254780711

254780711

signal recognition particle protein

GeneID in NCBI database:8209716Locus tag:CLIBASIA_02990
Protein GI in NCBI database:254780711Protein Accession:YP_003065124.1
Gene range:-(553806, 555191)Protein Length:461aa
Gene description:signal recognition particle protein
COG prediction:[U] Signal recognition particle GTPase
KEGG prediction:ffh; signal recognition particle protein; K03106 signal recognition particle subunit SRP54
SEED prediction:Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:Universal GTPases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSILRMLPGMPSLKQNIMPSSFDDKTINHHIAIIASMTKEERANPSIIKHSRKKRIAAGSGTNAAKINKLLKLHRQVAEMMHSTQGLGGNALTQQIMGRLKSKIGFGKNGRFPDF
ccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccc
ccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEEHHHcHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEcccccccEEEccHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHcccccHHHHHHHHHHHHHccHHHHcccHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccc
MFDNLQERLGSIfqnitgkgslsetdISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLGkesieldlnapspLVIMLVGlqgsgkttTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQvdtlevipeqspeKIAIRATQsardggydAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTrmdgdgrggaALSMRtvtgkpikaigtgekindlenffpdrianrilgmGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSIlrmlpgmpslkqnimpssfddktiNHHIAIIASMtkeeranpsiikhsrkkriaagsgtnAAKINKLLKLHRQVAEMMHstqglggnaLTQQIMGRLKskigfgkngrfpdf
MFDNLQERLGSifqnitgkgslsetdiSNTLREIRRTFLEADVSLEVVQSFSkrvqekakgekilrsiqpgqmVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLevipeqspeKIAIRAtqsardggYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALsmrtvtgkpikaigtgekindLENFFPDRIANRILGMGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSILRMLPGMPSLKQNIMPSSFDDKTINHHIAIIasmtkeeranpsiikhsrkkriaagsgtnaaKINKLLKLHRQVAEMMHSTQGLGGNALTQQIMGRLkskigfgkngrfpdf
MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSILRMLPGMPSLKQNIMPSSFDDKTINHHIAIIASMTKEERANPSIIKHSRKKRIAAGSGTNAAKINKLLKLHRQVAEMMHSTQGLGGNALTQQIMGRLKSKIGFGKNGRFPDF
MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDVVSLVEKAARNL***************KFDLEDLAEQFRQTQKIGGIGSILRMLPG*****************INHHIAIIASMTKEERANPS*IKHSRKKRIAAGSGTNAAKINKLLKLHRQ***************************************
MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSK********EKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSILRMLPGMPSLKQNIMPSSFDDKTINHHIAIIASMTKEERANPSIIKHSRKKRIAAGSGTNAAKINKLLKLHRQVAEMMHSTQGLGGNALTQQIMGRLKSKIGFGKNGRFPDF
MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSILRMLPGMPSLKQNIMPSSFDDKTINHHIAIIASMTKEERANPSIIKHSRKKRIAAGSGTNAAKINKLLKLHRQVAEMMHST*******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSILRMLPGMPSLKQNIMPSSFDDKTINHHIAIIASMTKEERANPSIIKHSRKKRIAAGSGTNAAKINKLLKLHRQVAEMMHSTQGLGGNALTQQIMGRLKSKIGFGKNGRFPDF
MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSILRMLPGMPSLKQNIMPSSFDDKTINHHIAIIASMTKEERANPSIIKHSRKKRIAAGSGTNAAKINKLLKLHRQVAEMMHSTQGLGGNALTQQIMGRLKSKIGFGKNGRFPDF
MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSILRMLPGMPSLKQNIMPSSFDDKTINHHIAIIASMTKEERANPSIIKHSRKKRIAAGSGTNAAKINKLLKLHRQVAEMMHSTQGLGGNALTQQIMGRLKSKIGFGKNGRFPDF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target461 signal recognition particle protein [Candidatus Liberib
254780709321 cell division protein [Candidatus Liberibacter asi 1e-25
>gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321 Back     alignment
 Score =  108 bits (271), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 132/278 (47%), Gaps = 21/278 (7%)

