253272 DapF Diaminopimelate epimerase [Amino acid transport an 100.0
pfam02567280 PhzC-PhzF Phenazine biosynthesis-like protein. PhzC/Phz 99.59
PRK10281299 hypothetical protein; Provisional 99.52
COG0384291 Predicted epimerase, PhzC/PhzF homolog [General functio 99.39
KOG3033286 consensus 99.17
TIGR00654314 PhzF_family phenazine biosynthesis protein PhzF family; 99.04
PRK13969335 proline racemase; Provisional 98.76
PRK13971333 hydroxyproline-2-epimerase; Provisional 98.67
pfam05544325 Pro_racemase Proline racemase. This family consists of 98.66
PRK13970310 hydroxyproline-2-epimerase; Provisional 98.54
pfam01678121 DAP_epimerase Diaminopimelate epimerase. Diaminopimelat 99.95
pfam01678121 DAP_epimerase Diaminopimelate epimerase. Diaminopimelat 99.89
pfam02567 280 PhzC-PhzF Phenazine biosynthesis-like protein. PhzC/Phz 96.28
COG0384 291 Predicted epimerase, PhzC/PhzF homolog [General functio 93.36
PRK10281 299 hypothetical protein; Provisional 93.13
COG3938341 Proline racemase [Amino acid transport and metabolism] 98.21
pfam04303371 PrpF PrpF protein. PrpF is a protein found in the 2-met 95.86
>PRK00450 dapF diaminopimelate epimerase; Provisional Back     alignment and domain information
>TIGR00652 DapF diaminopimelate epimerase; InterPro: IPR001653 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK13577 diaminopimelate epimerase; Provisional Back     alignment and domain information
>COG0253 DapF Diaminopimelate epimerase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam02567 PhzC-PhzF Phenazine biosynthesis-like protein Back     alignment and domain information
>PRK10281 hypothetical protein; Provisional Back     alignment and domain information
>COG0384 Predicted epimerase, PhzC/PhzF homolog [General function prediction only] Back     alignment and domain information
>KOG3033 consensus Back     alignment and domain information
>TIGR00654 PhzF_family phenazine biosynthesis protein PhzF family; InterPro: IPR003719 Five genes, phzF, phzA, phzB, phzC and phzD, encode enzymes for phenazine biosynthesis in the biological control bacterium Pseudomonas chlororaphis (Pseudomonas aureofaciens) Back     alignment and domain information
>PRK13969 proline racemase; Provisional Back     alignment and domain information
>PRK13971 hydroxyproline-2-epimerase; Provisional Back     alignment and domain information
>pfam05544 Pro_racemase Proline racemase Back     alignment and domain information
>PRK13970 hydroxyproline-2-epimerase; Provisional Back     alignment and domain information
>pfam01678 DAP_epimerase Diaminopimelate epimerase Back     alignment and domain information
>pfam01678 DAP_epimerase Diaminopimelate epimerase Back     alignment and domain information
>pfam02567 PhzC-PhzF Phenazine biosynthesis-like protein Back     alignment and domain information
>COG0384 Predicted epimerase, PhzC/PhzF homolog [General function prediction only] Back     alignment and domain information
>PRK10281 hypothetical protein; Provisional Back     alignment and domain information
>COG3938 Proline racemase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam04303 PrpF PrpF protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target296 diaminopimelate epimerase [Candidatus Liberibacter asia
1bwz_A274 Diaminopimelate Epimerase From Hemophilus Influenza 6e-61
1gqz_A274 Refinement Of Haemophilus Influenzae Diaminopimelat 7e-61
2q9h_A274 Crystal Structure Of The C73s Mutant Of Diaminopime 5e-60
3ejx_A317 Crystal Structure Of Diaminopimelate Epimerase From 4e-59
2q9j_A274 Crystal Structure Of The C217s Mutant Of Diaminopim 5e-59
2otn_A308 Crystal Structure Of The Catalytically Active Form 5e-47
3fve_A290 Crystal Structure Of Diaminopimelate Epimerase Myco 4e-24
>gi|6729756|pdb|1BWZ|A Chain A, Diaminopimelate Epimerase From Hemophilus Influenzae Length = 274 Back     alignment and structure
 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 140/280 (50%), Gaps = 10/280 (3%)

Query: 6   VDFAKMEGIGNKILVIDMRGCHDNITSDAINALS-TDDNTHFDQIMLIHDFQDASVDAFI 64
           + F+KM G+GN  +V+D    +   T + I  L+       FDQ++++    D  +D   
Sbjct: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDGSISVDMGE 122
           RI N DGSEV  CGNG RC  RF+T +    +K  +  T +G +V        I V+MGE
Sbjct: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDMNQIRVNMGE 120

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
           PI +   IP   +     +   +      +       VSMGNPH +  V+ D+   ++  
Sbjct: 121 PIWEPAKIPFTAN-----KFEKNYILRTDIQTVLCGAVSMGNPHCVVQVD-DIQTANVEQ 174

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKT 242
            G LL  H  F E VN    ++ + E + LR +ERG G T ACGS ACA+V         
Sbjct: 175 LGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGLL 234

Query: 243 NRAVSVKMLGGGLLIEWHDNNH-VFMTGEAKKEWEGKLDI 281
           N  V V + GG L+IEW+   H ++MTGEA   ++G + +
Sbjct: 235 NNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274