Query: 33  EIRRTFLEADVSLEVVQS-----FSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLG 87
           E+    + +D+ + V Q       +KR  +    +++L  +       +++H  L+ +  
Sbjct: 48  ELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVS------ELIHKMLMPL-- 99

Query: 88  KESIELDLNAPSPLVIMLVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQ 147
            +    D +   P VI++VG+ G GKTT   K++  +      K+++A+ D  R AA +Q
Sbjct: 100 SKPFNWDFS-HRPHVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQ 157

Query: 148 LRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISE 207
           L+   ++   D +          +A  A + A+    D +I+DTAGR H N  LM  I +
Sbjct: 158 LKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGK 217

Query: 208 IKSLTN------PHEILLVADALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALS 261
           +  +        PH +L V DA TGQ+A+     F  +   TG+I+T+MDG  RGG  + 
Sbjct: 218 MIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIP 277

Query: 262 MRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGD 299
           +      P+  +G GE INDLE F     +  I G  D
Sbjct: 278 IVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLD 315

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target461 signal recognition particle protein [Candidatus Liberib
315121876461 signal recognition particle protein [Candidatus Liberib 1 0.0
163869270520 signal recognition particle protein [Bartonella triboco 1 1e-161
49474776539 Signal recognition particle protein [Bartonella quintan 1 1e-159
319407814515 signal recognition particle protein [Bartonella sp. 1-1 1 1e-156
17986509523 signal recognition particle, subunit FFH/SRP54 [Brucell 1 1e-156
319404853515 signal recognition particle protein [Bartonella rochali 1 1e-156
254719813523 signal recognition particle protein [Brucella sp. 83/13 1 1e-156
148560502523 signal recognition particle protein [Brucella ovis ATCC 1 1e-156
319899458519 signal recognition particle protein [Bartonella clarrid 1 1e-156
254689978523 Ffh, signal recognition particle protein [Brucella abor 1 1e-156
>gi|315121876|ref|YP_004062365.1| signal recognition particle protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 461 Back     alignment and organism information
 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/459 (83%), Positives = 428/459 (93%)

Query: 1   MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSLEVVQSFSKRVQEKAK 60
           MF+NLQERLGS+FQ ITG+G+LSETDIS TLREIRRTFLEADVSLEVVQ+ ++R+QEKAK
Sbjct: 1   MFENLQERLGSVFQKITGRGNLSETDISKTLREIRRTFLEADVSLEVVQALNERIQEKAK 60

Query: 61  GEKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIMLVGLQGSGKTTTTAKI 120
           G KIL+SIQPGQMV+KIVHDEL+EVLG E++ LDLNAPSPLVIMLVGLQGSGKTTTTAKI
Sbjct: 61  GAKILKSIQPGQMVVKIVHDELIEVLGTENVGLDLNAPSPLVIMLVGLQGSGKTTTTAKI 120

Query: 121 AYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSAR 180
           AYHLKTLKKKK+LMASLD+HRPAAQEQLRYLGE+IQVDTLEV+P+Q P +IA RA Q+AR
Sbjct: 121 AYHLKTLKKKKMLMASLDIHRPAAQEQLRYLGEKIQVDTLEVVPKQLPAEIATRAIQNAR 180

Query: 181 DGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVADALTGQDAVHLARNFDKIV 240
           D GYD VILDTAGRNHIN+SLMQEISE+KSLTNPHEILLVADALTGQDAVHLARNFD+ +
Sbjct: 181 DRGYDVVILDTAGRNHINESLMQEISEVKSLTNPHEILLVADALTGQDAVHLARNFDEKI 240

Query: 241 DLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKINDLENFFPDRIANRILGMGDV 300
            LTGIILTRMDGDGRGGAALSMR VTGKPIKAIGTGEKI+DLENFFPDR+ NRILGMGD+
Sbjct: 241 GLTGIILTRMDGDGRGGAALSMRFVTGKPIKAIGTGEKIDDLENFFPDRVVNRILGMGDI 300

Query: 301 VSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQTQKIGGIGSILRMLPGMPSLK 360
           VSLVEKAARNL+E++A  TAKKIAKGKFDLEDL EQFRQTQKIGGI S+L MLPGM S K
Sbjct: 301 VSLVEKAARNLDEEKATATAKKIAKGKFDLEDLEEQFRQTQKIGGISSLLSMLPGMGSFK 360