gi|33356940|pdb|1GQZ|A Chain A, Refinement Of Haemophilus Influenzae Diaminopimelate Epimerase At 1.7a Length = 274 Back     alignment and structure
>gi|159795185|pdb|2Q9H|A Chain A, Crystal Structure Of The C73s Mutant Of Diaminopimelate Epimerase Length = 274 Back     alignment and structure
>gi|223673992|pdb|3EJX|A Chain A, Crystal Structure Of Diaminopimelate Epimerase From Arabidopsis Thaliana In Complex With Ll-Azidap Length = 317 Back     alignment and structure
>gi|159795186|pdb|2Q9J|A Chain A, Crystal Structure Of The C217s Mutant Of Diaminopimelate Epimerase Length = 274 Back     alignment and structure
>gi|169404550|pdb|2OTN|A Chain A, Crystal Structure Of The Catalytically Active Form Of Diaminopimelate Epimerase From Bacillus Anthracis Length = 308 Back     alignment and structure
>gi|222143275|pdb|3FVE|A Chain A, Crystal Structure Of Diaminopimelate Epimerase Mycobacterium Tuberculosis Dapf Length = 290 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target296 diaminopimelate epimerase [Candidatus Liberibacter asia
3ejx_A317 DAP epimerase, diaminopimelate epimerase, chloroplastic 1e-55
3fve_A290 DAP epimerase, diaminopimelate epimerase; alpha/beta, a 5e-39
2gke_A274 DAP epimerase, diaminopimelate epimerase; enzyme-inhibi 3e-37
2otn_A308 Diaminopimelate epimerase; DAP, lysine metabolism, X-RA 2e-36
1ym5_A300 YHI9, hypothetical 32.6 kDa protein in DAP2-SLT2 interg 4e-16
1u0k_A288 Gene product PA4716; sctructural genomics, MCSG, protei 9e-15
3edn_A299 Phenazine biosynthesis protein, PHZF family; diaminopim 1e-07
1qya_A307 ORFB, hypothetical protein YDDE; putative phenazine bio 5e-12
1xub_A298 Phenazine biosynthesis protein PHZF; biosynthetic prote 3e-09
>3ejx_A DAP epimerase, diaminopimelate epimerase, chloroplastic; PLP-independenet amino acid racemase, aziridino-diaminopimelate, isomerase; HET: ZDP; 1.95A {Arabidopsis thaliana} PDB: 3ekm_A* Length = 317 Back     alignment and structure
 Score =  211 bits (539), Expect = 1e-55
 Identities = 96/292 (32%), Positives = 142/292 (48%), Gaps = 13/292 (4%)

Query: 1   MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH--FDQIMLIHDFQDA 58
            ++ ++ F K  G+GN  +++D R   +   +    A   D N     D ++      + 
Sbjct: 22  KETGVLHFVKYHGLGNDFILVDNRDSSEPKITQEQAAKLCDRNFGVGADGVIFAMPGVNG 81

Query: 59  SVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRM---KRKSFTFETIRGILVAKENRDGS 115
           + D  +RI N DGSE + CGNG+RC  RF+        + SFT  T  G++V +   DG 
Sbjct: 82  T-DYAMRIFNSDGSEPEMCGNGVRCFARFIAELENLQGKHSFTIHTGAGLIVPEIQDDGQ 140

Query: 116 ISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED-- 173
           + VDMG PIL  + +P   S +K +        V+ +   N   VSMGNPH I F +   
Sbjct: 141 VKVDMGTPILKAQDVPTKLSGNKGEAVVEAELVVDGVSW-NVTCVSMGNPHCITFGKKGG 199

Query: 174 ---DLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC 230
               +   +L   G     H MF    N     V S   L +R WERG G T ACG+ AC
Sbjct: 200 PNLKVDDLNLPEIGPKFEHHEMFPARTNTEFVEVLSRSHLKMRVWERGAGATLACGTGAC 259

Query: 231 ASVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEGKLDI 281
           A VVA+    + +R  +V + GG L IEW  ++NH++MTG A+  + G   +
Sbjct: 260 ALVVAAVLEGRADRKCTVDLPGGPLEIEWKQEDNHIYMTGPAEAVFYGSALL 311


>3fve_A DAP epimerase, diaminopimelate epimerase; alpha/beta, amino-acid biosynthesis, cytoplasm, isomerase, lysine biosynthesis; 2.60A {Mycobacterium tuberculosis} Length = 290 Back     alignment and structure
>2gke_A DAP epimerase, diaminopimelate epimerase; enzyme-inhibitor complex, covalently bound inhibitor, isomerase; HET: ZDP; 1.35A {Haemophilus influenzae} SCOP: d.21.1.1 d.21.1.1 PDB: 1gqz_A* 2gkj_A* 2q9h_A* 2q9j_A 1bwz_A Length = 274 Back     alignment and structure
>2otn_A Diaminopimelate epimerase; DAP, lysine metabolism, X-RAY, lanthionine, isomeras; 2.40A {Bacillus anthracis str} Length = 308 Back     alignment and structure
>1ym5_A YHI9, hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region; PHZF enzyme superfamily, double hot-DOG, structural genomics; 2.05A {Saccharomyces cerevisiae} Length = 300 Back     alignment and structure
>1u0k_A Gene product PA4716; sctructural genomics, MCSG, protein structure initiative, structural genomics, PSI; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.21.1.2 d.21.1.2 Length = 288 Back     alignment and structure
>3edn_A Phenazine biosynthesis protein, PHZF family; diaminopimelate epimerase-like fold, alpha and beta protein class, structural genomics; HET: MSE; 1.50A {Bacillus anthracis} Length = 299 Back     alignment and structure
>1qya_A ORFB, hypothetical protein YDDE; putative phenazine biosynthesis protein, epimerase, antibiotic biosynthesis protein, structural genomics; 2.00A {Escherichia coli} SCOP: d.21.1.2 d.21.1.2 PDB: 1sdj_A 1qy9_A Length = 307 Back     alignment and structure
>1xub_A Phenazine biosynthesis protein PHZF; biosynthetic protein; 1.30A {Pseudomonas fluorescens} SCOP: d.21.1.2 d.21.1.2 PDB: 1u1w_A* 1u1v_A* 1u1x_A* 1xua_A* 1t6k_A Length = 298 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target296 diaminopimelate epimerase [Candidatus Liberibacter asia
2otn_A308 Diaminopimelate epimerase; DAP, lysine metabolism, X-RA 100.0
2gke_A274 DAP epimerase, diaminopimelate epimerase; enzyme-inhibi 100.0
3fve_A290 DAP epimerase, diaminopimelate epimerase; alpha/beta, a 100.0
3ejx_A317 DAP epimerase, diaminopimelate epimerase, chloroplastic 100.0
1u0k_A288 Gene product PA4716; sctructural genomics, MCSG, protei 99.97
1ym5_A300 YHI9, hypothetical 32.6 kDa protein in DAP2-SLT2 interg 99.96
3edn_A299 Phenazine biosynthesis protein, PHZF family; diaminopim 99.95
1xub_A298 Phenazine biosynthesis protein PHZF; biosynthetic prote 99.94
1qya_A307 ORFB, hypothetical protein YDDE; putative phenazine bio 99.92
2azp_A318 Hypothetical protein PA1268; PA1268,APC5861,sulfur SAD, 99.37
1s7j_A262 Phenazine biosynthesis protein PHZF family; bacteria, s 99.12
1w61_A414 B-cell mitogen; racemase, racemase pyridoxal phosphate- 99.08
1tm0_A350 Proline racemase; structural genomics, alpha-beta prote 98.55
3g7k_A391 3-methylitaconate isomerase; DAPF family fold, closed c 97.08
2pw0_A397 PRPF methylaconitate isomerase; propionate catabolism, 91.02
3edn_A 299 Phenazine biosynthesis protein, PHZF family; diaminopim 97.13
1qya_A 307 ORFB, hypothetical protein YDDE; putative phenazine bio 96.53
1xub_A 298 Phenazine biosynthesis protein PHZF; biosynthetic prote 96.48
1s7j_A 262 Phenazine biosynthesis protein PHZF family; bacteria, s 94.75
2azp_A 318 Hypothetical protein PA1268; PA1268,APC5861,sulfur SAD, 94.25
1u0k_A 288 Gene product PA4716; sctructural genomics, MCSG, protei 92.77
>2otn_A Diaminopimelate epimerase; DAP, lysine metabolism, X-RAY, lanthionine, isomeras; 2.40A {Bacillus anthracis str} Back     alignment and structure
Probab=100.00  E-value=0  Score=580.76  Aligned_cols=275  Identities=33%  Similarity=0.549  Sum_probs=234.8