Query: 361 QNIMPSSFDDKTINHHIAIIASMTKEERANPSIIKHSRKKRIAAGSGTNAAKINKLLKLH 420
            NIMPS+F+DKTINHHIAII+SMTKEERANPSIIKHSRKKRIAAGSGT+A +INKLLKL+
Sbjct: 361 PNIMPSNFNDKTINHHIAIISSMTKEERANPSIIKHSRKKRIAAGSGTDAVRINKLLKLY 420

Query: 421 RQVAEMMHSTQGLGGNALTQQIMGRLKSKIGFGKNGRFP 459
           RQ+A+MM+ST+G GG+  TQQ+M  LK+KIGFGKNG FP
Sbjct: 421 RQIADMMNSTKGHGGDTSTQQMMQTLKNKIGFGKNGGFP 459


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163869270|ref|YP_001610526.1| signal recognition particle protein [Bartonella tribocorum CIP 105476] Length = 520 Back     alignment and organism information
>gi|49474776|ref|YP_032818.1| Signal recognition particle protein [Bartonella quintana str. Toulouse] Length = 539 Back     alignment and organism information
>gi|319407814|emb|CBI81465.1| signal recognition particle protein [Bartonella sp. 1-1C] Length = 515 Back     alignment and organism information
>gi|17986509|ref|NP_539143.1| signal recognition particle, subunit FFH/SRP54 [Brucella melitensis bv. 1 str. 16M] Length = 523 Back     alignment and organism information
>gi|319404853|emb|CBI78454.1| signal recognition particle protein [Bartonella rochalimae ATCC BAA-1498] Length = 515 Back     alignment and organism information
>gi|254719813|ref|ZP_05181624.1| signal recognition particle protein [Brucella sp. 83/13] Length = 523 Back     alignment and organism information
>gi|148560502|ref|YP_001259663.1| signal recognition particle protein [Brucella ovis ATCC 25840] Length = 523 Back     alignment and organism information
>gi|319899458|ref|YP_004159555.1| signal recognition particle protein [Bartonella clarridgeiae 73] Length = 519 Back     alignment and organism information
>gi|254689978|ref|ZP_05153232.1| Ffh, signal recognition particle protein [Brucella abortus bv. 6 str. 870] Length = 523 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target461 signal recognition particle protein [Candidatus Liberib
PRK10867433 PRK10867, PRK10867, signal recognition particle protein 0.0
TIGR00959428 TIGR00959, ffh, signal recognition particle protein 1e-163
PRK00771437 PRK00771, PRK00771, signal recognition particle protein 1e-118
KOG0780483 KOG0780, KOG0780, KOG0780, Signal recognition particle, 5e-86
TIGR01425429 TIGR01425, SRP54_euk, signal recognition particle prote 9e-60
COG0541451 COG0541, Ffh, Signal recognition particle GTPase [Intra 1e-156
pfam00448196 pfam00448, SRP54, SRP54-type protein, GTPase domain 6e-67
cd03115173 cd03115, SRP, The signal recognition particle (SRP) med 1e-59
COG1419407 COG1419, FlhF, Flagellar GTP-binding protein [Cell moti 2e-20
PRK11889436 PRK11889, flhF, flagellar biosynthesis regulator FlhF; 2e-11
PRK12726407 PRK12726, PRK12726, flagellar biosynthesis regulator Fl 1e-09
PRK12727559 PRK12727, PRK12727, flagellar biosynthesis regulator Fl 2e-09
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator FlhF; 1e-07
PRK14722374 PRK14722, flhF, flagellar biosynthesis regulator FlhF; 4e-07
PRK14974336 PRK14974, PRK14974, cell division protein FtsY; Provisi 6e-60
TIGR00064272 TIGR00064, ftsY, signal recognition particle-docking pr 3e-56
COG0552340 COG0552, FtsY, Signal recognition particle GTPase [Intr 1e-55
PRK10416318 PRK10416, PRK10416, signal recognition particle-docking 6e-54
KOG0781587 KOG0781, KOG0781, KOG0781, Signal recognition particle 2e-35
PRK05703424 PRK05703, flhF, flagellar biosynthesis regulator FlhF; 4e-18
pfam02978100 pfam02978, SRP_SPB, Signal peptide binding domain 8e-30
TIGR03499282 TIGR03499, FlhF, flagellar biosynthetic protein FlhF 1e-12
PRK06731270 PRK06731, flhF, flagellar biosynthesis regulator FlhF; 7e-11
PRK12724432 PRK12724, PRK12724, flagellar biosynthesis regulator Fl 9e-07
pfam0288177 pfam02881, SRP54_N, SRP54-type protein, helical bundle 8e-09
smart00382148 smart00382, AAA, ATPases associated with a variety of c 5e-06
PRK14721420 PRK14721, flhF, flagellar biosynthesis regulator FlhF; 0.001
cd02035217 cd02035, ArsA, ArsA ATPase functionas as an efflux pump 0.003
KOG2878282 KOG2878, KOG2878, KOG2878, Predicted kinase [General fu 0.003
COG4240300 COG4240, COG4240, Predicted kinase [General function pr 0.004
>gnl|CDD|182793 PRK10867, PRK10867, signal recognition particle protein; Provisional Back     alignment and domain information
>gnl|CDD|162133 TIGR00959, ffh, signal recognition particle protein Back     alignment and domain information
>gnl|CDD|179118 PRK00771, PRK00771, signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>gnl|CDD|35999 KOG0780, KOG0780, KOG0780, Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|130492 TIGR01425, SRP54_euk, signal recognition particle protein SRP54 Back     alignment and domain information
>gnl|CDD|30887 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|144151 pfam00448, SRP54, SRP54-type protein, GTPase domain Back     alignment and domain information
>gnl|CDD|48379 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>gnl|CDD|31609 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183360 PRK11889, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|183704 PRK12726, PRK12726, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|183705 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|173186 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|173185 PRK14722, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|184937 PRK14974, PRK14974, cell division protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|161686 TIGR00064, ftsY, signal recognition particle-docking protein FtsY Back     alignment and domain information
>gnl|CDD|30898 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|182441 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|36000 KOG0781, KOG0781, KOG0781, Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|180213 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|145891 pfam02978, SRP_SPB, Signal peptide binding domain Back     alignment and domain information
>gnl|CDD|163294 TIGR03499, FlhF, flagellar biosynthetic protein FlhF Back     alignment and domain information
>gnl|CDD|75717 PRK06731, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|183703 PRK12724, PRK12724, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|145830 pfam02881, SRP54_N, SRP54-type protein, helical bundle domain Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|173184 PRK14721, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|73298 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>gnl|CDD|38089 KOG2878, KOG2878, KOG2878, Predicted kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|33963 COG4240, COG4240, Predicted kinase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 461 signal recognition particle protein [Candidatus Liberib
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 100.0
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 100.0
PRK10867453 signal recognition particle protein; Provisional 100.0
PRK00771433 signal recognition particle protein Srp54; Provisional 100.0
TIGR01425453 SRP54_euk signal recognition particle protein SRP54; In 100.0
KOG0780483 consensus 100.0
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 100.0
PRK10416499 cell division protein FtsY; Provisional 100.0
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 100.0
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 100.0
KOG0781587 consensus 100.0
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 100.0
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 100.0
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 95.96
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 100.0
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 100.0
cd03115173 SRP The signal recognition particle (SRP) mediates the 100.0
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 100.0
KOG0924 1042 consensus 98.46
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 98.31
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 98.27
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.2
PRK00090223 bioD dithiobiotin synthetase; Reviewed 98.06
PRK11537317 putative GTP-binding protein YjiA; Provisional 98.04
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 97.97
PRK08116262 hypothetical protein; Validated 97.82
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 97.8
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 97.77
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 97.72
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 97.52
PRK00784492 cobyric acid synthase; Provisional 97.52
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 97.48
COG0523323 Putative GTPases (G3E family) [General function predict 97.47
PRK13896432 cobyrinic acid a,c-diamide synthase; Provisional 97.36
PRK03003474 engA GTP-binding protein EngA; Reviewed 97.35
PRK12374231 putative dithiobiotin synthetase; Provisional 97.34
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 97.29
PRK06835330 DNA replication protein DnaC; Validated 97.27
PRK04040189 adenylate kinase; Provisional 97.23
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 97.15
pfam01591223 6PF2K 6-phosphofructo-2-kinase. This enzyme occurs as a 97.07
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 97.05
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 97.03
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 97.02
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 97.0
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 96.99
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 96.91
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 96.87
PRK00093438 engA GTP-binding protein EngA; Reviewed 96.86
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 96.84
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 96.83
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 96.72
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme meta 96.69
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 96.61
cd04105203 SR_beta Signal recognition particle receptor, beta subu 96.52
COG0486454 ThdF Predicted GTPase [General function prediction only 96.48
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.46
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.45
PRK00093 438 engA GTP-binding protein EngA; Reviewed 96.39
KOG2749415 consensus 96.39
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 96.32
PRK06921265 hypothetical protein; Provisional 96.31
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 96.28
PRK00741 526 prfC peptide chain release factor 3; Provisional 96.23
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 96.22
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 96.22
KOG0734752 consensus 96.2
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 96.2
COG1084346 Predicted GTPase [General function prediction only] 96.19
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.11
COG4586325 ABC-type uncharacterized transport system, ATPase compo 96.11
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 96.11
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.08
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.05
PRK00454196 engB GTPase EngB; Reviewed 96.04
pfam05621302 TniB Bacterial TniB protein. This family consists of se 96.01
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 95.67
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 95.65
COG4555245 NatA ABC-type Na+ transport system, ATPase component [E 95.61
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 95.6
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 95.47
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 95.29
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 95.27
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 95.27
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 95.09
COG1160444 Predicted GTPases [General function prediction only] 95.03
pfam02978100 SRP_SPB Signal peptide binding domain. 99.97
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 99.95
KOG18051100 consensus 97.99
PRK04301318 radA DNA repair and recombination protein RadA; Validat 97.71