Q ss_pred             CCCC--CEEEEECCCCCCEEEEECCCCCCCCC--HHHHH-HHCCCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCCCCC
Q ss_conf             8754--11378517677389994778887888--88998-7203567143558998258888866899997178762123
Q gi|254780710|r    2 QSSM--VDFAKMEGIGNKILVIDMRGCHDNIT--SDAIN-ALSTDDNTHFDQIMLIHDFQDASVDAFIRIINCDGSEVQS   76 (296)
Q Consensus         2 ~~~m--i~F~Kmhg~GNDFiiiD~~~~~~~~~--~~~i~-~~~~~~giG~Dgli~i~~~~~~~~d~~m~~fN~DGS~A~m   76 (296)
                      ++.|  ++|+||||+||||||+|.++......  +..++ .|.|++||||||||+|++++  .+|++|+|||+|||+|+|
T Consensus        18 ~~~m~~~~F~Kmhg~GNDFiiiD~~~~~~~~~~~~~~~~~lc~R~~GIGaDgll~i~~s~--~~d~~m~ifNaDGSeA~m   95 (308)
T 2otn_A           18 GSHMSQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSD--VAPVKMRMFNNDGSEGKS   95 (308)
T ss_dssp             SCEEEEEEEEEEEETTEEEEEEETTTCCCCGGGHHHHHHHHHCTTTSCCCSEEEEEECCS--SSSEEEEEEETTSCEECC
T ss_pred             CCCCCCCCEEEEECCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCEEEEEEECC--CCCEEEEEEECCCCHHHC
T ss_conf             787762668987259984999978888798567899999876445684788899997177--888589999489986861


Q ss_pred             CCCHHHHHHHHHHCC--CCCCEEEEEECCCCEEEEECCCC----EEEECCCCCCCCHHHCCCCCCCCCCCCCEEECCCCC
Q ss_conf             320332231110013--57640379835883799985774----277403687777776856565654344301105777
Q gi|254780710|r   77 CGNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVN  150 (296)
Q Consensus        77 CGNG~Rc~a~yl~~~--~~~~~~~i~T~~g~~~~~~~~~~----~v~V~mG~p~~~~~~ip~~~~~~~~~~~~~~~~~~~  150 (296)
                      ||||+||+|+||+++  ..++.+.++|.+|.+.++...++    .++|+||.|.+.+.++|+....+......   ....
T Consensus        96 CGNG~Rcva~yl~~~~~~~~~~~~i~t~~g~~~~~~~~~~~~~~~~~v~mg~~~~~~~~i~~~~~~~~~~~~~---~~~~  172 (308)
T 2otn_A           96 CGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAKIDMGAPRLTRAEIPMLGEGETPFIRE---NFLY  172 (308)
T ss_dssp             TTTTHHHHHHHHHHTTSCSSSEEEEEETTEEEEEEEEESSSSEEEEEEEEECCBCSGGGTTCCSSCCSSSEEE---EEEE
T ss_pred             CCCHHHHHEEHHHHCCCCCCCEEEEEECCCCEEEEEEECCCCEEEEEEECCCCEECCCCCCCCCCCCCCCCCC---CCCC
T ss_conf             6486875400131427767743689961772799999517946899972898572333354323345532222---2024


Q ss_pred             CCEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHH
Q ss_conf             74021309995587427974255768688876310002332375555146799728872899980467876656323589
Q gi|254780710|r  151 HLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC  230 (296)
Q Consensus       151 ~~~~~~~~~v~iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvGeTlACGTGA~  230 (296)
                      ......+++|+|||||||+|++ +++.+++..+|+.|++|+.||+|+||+|++++++++|++||||||||||+|||||||
T Consensus       173 ~~~~~~~~~V~~GnPH~Vi~v~-~~~~~~l~~~g~~i~~~~~fp~g~NV~fv~~~~~~~i~vRt~ERGvGeTlaCGTGa~  251 (308)
T 2otn_A          173 NNHRYAFTAVSMGNPHAVIFVD-DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGAC  251 (308)
T ss_dssp             TTEEEEEEEEESSSEEEEEECS-CGGGSCTTTHHHHHHTCTTCTTCCEEEEEEEEETTEEEEEEECSSSCBCSCCHHHHH
T ss_pred             CCCCEEEEEECCCCCEEEEEEC-CCCCCHHHHHCCHHCCCCCCCCCCCEEEEEEECCCEEEEEEECCCCCCCCCCHHHHH
T ss_conf             7860457998169965999945-632011443173200554466654358999721342799996178885656467899