CHL00181287 cbbX CbbX; Provisional 97.2
PRK06526254 transposase; Provisional 97.2
PRK08181269 transposase; Validated 97.02
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 97.0
PRK09183258 transposase/IS protein; Provisional 96.98
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 98.79
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 98.7
PRK11519720 tyrosine kinase; Provisional 98.69
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 98.68
PHA02518211 ParA-like protein; Provisional 98.58
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 98.57
cd03114148 ArgK-like The function of this protein family is unkown 98.56
PRK13849231 putative crown gall tumor protein VirC1; Provisional 98.55
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 98.55
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 98.5
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 98.49
PRK09435325 arginine/ornithine transport system ATPase; Provisional 98.46
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 98.43
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.37
cd02117212 NifH_like This family contains the NifH (iron protein) 98.34
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 98.28
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 98.27
COG1192259 Soj ATPases involved in chromosome partitioning [Cell d 98.26
cd03110179 Fer4_NifH_child This protein family's function is unkow 98.2
TIGR01007207 eps_fam capsular exopolysaccharide family; InterPro: IP 98.19
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 98.18
cd02036179 MinD Bacterial cell division requires the formation of 98.13
PRK10818270 cell division inhibitor MinD; Provisional 98.11
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 98.11
PRK13233275 nifH nitrogenase reductase; Reviewed 98.09
PRK13231264 nitrogenase reductase-like protein; Reviewed 98.05
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 98.05
cd03112158 CobW_like The function of this protein family is unkown 97.94
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.9
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 97.88
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 97.82
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 97.81
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 97.81
PRK13232273 nifH nitrogenase reductase; Reviewed 97.78
PRK13235274 nifH nitrogenase reductase; Reviewed 97.71
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 97.71
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 97.7
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.69
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 97.67
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 97.66
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, an A 97.65
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.65
KOG0922 674 consensus 97.64
CHL00175279 minD septum-site determining protein; Validated 97.63
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 97.61
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 97.6
KOG0925 699 consensus 97.55
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 97.54
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 97.48
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 97.47
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 97.44
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.34
smart00487201 DEXDc DEAD-like helicases superfamily. 97.31
KOG2743391 consensus 97.23
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 97.05
cd00881189 GTP_translation_factor GTP translation factor family. T 97.01
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 97.0
PRK12735396 elongation factor Tu; Reviewed 96.82
PRK13342417 recombination factor protein RarA; Reviewed 96.81
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 96.77
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 96.73
COG2403449 Predicted GTPase [General function prediction only] 96.67
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 96.62
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 96.61
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 96.6
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penultimate 96.46
PRK12317426 elongation factor 1-alpha; Reviewed 96.46
PRK00089296 era GTP-binding protein Era; Reviewed 96.39
PRK00007 693 elongation factor G; Reviewed 96.39
TIGR00313502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 96.36
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 96.33
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 96.29
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 96.27
PTZ00141443 elongation factor 1 alpha; Provisional 96.23
CHL00071409 tufA elongation factor Tu 96.22
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 96.2
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 96.19
PRK00049397 elongation factor Tu; Reviewed 96.19
PRK13185269 chlL protochlorophyllide reductase iron-sulfur ATP-bind 96.18
PRK07940395 DNA polymerase III subunit delta'; Validated 96.13
KOG0920 924 consensus 96.1
cd03111106 CpaE_like This protein family consists of proteins simi 96.02
PRK03003 474 engA GTP-binding protein EngA; Reviewed 96.01
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 96.0
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 95.95
TIGR01005778 eps_transp_fam exopolysaccharide transport protein fami 95.94
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 95.94
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 95.94
PRK08058329 DNA polymerase III subunit delta'; Validated 95.92
CHL00072271 chlL photochlorophyllide reductase subunit L 95.82
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.8
PRK12739 693 elongation factor G; Reviewed 95.75
cd02033329 BchX Chlorophyllide reductase converts chlorophylls int 95.74
COG1100219 GTPase SAR1 and related small G proteins [General funct 95.73
PRK13766 764 Hef nuclease; Provisional 95.66
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 95.66
PRK07560 730 elongation factor EF-2; Reviewed 95.63