Q ss_pred             HHHHHHHHHCCCC--CCEEEECCCCEEEEEEECCCEEEEEECEEEEEEEEEEEC
Q ss_conf             9999999817889--807999079579999958981999946289998899841
Q gi|254780710|r  231 ASVVASGCLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIK  282 (296)
Q Consensus       231 Asa~~~~~~~~~~--~~v~V~~pGG~L~v~~~~~~~i~l~Gpa~~vf~G~~~i~  282 (296)
                      |+|+++.++++.+  ++++|++|||.|.|+|.++++|+|+|||++||+|+|+..
T Consensus       252 Aaa~a~~~~~~~~~~~~v~V~~~GG~L~V~~~~~~~v~L~Gpa~~vf~G~~~~~  305 (308)
T 2otn_A          252 AAVVASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYK  305 (308)
T ss_dssp             HHHHHHHHTTSSCTTCCEEEECSSCEEEEEECTTSCEEEEEECEEEEEEEEEEE
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCEEEEEEECCCCEEEEECCEEEEEEEEEEE
T ss_conf             999999984756789879999699779999937994999937599999999988



>2gke_A DAP epimerase, diaminopimelate epimerase; enzyme-inhibitor complex, covalently bound inhibitor, isomerase; HET: ZDP; 1.35A {Haemophilus influenzae} SCOP: d.21.1.1 d.21.1.1 PDB: 1gqz_A* 2gkj_A* 2q9h_A* 2q9j_A 1bwz_A Back     alignment and structure
>3fve_A DAP epimerase, diaminopimelate epimerase; alpha/beta, amino-acid biosynthesis, cytoplasm, isomerase, lysine biosynthesis; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3ejx_A DAP epimerase, diaminopimelate epimerase, chloroplastic; PLP-independenet amino acid racemase, aziridino-diaminopimelate, isomerase; HET: ZDP; 1.95A {Arabidopsis thaliana} PDB: 3ekm_A* Back     alignment and structure
>1u0k_A Gene product PA4716; sctructural genomics, MCSG, protein structure initiative, structural genomics, PSI; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.21.1.2 d.21.1.2 Back     alignment and structure
>1ym5_A YHI9, hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region; PHZF enzyme superfamily, double hot-DOG, structural genomics; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>3edn_A Phenazine biosynthesis protein, PHZF family; diaminopimelate epimerase-like fold, alpha and beta protein class, structural genomics; HET: MSE; 1.50A {Bacillus anthracis} Back     alignment and structure
>1xub_A Phenazine biosynthesis protein PHZF; biosynthetic protein; 1.30A {Pseudomonas fluorescens} SCOP: d.21.1.2 d.21.1.2 PDB: 1u1w_A* 1u1v_A* 1u1x_A* 1xua_A* 1t6k_A Back     alignment and structure
>1qya_A ORFB, hypothetical protein YDDE; putative phenazine biosynthesis protein, epimerase, antibiotic biosynthesis protein, structural genomics; 2.00A {Escherichia coli} SCOP: d.21.1.2 d.21.1.2 PDB: 1sdj_A 1qy9_A Back     alignment and structure
>2azp_A Hypothetical protein PA1268; PA1268,APC5861,sulfur SAD, structural genomics, PSI, protein structure initiative; 2.13A {Pseudomonas aeruginosa} Back     alignment and structure
>1s7j_A Phenazine biosynthesis protein PHZF family; bacteria, structural genomics, PSI, protein structure initiative; 2.30A {Enterococcus faecalis V583} SCOP: d.21.1.2 Back     alignment and structure
>1w61_A B-cell mitogen; racemase, racemase pyridoxal phosphate-independent, stereo inversion, acid/base catalysis, homodimer, alpha/beta domains; 2.1A {Trypanosoma cruzi} PDB: 1w62_A Back     alignment and structure
>1tm0_A Proline racemase; structural genomics, alpha-beta protein THAT resembles double-beta barrel; 2.80A {Brucella melitensis 16M} SCOP: d.21.1.3 Back     alignment and structure
>3g7k_A 3-methylitaconate isomerase; DAPF family fold, closed conformation, open conformation; 2.70A {Eubacterium barkeri} Back     alignment and structure
>2pw0_A PRPF methylaconitate isomerase; propionate catabolism, diaminopimelate epimerase like, aconitate binding, unknown function; HET: TRC; 1.57A {Shewanella oneidensis} PDB: 2pvz_A 2h9f_A Back     alignment and structure
>3edn_A Phenazine biosynthesis protein, PHZF family; diaminopimelate epimerase-like fold, alpha and beta protein class, structural genomics; HET: MSE; 1.50A {Bacillus anthracis} Back     alignment and structure
>1qya_A ORFB, hypothetical protein YDDE; putative phenazine biosynthesis protein, epimerase, antibiotic biosynthesis protein, structural genomics; 2.00A {Escherichia coli} SCOP: d.21.1.2 d.21.1.2 PDB: 1sdj_A 1qy9_A Back     alignment and structure
>1xub_A Phenazine biosynthesis protein PHZF; biosynthetic protein; 1.30A {Pseudomonas fluorescens} SCOP: d.21.1.2 d.21.1.2 PDB: 1u1w_A* 1u1v_A* 1u1x_A* 1xua_A* 1t6k_A Back     alignment and structure
>1s7j_A Phenazine biosynthesis protein PHZF family; bacteria, structural genomics, PSI, protein structure initiative; 2.30A {Enterococcus faecalis V583} SCOP: d.21.1.2 Back     alignment and structure
>2azp_A Hypothetical protein PA1268; PA1268,APC5861,sulfur SAD, structural genomics, PSI, protein structure initiative; 2.13A {Pseudomonas aeruginosa} Back     alignment and structure
>1u0k_A Gene product PA4716; sctructural genomics, MCSG, protein structure initiative, structural genomics, PSI; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.21.1.2 d.21.1.2 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 296 diaminopimelate epimerase [Candidatus Liberibacter asia
d2gkea2144 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemoph 9e-26
d1u0ka2153 d.21.1.2 (A:131-283) Hypothetical protein PA4716 {Pseud 1e-13
d1qy9a2168 d.21.1.2 (A:130-297) Hypothetical protein YddE {Escheri 4e-08
d1xuba2150 d.21.1.2 (A:129-278) Phenazine biosynthesis protein Phz 3e-07
d2gkea1130 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophil 4e-25
>d2gkea2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]} Length = 144 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Diaminopimelate epimerase-like
superfamily: Diaminopimelate epimerase-like
family: Diaminopimelate epimerase
domain: Diaminopimelate epimerase
species: Haemophilus influenzae [TaxId: 727]
 Score =  110 bits (277), Expect = 9e-26
 Identities = 49/124 (39%), Positives = 69/124 (55%), Gaps = 2/124 (1%)