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 95.63
PRK12736394 elongation factor Tu; Reviewed 95.57
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 95.52
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 95.49
PTZ00110602 helicase; Provisional 95.28
KOG1051898 consensus 95.25
PTZ00336449 elongation factor 1-alpha; Provisional 95.25
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 95.23
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 95.2
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.06
PRK05124475 cysN sulfate adenylyltransferase subunit 1; Provisional 94.98
TIGR00708191 cobA cob(I)alamin adenosyltransferase; InterPro: IPR003 94.93
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 98.62
PRK13869405 plasmid-partitioning protein RepA; Provisional 98.35
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 98.28
PRK13705388 plasmid-partitioning protein SopA; Provisional 98.23
cd02040270 NifH NifH gene encodes component II (iron protein) of n 98.16
PHA02519387 plasmid partition protein SopA; Reviewed 97.9
PRK04328250 hypothetical protein; Provisional 97.8
PRK13230292 nitrogenase reductase-like protein; Reviewed 97.76
pfam06745231 KaiC KaiC. This family represents a conserved region wi 97.7
KOG2878282 consensus 97.54
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 97.49
PRK06696227 uridine kinase; Validated 97.41
cd01124187 KaiC KaiC is a circadian clock protein primarily found 97.4
PRK05595444 replicative DNA helicase; Provisional 97.36
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 97.26
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 97.2
PRK05480209 uridine kinase; Provisional 97.11
PRK03846198 adenylylsulfate kinase; Provisional 97.09
PRK10865 857 protein disaggregation chaperone; Provisional 97.05
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 96.96
PRK00889175 adenylylsulfate kinase; Provisional 96.93
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 96.92
PTZ00301210 uridine kinase; Provisional 96.91
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 96.91
PRK00698204 tmk thymidylate kinase; Validated 96.89
CHL00095 823 clpC Clp protease ATP binding subunit 96.81
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 96.81
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 96.81
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 96.79
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 96.79
PRK09270230 frcK putative fructose transport system kinase; Reviewe 96.79
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 96.79
PRK07667190 uridine kinase; Provisional 96.75
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 96.71
PRK00440318 rfc replication factor C small subunit; Reviewed 96.71
PRK01184183 hypothetical protein; Provisional 96.7
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.7
PRK07471363 DNA polymerase III subunit delta'; Validated 96.65
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.64
PRK09112352 DNA polymerase III subunit delta'; Validated 96.55
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 96.54
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 96.52
pfam00931285 NB-ARC NB-ARC domain. 96.5
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 96.48
pfam02223186 Thymidylate_kin Thymidylate kinase. 96.41
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 96.4
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 96.39
pfam00004131 AAA ATPase family associated with various cellular acti 96.33
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 96.32
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 96.23
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 96.23
TIGR01188343 drrA daunorubicin resistance ABC transporter, ATP-bindi 96.22
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.16
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 96.14
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 96.1
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 96.09
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 96.09
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.08
PRK13974212 thymidylate kinase; Provisional 96.08
PTZ00088225 adenylate kinase 1; Provisional 96.02
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 95.98
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 95.95
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 95.95
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.94
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.93
PRK08769319 DNA polymerase III subunit delta'; Validated 95.9
PRK05564313 DNA polymerase III subunit delta'; Validated 95.87
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 95.85
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.84
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.83
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 95.78
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.77
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 95.75
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.74
PRK10636638 putative ABC transporter ATP-binding protein; Provision 95.73
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.72
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.7
PRK02496185 adk adenylate kinase; Provisional 95.69
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 95.68
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 95.61
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.57
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 95.53
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 95.53
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 95.5
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 95.5
PRK05917290 DNA polymerase III subunit delta'; Validated 95.49
PRK11545177 gntK gluconate kinase 1; Provisional 95.46
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 95.44
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 95.39
PRK10037250 cell division protein; Provisional 95.38
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.36
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 95.36
PRK07933213 thymidylate kinase; Validated 95.32
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 95.3
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 95.28
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 95.25
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.24
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.22
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.19
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.18
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 95.18
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 95.17
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 95.17
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 95.16
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.16
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 95.14
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 95.09
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.09
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.05
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 95.04
PRK12339197 2-phosphoglycerate kinase; Provisional 95.04
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 95.03
pfam04851103 ResIII Type III restriction enzyme, res subunit. 95.03
KOG1533290 consensus 95.0
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.0
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 95.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 94.98
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 94.97
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 94.95
PRK13409 590 putative ATPase RIL; Provisional 94.95
PRK06761281 hypothetical protein; Provisional 94.93
KOG1969 877 consensus 94.92
COG1341398 Predicted GTPase or GTP-binding protein [General functi 98.43
smart00382148 AAA ATPases associated with a variety of cellular activ 98.29
PRK13768253 GTPase; Provisional 98.28
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 97.93
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 97.92
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 97.88
PRK11670369 putative ATPase; Provisional 97.78
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 97.76
KOG0923 902 consensus 97.71
PRK09302501 circadian clock protein KaiC; Reviewed 97.61
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 97.56
PRK12402337 replication factor C small subunit 2; Reviewed 97.55
PRK09401 1176 reverse gyrase; Reviewed 97.53
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 97.53
PRK05541176 adenylylsulfate kinase; Provisional 97.4
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 97.17
PRK05748448 replicative DNA helicase; Provisional 97.15
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.13
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 97.12
PRK07263453 consensus 97.11
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 97.07
PRK13695174 putative NTPase; Provisional 97.05
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 97.05
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 96.98
PRK10875607 recD exonuclease V subunit alpha; Provisional 96.96
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 96.92
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 96.91
PRK13973216 thymidylate kinase; Provisional 96.91
PRK07952242 DNA replication protein DnaC; Validated 96.87
PRK09354350 recA recombinase A; Provisional 96.86
PRK04195403 replication factor C large subunit; Provisional 96.84
PRK13976202 thymidylate kinase; Provisional 96.78
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 96.48
PRK08939306 primosomal protein DnaI; Reviewed 96.44
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 96.39
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 96.37
PRK12377248 putative replication protein; Provisional 96.37
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 96.28
PRK05636507 replicative DNA helicase; Provisional 96.23
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.19
PRK08694468 consensus 96.15
PRK08760476 replicative DNA helicase; Provisional 96.14
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 96.05
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 96.03
PRK00279215 adk adenylate kinase; Reviewed 95.95
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 95.92
COG1484254 DnaC DNA replication protein [DNA replication, recombin 95.88
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 95.87
KOG0926 1172 consensus 95.83
PRK06762166 hypothetical protein; Provisional 95.81
PRK06749428 replicative DNA helicase; Provisional 95.74
PRK01906339 tetraacyldisaccharide 4'-kinase; Provisional 95.72
pfam00406186 ADK Adenylate kinase. 95.7
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 95.67
PRK09860383 putative alcohol dehydrogenase; Provisional 95.62
PRK10624381 L-1,2-propanediol oxidoreductase; Provisional 95.6
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 95.57
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 95.53
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Posttra 95.46
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.41
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 95.3
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 95.29
PHA00729228 NTP-binding motif containing protein 95.25
cd01987124 USP_OKCHK USP domain is located between the N-terminal 94.97
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 98.27
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 98.21
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 97.64
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 97.54
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 97.41
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 97.38
cd02034116 CooC The accessory protein CooC, which contains a nucle 97.38
PRK09302501 circadian clock protein KaiC; Reviewed 97.19
PRK08233182 hypothetical protein; Provisional 97.18
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 97.03