Query: 159 VVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERG 218
            VSMGNPH +  V DD+   ++   G LL  H  F E VN    ++ + E + LR +ERG
Sbjct: 22  AVSMGNPHCVVQV-DDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERG 80

Query: 219 VGLTAACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWH-DNNHVFMTGEAKKEWEG 277
            G T ACGS ACA+V         N  V V + GG L+IEW+   + ++MTGEA   ++G
Sbjct: 81  AGETQACGSGACAAVAVGIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDG 140

Query: 278 KLDI 281
            + +
Sbjct: 141 FITL 144


>d1u0ka2 d.21.1.2 (A:131-283) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]} Length = 153 Back     information, alignment and structure
>d1qy9a2 d.21.1.2 (A:130-297) Hypothetical protein YddE {Escherichia coli [TaxId: 562]} Length = 168 Back     information, alignment and structure
>d1xuba2 d.21.1.2 (A:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]} Length = 150 Back     information, alignment and structure
>d2gkea1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]} Length = 130 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target296 diaminopimelate epimerase [Candidatus Liberibacter asia
d2gkea2144 Diaminopimelate epimerase {Haemophilus influenzae [TaxI 100.0
d1u0ka2153 Hypothetical protein PA4716 {Pseudomonas aeruginosa [Ta 99.42
d1qy9a2168 Hypothetical protein YddE {Escherichia coli [TaxId: 562 99.32
d1xuba2150 Phenazine biosynthesis protein PhzF {Pseudomonas fluore 99.27
d1u0ka1129 Hypothetical protein PA4716 {Pseudomonas aeruginosa [Ta 97.37
d1qy9a1127 Hypothetical protein YddE {Escherichia coli [TaxId: 562 97.23
d1xuba1128 Phenazine biosynthesis protein PhzF {Pseudomonas fluore 97.06
d1s7ja_ 260 Hypothetical protein EF0119 {Enterococcus faecalis [Tax 94.96
d2gkea1130 Diaminopimelate epimerase {Haemophilus influenzae [TaxI 100.0
d1xuba1128 Phenazine biosynthesis protein PhzF {Pseudomonas fluore 98.31
d1qy9a1127 Hypothetical protein YddE {Escherichia coli [TaxId: 562 97.98
d1u0ka1129 Hypothetical protein PA4716 {Pseudomonas aeruginosa [Ta 97.18
d1s7ja_260 Hypothetical protein EF0119 {Enterococcus faecalis [Tax 99.22
d1tm0a_332 Proline racemase {Brucella melitensis [TaxId: 29459]} 98.2
d1qy9a2168 Hypothetical protein YddE {Escherichia coli [TaxId: 562 94.25
>d2gkea2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Diaminopimelate epimerase-like
superfamily: Diaminopimelate epimerase-like
family: Diaminopimelate epimerase
domain: Diaminopimelate epimerase
species: Haemophilus influenzae [TaxId: 727]
Probab=100.00  E-value=3.2e-43  Score=301.81  Aligned_cols=125  Identities=38%  Similarity=0.656  Sum_probs=118.8

Q ss_pred             CEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             30999558742797425576868887631000233237555514679972887289998046787665632358999999
Q gi|254780710|r  156 NPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVA  235 (296)
Q Consensus       156 ~~~~v~iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvGeTlACGTGA~Asa~~  235 (296)
                      .+++|+|||||+|+|++ +++.+++..+|+.||+|+.||+|+||+|++++++++|++||||||||||+||||||||+|++
T Consensus        19 ~~~~V~vGNPH~Vi~v~-~l~~~~~~~~g~~i~~~~~fp~g~Nv~f~~~~~~~~i~iRt~ERGvGeTlaCGTGA~Aaa~~   97 (144)
T d2gkea2          19 LCGAVSMGNPHCVVQVD-DIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAV   97 (144)
T ss_dssp             EEEEEESSSEEEEEECS-CTTTSCHHHHHHHHHTCTTCTTCCEEEEEEEEETTEEEEEEEETTTEECSCCHHHHHHHHHH
T ss_pred             EEEEEECCCCEEEEEEC-CCCCCCHHHHCCEECCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHH
T ss_conf             99999879985999977-70207656726430046321333551279994288089999368871144433006899999


Q ss_pred             HHHHCCCCCCEEEECCCCEEEEEEEC-CCEEEEEECEEEEEEEEEEE
Q ss_conf             99817889807999079579999958-98199994628999889984
Q gi|254780710|r  236 SGCLHKTNRAVSVKMLGGGLLIEWHD-NNHVFMTGEAKKEWEGKLDI  281 (296)
Q Consensus       236 ~~~~~~~~~~v~V~~pGG~L~v~~~~-~~~i~l~Gpa~~vf~G~~~i  281 (296)
                      +.++++.+++++|.+|||.|.|+|++ +++|+|+|||++||+|+++|
T Consensus        98 ~~~~~~~~~~i~V~~~GG~l~V~~~~~~~~i~L~Gpa~~vf~G~i~l  144 (144)
T d2gkea2          98 GIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL  144 (144)
T ss_dssp             HHHTTSSCSEEEEEETTEEEEEEECCTTSCEEEEECCEEEEEEECCC
T ss_pred             HHHCCCCCCCEEEEECCCEEEEEEECCCCEEEEEECCEEEEEEEEEC
T ss_conf             99809999739999789879999988999899991679999999989