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 96.99
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 96.95
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 96.75
PRK08082453 consensus 96.74
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 96.52
cd03116159 MobB Molybdenum is an essential trace element in the fo 96.43
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 96.27
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 96.13
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 96.01
KOG2004 906 consensus 95.7
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 95.55
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 95.5
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 95.41
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 95.4
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 95.08
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 95.04
pfam0288177 SRP54_N SRP54-type protein, helical bundle domain. 98.18
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 98.09
PRK06067241 flagellar accessory protein FlaH; Validated 97.87
cd01394218 radB RadB. The archaeal protein radB shares similarity 97.84
PTZ00035350 Rad51; Provisional 97.49
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 97.08
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 97.05
PRK11823454 DNA repair protein RadA; Provisional 96.93
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 96.83
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 96.8
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.29
cd02032267 Bchl_like This family of proteins contains bchL and chl 98.08
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 97.77
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 97.71
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 97.68
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 97.66
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 97.66
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 97.64
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 97.62
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 97.61
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 97.44
PRK13234293 nifH nitrogenase reductase; Reviewed 97.28
KOG1532366 consensus 97.28
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 97.19
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 97.19
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 97.18
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 97.16
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 97.13
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 97.09
PRK00313332 lpxK tetraacyldisaccharide 4'-kinase; Provisional 96.89
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 96.86
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 96.84
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 96.71
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.61
CHL00176631 ftsH cell division protein; Validated 96.59
PRK03992390 proteasome-activating nucleotidase; Provisional 96.46
PRK10436461 hypothetical protein; Provisional 96.46
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 96.44
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.37
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.33
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.29
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.24
PRK00652334 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 96.23
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 96.22
PRK07132303 DNA polymerase III subunit delta'; Validated 96.17
pfam02606318 LpxK Tetraacyldisaccharide-1-P 4'-kinase. This family c 96.16
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.11
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 96.03
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.02
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.96
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.92
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.85
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.77
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 95.37
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 95.3
PRK04220306 2-phosphoglycerate kinase; Provisional 97.86
PRK12337492 2-phosphoglycerate kinase; Provisional 97.45
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 97.24
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 96.81
COG4240300 Predicted kinase [General function prediction only] 97.69
PRK07429331 phosphoribulokinase; Provisional 96.04
COG0610 962 Type I site-specific restriction-modification system, R 96.0
TIGR01085494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 95.92
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 97.61
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 97.51
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 97.22
COG3523 1188 IcmF Type VI protein secretion system component VasK [I 96.61
pfam00350168 Dynamin_N Dynamin family. 96.35
PRK12740 670 elongation factor G; Reviewed 96.18
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 95.79
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 97.21
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 96.79
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 95.42
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 97.19
PRK05632 702 phosphate acetyltransferase; Reviewed 96.77
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.09
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.76
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 96.69
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 95.87
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 96.37
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>KOG0780 consensus Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10416 cell division protein FtsY; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0781 consensus Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG0924 consensus Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information