>d1u0ka2 d.21.1.2 (A:131-283) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qy9a2 d.21.1.2 (A:130-297) Hypothetical protein YddE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xuba2 d.21.1.2 (A:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1u0ka1 d.21.1.2 (A:2-130) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qy9a1 d.21.1.2 (A:3-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xuba1 d.21.1.2 (A:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1s7ja_ d.21.1.2 (A:) Hypothetical protein EF0119 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gkea1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xuba1 d.21.1.2 (A:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1qy9a1 d.21.1.2 (A:3-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ka1 d.21.1.2 (A:2-130) Hypothetical protein PA4716 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s7ja_ d.21.1.2 (A:) Hypothetical protein EF0119 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1tm0a_ d.21.1.3 (A:) Proline racemase {Brucella melitensis [TaxId: 29459]} Back     information, alignment and structure
>d1qy9a2 d.21.1.2 (A:130-297) Hypothetical protein YddE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 296 diaminopimelate epimerase [Candidatus Liberibacter
2otn_A_97-293197 (A:97-293) Diaminopimelate epimerase; DAP, lysine 4e-46
2gke_A_274 (A:) DAP epimerase, diaminopimelate epimerase; enz 2e-40
3ejx_A_317 (A:) DAP epimerase, diaminopimelate epimerase, chl 1e-36
3fve_A_290 (A:) DAP epimerase, diaminopimelate epimerase; alp 5e-30
1u0k_A_288 (A:) Gene product PA4716; sctructural genomics, MC 1e-29
1s7j_A_262 (A:) Phenazine biosynthesis protein PHZF family; b 3e-28
3edn_A_299 (A:) Phenazine biosynthesis protein, PHZF family; 3e-26
1qya_A_307 (A:) ORFB, hypothetical protein YDDE; putative phe 3e-26
2azp_A_318 (A:) Hypothetical protein PA1268; PA1268,APC5861,s 2e-25
1tm0_A_350 (A:) Proline racemase; structural genomics, alpha- 4e-23
1ym5_A_300 (A:) YHI9, hypothetical 32.6 kDa protein in DAP2-S 1e-22
1w61_A_414 (A:) B-cell mitogen; racemase, racemase pyridoxal 1e-21
3g7k_A_391 (A:) 3-methylitaconate isomerase; DAPF family fold 2e-06
1xub_A_141-276136 (A:141-276) Phenazine biosynthesis protein PHZF; b 2e-17
2otn_A_1-96_294-308111 (A:1-96,A:294-308) Diaminopimelate epimerase; DAP, 1e-09
>2otn_A (A:97-293) Diaminopimelate epimerase; DAP, lysine metabolism, X-RAY, lanthionine, isomeras; 2.40A {Bacillus anthracis str}Length = 197 Back     alignment and structure
 Score =  179 bits (455), Expect = 4e-46
 Identities = 73/201 (36%), Positives = 105/201 (52%), Gaps = 14/201 (6%)

Query: 78  GNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISVDMGEPILDWKLIP 131
           GNG+RCV ++      ++   FT ET+ GI+ A+   +        +DMG P L    IP
Sbjct: 1   GNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAKIDMGAPRLTRAEIP 60

Query: 132 LARSFD-KMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKH 190
           +    +    R+ F      + F      VSMGNPHA+ FV DD+    L + G +L  H
Sbjct: 61  MLGEGETPFIRENFLYNNHRYAFT----AVSMGNPHAVIFV-DDVEQAPLTTLGPVLETH 115

Query: 191 PMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLHKTNRA--VSV 248
            MF E VN+    + + E ++ R WERG G+T ACG+ ACA+VVAS    K  R   ++V
Sbjct: 116 EMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILNGKMERGKEITV 175

Query: 249 KMLGGGLLIEWHDNNHVFMTG 269
            + GG L+I W +  +V M G
Sbjct: 176 HLAGGDLMIAWTEEGNVLMKG 196


>2gke_A (A:) DAP epimerase, diaminopimelate epimerase; enzyme-inhibitor complex, covalently bound inhibitor, isomerase; HET: ZDP; 1.35A {Haemophilus influenzae}Length = 274 Back     alignment and structure
>3ejx_A (A:) DAP epimerase, diaminopimelate epimerase, chloroplastic; PLP-independenet amino acid racemase, aziridino-diaminopimelate, isomerase; HET: ZDP; 1.95A {Arabidopsis thaliana} PDB: 3ekm_A*Length = 317 Back     alignment and structure
>3fve_A (A:) DAP epimerase, diaminopimelate epimerase; alpha/beta, amino-acid biosynthesis, cytoplasm, isomerase, lysine biosynthesis; 2.60A {Mycobacterium tuberculosis}Length = 290 Back     alignment and structure
>1u0k_A (A:) Gene product PA4716; sctructural genomics, MCSG, protein structure initiative, structural genomics, PSI; 1.50A {Pseudomonas aeruginosa PAO1}Length = 288 Back     alignment and structure
>1s7j_A (A:) Phenazine biosynthesis protein PHZF family; bacteria, structural genomics, PSI, protein structure initiative; 2.30A {Enterococcus faecalis V583}Length = 262 Back     alignment and structure
>3edn_A (A:) Phenazine biosynthesis protein, PHZF family; diaminopimelate epimerase-like fold, alpha and beta protein class, structural genomics; HET: MSE; 1.50A {Bacillus anthracis}Length = 299 Back     alignment and structure
>1qya_A (A:) ORFB, hypothetical protein YDDE; putative phenazine biosynthesis protein, epimerase, antibiotic biosynthesis protein, structural genomics; 2.00A {Escherichia coli}Length = 307 Back     alignment and structure
>2azp_A (A:) Hypothetical protein PA1268; PA1268,APC5861,sulfur SAD, structural genomics, PSI, protein structure initiative; 2.13A {Pseudomonas aeruginosa}Length = 318 Back     alignment and structure
>1tm0_A (A:) Proline racemase; structural genomics, alpha-beta protein THAT resembles double-beta barrel; 2.80A {Brucella melitensis 16M}Length = 350 Back     alignment and structure
>1ym5_A (A:) YHI9, hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region; PHZF enzyme superfamily, double hot-DOG, structural genomics; 2.05A {Saccharomyces cerevisiae}Length = 300 Back     alignment and structure
>1w61_A (A:) B-cell mitogen; racemase, racemase pyridoxal phosphate-independent, stereo inversion, acid/base catalysis, homodimer, alpha/beta domains; 2.1A {Trypanosoma cruzi} PDB: 1w62_ALength = 414 Back     alignment and structure
>3g7k_A (A:) 3-methylitaconate isomerase; DAPF family fold, closed conformation, open conformation; 2.70A {Eubacterium barkeri}Length = 391 Back     alignment and structure
>1xub_A (A:141-276) Phenazine biosynthesis protein PHZF; biosynthetic protein; 1.30A {Pseudomonas fluorescens}Length = 136 Back     alignment and structure
>2otn_A (A:1-96,A:294-308) Diaminopimelate epimerase; DAP, lysine metabolism, X-RAY, lanthionine, isomeras; 2.40A {Bacillus anthracis str}Length = 111 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target296 diaminopimelate epimerase [Candidatus Liberibacter asia
2otn_A_97-293197 Diaminopimelate epimerase; DAP, lysine metabolism, 100.0
2gke_A_274 DAP epimerase, diaminopimelate epimerase; enzyme-i 100.0
3fve_A_290 DAP epimerase, diaminopimelate epimerase; alpha/be 100.0
3ejx_A_317 DAP epimerase, diaminopimelate epimerase, chloropl 100.0
1tm0_A_350 Proline racemase; structural genomics, alpha-beta 100.0
1ym5_A_300 YHI9, hypothetical 32.6 kDa protein in DAP2-SLT2 i 100.0
1qya_A_307 ORFB, hypothetical protein YDDE; putative phenazin 100.0
1s7j_A_262 Phenazine biosynthesis protein PHZF family; bacter 100.0
2azp_A_318 Hypothetical protein PA1268; PA1268,APC5861,sulfur 100.0
1u0k_A_288 Gene product PA4716; sctructural genomics, MCSG, p 100.0
3edn_A_299 Phenazine biosynthesis protein, PHZF family; diami 100.0
1w61_A_414 B-cell mitogen; racemase, racemase pyridoxal phosp 100.0
3g7k_A_391 3-methylitaconate isomerase; DAPF family fold, clo 99.85
2otn_A_1-96_294-308111 Diaminopimelate epimerase; DAP, lysine metabolism, 99.88
1xub_A_141-276136 Phenazine biosynthesis protein PHZF; biosynthetic 99.58
1u0k_A_ 288 Gene product PA4716; sctructural genomics, MCSG, p 96.64
1qya_A_ 307 ORFB, hypothetical protein YDDE; putative phenazin 96.61
2gke_A_ 274 DAP epimerase, diaminopimelate epimerase; enzyme-i 96.46
1s7j_A_ 262 Phenazine biosynthesis protein PHZF family; bacter 96.32
1xub_A_1-140_277-298162 Phenazine biosynthesis protein PHZF; biosynthetic 96.25
3ejx_A_ 317 DAP epimerase, diaminopimelate epimerase, chloropl 95.77
2azp_A_ 318 Hypothetical protein PA1268; PA1268,APC5861,sulfur 94.84
1tm0_A_ 350 Proline racemase; structural genomics, alpha-beta 93.22
3edn_A_ 299 Phenazine biosynthesis protein, PHZF family; diami 92.95
1xub_A_1-140_277-298162 Phenazine biosynthesis protein PHZF; biosynthetic 98.06
3fve_A_ 290 DAP epimerase, diaminopimelate epimerase; alpha/be 93.71
>2otn_A (A:97-293) Diaminopimelate epimerase; DAP, lysine metabolism, X-RAY, lanthionine, isomeras; 2.40A {Bacillus anthracis str} Back     alignment and structure
Probab=100.00  E-value=0  Score=392.56  Aligned_cols=188  Identities=37%  Similarity=0.654  Sum_probs=168.0

Q ss_pred             CCHHHHHHHHHHCC--CCCCEEEEEECCCCEEEEECCCC----EEEECCCCCCCCHHHCCCCCCCCCCCCC-EEECCCCC
Q ss_conf             20332231110013--57640379835883799985774----2774036877777768565656543443-01105777
Q gi|254780710|r   78 GNGMRCVVRFLTSR--MKRKSFTFETIRGILVAKENRDG----SISVDMGEPILDWKLIPLARSFDKMDRD-RFHIGPVN  150 (296)
Q Consensus        78 GNG~Rc~a~yl~~~--~~~~~~~i~T~~g~~~~~~~~~~----~v~V~mG~p~~~~~~ip~~~~~~~~~~~-~~~~~~~~  150 (296)
                      |||+||+++||+++  ..++++.|+|.+|++.++...++    .|+|+||.|+|.++++|+....+....+ .+..    
T Consensus         1 GNG~Rc~a~~l~~~g~~~~~~~~i~T~aG~~~~~~~~~~~~~~~v~V~MG~p~~~~~~ip~~~~~~~~~~~~~~~~----   76 (197)
T 2otn_A            1 GNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAKIDMGAPRLTRAEIPMLGEGETPFIRENFLY----   76 (197)
T ss_dssp             TTTHHHHHHHHHHTTSCSSSEEEEEETTEEEEEEEEESSSSEEEEEEEEECCBCSGGGTTCCSSCCSSSEEEEEEE----
T ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEECCCCCEEEEEEECCCEEEEEEEECCCCEECHHHCCCCCCCCCCCCCEEEEC----
T ss_conf             5168888857655277644211101048717899973276158998633685644001332122466332101320----


Q ss_pred             CCEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHH
Q ss_conf             74021309995587427974255768688876310002332375555146799728872899980467876656323589
Q gi|254780710|r  151 HLFLRNPFVVSMGNPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAAC  230 (296)
Q Consensus       151 ~~~~~~~~~v~iGNPH~Vi~v~d~i~~~~l~~~g~~i~~~~~Fp~gvNV~fv~v~~~~~I~iRt~ERGvGeTlACGTGA~  230 (296)
                      ......+++|+|||||||+|++ +++.+++..+|+.+++||.||+|+||+|+|++++++|++||||||+|||+|||||||
T Consensus        77 ~~~~~~~~~v~~GnPH~V~fv~-~~~~~~~~~~g~~i~~~~~FP~g~NV~fv~v~~~~~i~~Rt~ERG~geTlACGTGac  155 (197)
T 2otn_A           77 NNHRYAFTAVSMGNPHAVIFVD-DVEQAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGAC  155 (197)
T ss_dssp             TTEEEEEEEEESSSEEEEEECS-CGGGSCTTTHHHHHHTCTTCTTCCEEEEEEEEETTEEEEEEECSSSCBCSCCHHHHH
T ss_pred             CCCCEEEEEEECCCCEEEEEEE-EECCCCHHCCCCCCCCCCCCCCCCCEEEEEEECCCEEEEEEECCCCCCCCCCHHHHH
T ss_conf             4761026999638950899984-001233110064001434476543224678740433899996478863335005689


Q ss_pred             HHHHHHHHHCCCC--CCEEEECCCCEEEEEEECCCEEEEEEC
Q ss_conf             9999999817889--807999079579999958981999946
Q gi|254780710|r  231 ASVVASGCLHKTN--RAVSVKMLGGGLLIEWHDNNHVFMTGE  270 (296)
Q Consensus       231 Asa~~~~~~~~~~--~~v~V~~pGG~L~v~~~~~~~i~l~Gp  270 (296)
                      |+|+++.++++++  .+++|++|||+|.|+|.++++|+|+||
T Consensus       156 Aaa~~a~~~g~~~~~~~v~V~~~GG~L~V~~~~~~~i~ltGP  197 (197)
T 2otn_A          156 AAVVASILNGKMERGKEITVHLAGGDLMIAWTEEGNVLMKGP  197 (197)
T ss_dssp             HHHHHHHHTTSSCTTCCEEEECSSCEEEEEECTTSCEEEEEE
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCEEEEEEECCCCEEEEEC
T ss_conf             999999984756789879999799789999957995999927



>2gke_A (A:) DAP epimerase, diaminopimelate epimerase; enzyme-inhibitor complex, covalently bound inhibitor, isomerase; HET: ZDP; 1.35A {Haemophilus influenzae} Back     alignment and structure
>3fve_A (A:) DAP epimerase, diaminopimelate epimerase; alpha/beta, amino-acid biosynthesis, cytoplasm, isomerase, lysine biosynthesis; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3ejx_A (A:) DAP epimerase, diaminopimelate epimerase, chloroplastic; PLP-independenet amino acid racemase, aziridino-diaminopimelate, isomerase; HET: ZDP; 1.95A {Arabidopsis thaliana} PDB: 3ekm_A* Back     alignment and structure
>1tm0_A (A:) Proline racemase; structural genomics, alpha-beta protein THAT resembles double-beta barrel; 2.80A {Brucella melitensis 16M} Back     alignment and structure
>1ym5_A (A:) YHI9, hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region; PHZF enzyme superfamily, double hot-DOG, structural genomics; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1qya_A (A:) ORFB, hypothetical protein YDDE; putative phenazine biosynthesis protein, epimerase, antibiotic biosynthesis protein, structural genomics; 2.00A {Escherichia coli} Back     alignment and structure
>1s7j_A (A:) Phenazine biosynthesis protein PHZF family; bacteria, structural genomics, PSI, protein structure initiative; 2.30A {Enterococcus faecalis V583} Back     alignment and structure
>2azp_A (A:) Hypothetical protein PA1268; PA1268,APC5861,sulfur SAD, structural genomics, PSI, protein structure initiative; 2.13A {Pseudomonas aeruginosa} Back     alignment and structure
>1u0k_A (A:) Gene product PA4716; sctructural genomics, MCSG, protein structure initiative, structural genomics, PSI; 1.50A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3edn_A (A:) Phenazine biosynthesis protein, PHZF family; diaminopimelate epimerase-like fold, alpha and beta protein class, structural genomics; HET: MSE; 1.50A {Bacillus anthracis} Back     alignment and structure
>1w61_A (A:) B-cell mitogen; racemase, racemase pyridoxal phosphate-independent, stereo inversion, acid/base catalysis, homodimer, alpha/beta domains; 2.1A {Trypanosoma cruzi} PDB: 1w62_A Back     alignment and structure
>3g7k_A (A:) 3-methylitaconate isomerase; DAPF family fold, closed conformation, open conformation; 2.70A {Eubacterium barkeri} Back     alignment and structure
>2otn_A (A:1-96,A:294-308) Diaminopimelate epimerase; DAP, lysine metabolism, X-RAY, lanthionine, isomeras; 2.40A {Bacillus anthracis str} Back     alignment and structure
>1xub_A (A:141-276) Phenazine biosynthesis protein PHZF; biosynthetic protein; 1.30A {Pseudomonas fluorescens} Back     alignment and structure
>1u0k_A (A:) Gene product PA4716; sctructural genomics, MCSG, protein structure initiative, structural genomics, PSI; 1.50A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1qya_A (A:) ORFB, hypothetical protein YDDE; putative phenazine biosynthesis protein, epimerase, antibiotic biosynthesis protein, structural genomics; 2.00A {Escherichia coli} Back     alignment and structure
>2gke_A (A:) DAP epimerase, diaminopimelate epimerase; enzyme-inhibitor complex, covalently bound inhibitor, isomerase; HET: ZDP; 1.35A {Haemophilus influenzae} Back     alignment and structure
>1s7j_A (A:) Phenazine biosynthesis protein PHZF family; bacteria, structural genomics, PSI, protein structure initiative; 2.30A {Enterococcus faecalis V583} Back     alignment and structure
>1xub_A (A:1-140,A:277-298) Phenazine biosynthesis protein PHZF; biosynthetic protein; 1.30A {Pseudomonas fluorescens} Back     alignment and structure
>3ejx_A (A:) DAP epimerase, diaminopimelate epimerase, chloroplastic; PLP-independenet amino acid racemase, aziridino-diaminopimelate, isomerase; HET: ZDP; 1.95A {Arabidopsis thaliana} PDB: 3ekm_A* Back     alignment and structure
>2azp_A (A:) Hypothetical protein PA1268; PA1268,APC5861,sulfur SAD, structural genomics, PSI, protein structure initiative; 2.13A {Pseudomonas aeruginosa} Back     alignment and structure
>1tm0_A (A:) Proline racemase; structural genomics, alpha-beta protein THAT resembles double-beta barrel; 2.80A {Brucella melitensis 16M} Back     alignment and structure
>3edn_A (A:) Phenazine biosynthesis protein, PHZF family; diaminopimelate epimerase-like fold, alpha and beta protein class, structural genomics; HET: MSE; 1.50A {Bacillus anthracis} Back     alignment and structure
>1xub_A (A:1-140,A:277-298) Phenazine biosynthesis protein PHZF; biosynthetic protein; 1.30A {Pseudomonas fluorescens} Back     alignment and structure
>3fve_A (A:) DAP epimerase, diaminopimelate epimerase; alpha/beta, amino-acid biosynthesis, cytoplasm, isomerase, lysine biosynthesis; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure