254780712

254780712

30S ribosomal protein S16

GeneID in NCBI database:8209717Locus tag:CLIBASIA_02995
Protein GI in NCBI database:254780712Protein Accession:YP_003065125.1
Gene range:-(553068, 553418)Protein Length:116aa
Gene description:30S ribosomal protein S16
COG prediction:[J] Ribosomal protein S16
KEGG prediction:rpsP; 30S ribosomal protein S16; K02959 small subunit ribosomal protein S16
SEED prediction:SSU ribosomal protein S16p
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKALERLASKKNADEHATT
ccEEEEEEccccccccEEEEEEEcccccccccEEEEccccccccccccccEEEEEHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccc
ccEEEEEEccccccccEEEEEEEcccccccccEEEEccccccccccccccHccccHHHHHHHHHccccccHHHHHHHHHccccccHHHcccccccccHHHHHHHHHHHHHHccccc
mtlkirlacggsksrhhYRIVvansrsprdgkfieklgtwnptlpkenplrfTMNFERIQHWmskgaqptdRILFFLdkaglikrspqnnpkksqpkKKALERLASKknadehatt
mtlkirlacggsksrhhyrivvansrsprdgkfieklgtwnptlpkenpLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGlikrspqnnpkksqpkkkalerlaskknadehatt
MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLIKRspqnnpkksqpkkkALERLASKKNADEHATT
MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLI*********************************
MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLIKRS******************************
*TLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLIKRSP*****************ASKKN*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKALERLASKKNADEHATT
MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKALERLASKKNADEHATT
MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKALERLASKKNADEHATT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target116 30S ribosomal protein S16 [Candidatus Liberibacter asia
315121877109 30S ribosomal protein S16 [Candidatus Liberibacter sola 1 2e-49
304392573170 30S ribosomal protein S16 [Ahrensia sp. R2A130] Length 1 8e-34
15966995124 30S ribosomal protein S16 [Sinorhizobium meliloti 1021] 1 8e-34
222150102123 30S ribosomal protein S16 [Agrobacterium vitis S4] Leng 1 4e-33
15889953126 30S ribosomal protein S16 [Agrobacterium tumefaciens st 1 4e-33
126724937136 ribosomal protein S16 [Rhodobacterales bacterium HTCC21 1 1e-32
319406335122 30S ribosomal protein S16 [Bartonella sp. AR 15-3] Leng 1 1e-32
227823736124 30S ribosomal protein S16 [Sinorhizobium fredii NGR234] 1 2e-32
150398291124 30S ribosomal protein S16 [Sinorhizobium medicae WSM419 1 3e-32
325294070125 30S ribosomal protein S16 [Agrobacterium sp. H13-3] Len 1 4e-32
>gi|315121877|ref|YP_004062366.1| 30S ribosomal protein S16 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 109 Back     alignment and organism information
 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 102/109 (93%)

Query: 1   MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQ 60
           MTLKIRLACGGSK RHHYRIVVANSRSPRDG+FIEK+GTWNPTLPKE+P+RFTM+FERIQ
Sbjct: 1   MTLKIRLACGGSKKRHHYRIVVANSRSPRDGRFIEKIGTWNPTLPKESPMRFTMDFERIQ 60

Query: 61  HWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKALERLASKKN 109
           HW+SKGAQPTDRILFF+DKAGLIKR  +NNPKK+ PK KAL+RL SK N
Sbjct: 61  HWISKGAQPTDRILFFMDKAGLIKRPSRNNPKKAMPKDKALKRLESKNN 109


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|304392573|ref|ZP_07374513.1| 30S ribosomal protein S16 [Ahrensia sp. R2A130] Length = 170 Back     alignment and organism information
>gi|15966995|ref|NP_387348.1| 30S ribosomal protein S16 [Sinorhizobium meliloti 1021] Length = 124 Back     alignment and organism information
>gi|222150102|ref|YP_002551059.1| 30S ribosomal protein S16 [Agrobacterium vitis S4] Length = 123 Back     alignment and organism information
>gi|15889953|ref|NP_355634.1| 30S ribosomal protein S16 [Agrobacterium tumefaciens str. C58] Length = 126 Back     alignment and organism information
>gi|126724937|ref|ZP_01740780.1| ribosomal protein S16 [Rhodobacterales bacterium HTCC2150] Length = 136 Back     alignment and organism information
>gi|319406335|emb|CBI79972.1| 30S ribosomal protein S16 [Bartonella sp. AR 15-3] Length = 122 Back     alignment and organism information
>gi|227823736|ref|YP_002827709.1| 30S ribosomal protein S16 [Sinorhizobium fredii NGR234] Length = 124 Back     alignment and organism information
>gi|150398291|ref|YP_001328758.1| 30S ribosomal protein S16 [Sinorhizobium medicae WSM419] Length = 124 Back     alignment and organism information
>gi|325294070|ref|YP_004279934.1| 30S ribosomal protein S16 [Agrobacterium sp. H13-3] Length = 125 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target116 30S ribosomal protein S16 [Candidatus Liberibacter asia
PRK0004075 PRK00040, rpsP, 30S ribosomal protein S16; Reviewed 2e-27
TIGR0000278 TIGR00002, S16, ribosomal protein S16 1e-24
pfam0088658 pfam00886, Ribosomal_S16, Ribosomal protein S16 2e-20
KOG3419112 KOG3419, KOG3419, KOG3419, Mitochondrial/chloroplast ri 1e-19
PRK14521186 PRK14521, rpsP, 30S ribosomal protein S16; Provisional 4e-19
PRK14520155 PRK14520, rpsP, 30S ribosomal protein S16; Provisional 3e-17
CHL0000582 CHL00005, rps16, ribosomal protein S16 4e-13
PRK1452588 PRK14525, rpsP, 30S ribosomal protein S16; Provisional 6e-13
PRK1452494 PRK14524, rpsP, 30S ribosomal protein S16; Provisional 2e-12
PRK14522116 PRK14522, rpsP, 30S ribosomal protein S16; Provisional 2e-10
COG022887 COG0228, RpsP, Ribosomal protein S16 [Translation, ribo 2e-24
PRK14523137 PRK14523, rpsP, 30S ribosomal protein S16; Provisional 6e-13
>gnl|CDD|178814 PRK00040, rpsP, 30S ribosomal protein S16; Reviewed Back     alignment and domain information
>gnl|CDD|129114 TIGR00002, S16, ribosomal protein S16 Back     alignment and domain information
>gnl|CDD|144471 pfam00886, Ribosomal_S16, Ribosomal protein S16 Back     alignment and domain information
>gnl|CDD|38629 KOG3419, KOG3419, KOG3419, Mitochondrial/chloroplast ribosomal protein S16 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|184725 PRK14521, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|184724 PRK14520, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|176950 CHL00005, rps16, ribosomal protein S16 Back     alignment and domain information
>gnl|CDD|172991 PRK14525, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|172990 PRK14524, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|172988 PRK14522, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|30577 COG0228, RpsP, Ribosomal protein S16 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|172989 PRK14523, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 116 30S ribosomal protein S16 [Candidatus Liberibacter asia
KOG3419112 consensus 100.0
CHL0000582 rps16 ribosomal protein S16 100.0
COG022887 RpsP Ribosomal protein S16 [Translation, ribosomal stru 100.0
PRK0004075 rpsP 30S ribosomal protein S16; Reviewed 100.0
TIGR0000281 S16 ribosomal protein S16; InterPro: IPR000307 Ribosome 99.97
pfam0088658 Ribosomal_S16 Ribosomal protein S16. 99.93
>KOG3419 consensus Back     alignment and domain information
>CHL00005 rps16 ribosomal protein S16 Back     alignment and domain information
>COG0228 RpsP Ribosomal protein S16 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00040 rpsP 30S ribosomal protein S16; Reviewed Back     alignment and domain information
>TIGR00002 S16 ribosomal protein S16; InterPro: IPR000307 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>pfam00886 Ribosomal_S16 Ribosomal protein S16 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target116 30S ribosomal protein S16 [Candidatus Liberibacter asia
1emw_A88 Solution Structure Of The Ribosomal Protein S16 Fro 7e-21
2gy9_P78 Structure Of The 30s Subunit Of A Pre-Translocation 1e-20
3fic_P84 T. Thermophilus 70s Ribosome In Complex With Mrna, 1e-20
1pns_P83 Crystal Structure Of A Streptomycin Dependent Ribos 1e-20
3fih_P80 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 3e-20
1p6g_P82 Real Space Refined Coordinates Of The 30s Subunit F 4e-20
1jgo_S91 Crystal Structure Of The Ribosome At 5.5 A Resoluti 1e-19
3bbn_P88 Homology Model For The Spinach Chloroplast 30s Subu 4e-16
3bn0_A112 The Ribosomal Protein S16 From Aquifex Aeolicus Len 4e-15
gi|10120996|pdb|1EMW|A Chain A, Solution Structure Of The Ribosomal Protein S16 From Thermus Thermophilus Length = 88 Back     alignment and structure
 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 56/88 (63%), Gaps = 2/88 (2%)

Query: 2  TLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQH 61
           +KIRLA  GSK   HYRIVV ++R  RDGK+IEK+G ++P   K  P    ++ ER ++
Sbjct: 1  MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPR--KTTPDWLKVDVERARY 58

Query: 62 WMSKGAQPTDRILFFLDKAGLIKRSPQN 89
          W+S GAQPTD     L +AG+ ++  + 
Sbjct: 59 WLSVGAQPTDTARRLLRQAGVFRQEARE 86


>gi|116667425|pdb|2GY9|P Chain P, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 78 Back     alignment and structure
>gi|224510693|pdb|3FIC|P Chain P, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 84 Back     alignment and structure
>gi|34811544|pdb|1PNS|P Chain P, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 83 Back     alignment and structure
>gi|224510717|pdb|3FIH|P Chain P, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 80 Back     alignment and structure
gi|33357893|pdb|1P6G|P Chain P, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 82 Back     alignment and structure
gi|188036217|pdb|3BBN|P Chain P, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. Length = 88 Back     alignment and structure
gi|189096163|pdb|3BN0|A Chain A, The Ribosomal Protein S16 From Aquifex Aeolicus Length = 112 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target116 30S ribosomal protein S16 [Candidatus Liberibacter asia
3bn0_A112 30S ribosomal protein S16; ribonucleoprotein, ribosome; 1e-28
3mr8_P83 30S ribosomal protein S16; ribosome, termination, RF1, 2e-24
1jgq_S91 30S ribosomal protein S16; ribosome assembly, protein s 2e-24
3bbn_P88 Ribosomal protein S16; small ribosomal subunit, spinach 4e-22
3ofo_P82 30S ribosomal protein S16; protein biosynthesis, riboso 4e-26
3i1m_P82 30S ribosomal protein S16; ribosome structure, protein- 7e-23
>3bn0_A 30S ribosomal protein S16; ribonucleoprotein, ribosome; 2.00A {Aquifex aeolicus} SCOP: d.27.1.1 Length = 112 Back     alignment and structure
 Score =  119 bits (300), Expect = 1e-28
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 5/115 (4%)

Query: 1   MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQ 60
           M ++IRLA  G K    YRIVV +++SPR+GK+I+ LGT++P           +  E+++
Sbjct: 1   MAVRIRLAKFGRKHHPIYRIVVMDAKSPREGKYIDILGTYDPKRKV----LINVYPEKVK 56

Query: 61  HWMSKGAQPTDRILFFLDKAGLIKR-SPQNNPKKSQPKKKALERLASKKNADEHA 114
            W+ KG + + R    L   G++K   P+    K        E+  SKK+    A
Sbjct: 57  EWVLKGVELSHRAKAILWNHGILKEVVPEGYEMKRVGDYYVFEKRESKKSKGGEA 111


>3mr8_P 30S ribosomal protein S16; ribosome, termination, RF1, amber, STOP UAG; 3.62A {Thermus thermophilus} PDB: 1pnx_P 1voq_P 1vos_P 1vov_P 1vox_P 1voz_P 1pns_P 3ms0_P 3fic_P* 1emw_A 1fjg_P* 1hnw_P* 1hnx_P* 1hnz_P* 1hr0_P 1i94_P* 1i95_P* 1i96_P* 1i97_P* 1ibk_P* ... Length = 83 Back     alignment and structure
>3bbn_P Ribosomal protein S16; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 88 Back     alignment and structure
>3ofo_P 30S ribosomal protein S16; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 1p6g_P 1p87_P* 1vs7_P* 2avy_P 2aw7_P 1vs5_P 2i2u_P 2i2p_P* 2qan_P* 2qb9_P* 2qbb_P* 2qbd_P 2qbf_P 2qbh_P* 2qbj_P* 2qou_P* 2qow_P* 2qoy_P* 2qp0_P* 2vho_P ... Length = 82 Back     alignment and structure
>3i1m_P 30S ribosomal protein S16; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1p6g_P 1p87_P* 1vs7_P* 2avy_P 2aw7_P 1vs5_P 2i2u_P 2i2p_P* 2qan_P* 2qb9_P* 2qbb_P* 2qbd_P 2qbf_P 2qbh_P* 2qbj_P* 2qou_P* 2qow_P* 2qoy_P* 2qp0_P* 2vho_P ... Length = 82 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target116 30S ribosomal protein S16 [Candidatus Liberibacter asia
3bn0_A112 30S ribosomal protein S16; ribonucleoprotein, ribosome; 100.0
3bbn_P88 Ribosomal protein S16; small ribosomal subunit, spinach 100.0
3mr8_P83 30S ribosomal protein S16; ribosome, termination, RF1, 100.0
3ofo_P82 30S ribosomal protein S16; protein biosynthesis, riboso 100.0
>3bn0_A 30S ribosomal protein S16; ribonucleoprotein, ribosome; 2.00A {Aquifex aeolicus} SCOP: d.27.1.1 Back     alignment and structure
Probab=100.00  E-value=1e-40  Score=268.28  Aligned_cols=108  Identities=33%  Similarity=0.557  Sum_probs=88.0

Q ss_pred             CCCHHHHHHCCCCCCCEEEEEEEECCCCCCCCCEEEEEEECCCCCCCCCCEEEECHHHHHHHHHCCCCCCHHHHHHHHHC
Q ss_conf             93014123066878882799992067877684102221215678788864479739999999841983568999999972
Q gi|254780712|r    1 MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKA   80 (116)
Q Consensus         1 M~vkIRL~r~G~k~rp~yrIVvadsr~~Rdgk~iE~lG~YnP~~~k~~~~~i~l~~eRi~yWL~~GAqpS~~V~~LL~~~   80 (116)
                      |+|+|||+|+||||+|||||||+|||+||||+|||+||||||+    ++++|.||.|||+|||++||||||+|.+||+.+
T Consensus         1 MavkIRL~r~G~k~~p~yriVv~d~r~~rdgk~iE~lG~YnP~----~~~~i~l~~eri~~Wl~~GAqps~~V~~lL~~~   76 (112)
T 3bn0_A            1 MAVRIRLAKFGRKHHPIYRIVVMDAKSPREGKYIDILGTYDPK----RKVLINVYPEKVKEWVLKGVELSHRAKAILWNH   76 (112)
T ss_dssp             -CEEEEEEEEEETTEEEEEEEEEECC------CSEEEEEEETT----TTEEEEECHHHHHHHHHTTCEEEHHHHHHHHHT
T ss_pred             CCEEEEHHCCCCCCCCEEEEEEEECCCCCCCCCCCCEEEECCC----CCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHC
T ss_conf             9788703108888898578998436878899650232377587----642124689999999987897479999999985


Q ss_pred             CCCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             986668-00051122542889889999874303
Q gi|254780712|r   81 GLIKRS-PQNNPKKSQPKKKALERLASKKNADE  112 (116)
Q Consensus        81 Gl~~~~-~~~~~~~~~~~kk~~e~~~~kk~~~e  112 (116)
                      |+++.. +.....+.....+..++.++++.+.+
T Consensus        77 Gll~~~~~~~~~~k~~~~~~~~ek~~~~~~~~~  109 (112)
T 3bn0_A           77 GILKEVVPEGYEMKRVGDYYVFEKRESKKSKGG  109 (112)
T ss_dssp             THHHHHCCTTEEEEEETTEEEEEECC-------
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             986444544333243442100467999875341



>3bbn_P Ribosomal protein S16; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3mr8_P 30S ribosomal protein S16; ribosome, termination, RF1, amber, STOP UAG; 3.62A {Thermus thermophilus} PDB: 1pnx_P 1voq_P 1vos_P 1vov_P 1vox_P 1voz_P 1pns_P 3ms0_P 3fic_P* 1emw_A 1fjg_P* 1hnw_P* 1hnx_P* 1hnz_P* 1hr0_P 1i94_P* 1i95_P* 1i96_P* 1i97_P* 1ibk_P* ... Back     alignment and structure
>3ofo_P 30S ribosomal protein S16; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 1p6g_P 1p87_P* 1vs7_P* 2avy_P 2aw7_P 1vs5_P 2i2u_P 2i2p_P* 2qan_P* 2qb9_P* 2qbb_P* 2qbd_P 2qbf_P 2qbh_P* 2qbj_P* 2qou_P* 2qow_P* 2qoy_P* 2qp0_P* 2vho_P ... Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 116 30S ribosomal protein S16 [Candidatus Liberibacter asia
d2uubp183 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermo 4e-25
d3bn0a1101 d.27.1.1 (A:2-102) Ribosomal protein S16 {Aquifex aeoli 6e-25
d2gy9p178 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia co 6e-23
>d2uubp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} Length = 83 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S16
superfamily: Ribosomal protein S16
family: Ribosomal protein S16
domain: Ribosomal protein S16
species: Thermus thermophilus [TaxId: 274]
 Score =  107 bits (268), Expect = 4e-25
 Identities = 38/83 (45%), Positives = 55/83 (66%), Gaps = 2/83 (2%)

Query: 3  LKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHW 62
          +KIRLA  GSK   HYRIVV ++R  RDGK+IEK+G ++P     + L+   + ER ++W
Sbjct: 2  VKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKV--DVERARYW 59

Query: 63 MSKGAQPTDRILFFLDKAGLIKR 85
          +S GAQPTD     L +AG+ ++
Sbjct: 60 LSVGAQPTDTARRLLRQAGVFRQ 82


>d3bn0a1 d.27.1.1 (A:2-102) Ribosomal protein S16 {Aquifex aeolicus [TaxId: 63363]} Length = 101 Back     information, alignment and structure
>d2gy9p1 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target116 30S ribosomal protein S16 [Candidatus Liberibacter asia
d2uubp183 Ribosomal protein S16 {Thermus thermophilus [TaxId: 274 100.0
d3bn0a1101 Ribosomal protein S16 {Aquifex aeolicus [TaxId: 63363]} 100.0
d2gy9p178 Ribosomal protein S16 {Escherichia coli [TaxId: 562]} 100.0
>d2uubp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S16
superfamily: Ribosomal protein S16
family: Ribosomal protein S16
domain: Ribosomal protein S16
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=2.9e-37  Score=245.76  Aligned_cols=83  Identities=46%  Similarity=0.765  Sum_probs=79.0

Q ss_pred             CCHHHHHHCCCCCCCEEEEEEEECCCCCCCCCEEEEEEECCCCCCCCCCEEEECHHHHHHHHHCCCCCCHHHHHHHHHCC
Q ss_conf             30141230668788827999920678776841022212156787888644797399999998419835689999999729
Q gi|254780712|r    2 TLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAG   81 (116)
Q Consensus         2 ~vkIRL~r~G~k~rp~yrIVvadsr~~Rdgk~iE~lG~YnP~~~k~~~~~i~l~~eRi~yWL~~GAqpS~~V~~LL~~~G   81 (116)
                      ||+|||+|+||||+|||||||+|+|+||||+|||+||||||+.  .+++.+.||.||++|||++|||||++|..||+++|
T Consensus         1 MvkIRL~R~G~k~~P~yrIVv~d~r~~rdGk~IE~lG~YnP~~--~~~~~i~l~~eRi~~Wl~~GAqpS~tV~~ll~~~g   78 (83)
T d2uubp1           1 MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRK--TTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAG   78 (83)
T ss_dssp             CEEEEEEECSBTTBCCEEEEEEETTSCTTSCCSEEEEEECTTC--CSSCCEEECHHHHHHHHHHTCEECHHHHHHHHHTT
T ss_pred             CEEEECCCCCCCCCCEEEEEEEECCCCCCCCCEEEEEEECCCC--CCCCEEEECHHHHHHHHHCCCCCCHHHHHHHHHCC
T ss_conf             9388121589989985899997668888995651365787998--98744887799999999977977899999999838


Q ss_pred             CCCCC
Q ss_conf             86668
Q gi|254780712|r   82 LIKRS   86 (116)
Q Consensus        82 l~~~~   86 (116)
                      +++.+
T Consensus        79 i~~~e   83 (83)
T d2uubp1          79 VFRQE   83 (83)
T ss_dssp             SSCCC
T ss_pred             CCCCC
T ss_conf             97689



>d3bn0a1 d.27.1.1 (A:2-102) Ribosomal protein S16 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gy9p1 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 116 30S ribosomal protein S16 [Candidatus Liberibacter
3bn0_A_112 (A:) 30S ribosomal protein S16; ribonucleoprotein, 1e-26
3bbn_P_88 (P:) Ribosomal protein S16; small ribosomal subuni 3e-24
1jgq_S_91 (S:) 30S ribosomal protein S16; ribosome assembly, 2e-23
3i1m_P_82 (P:) 30S ribosomal protein S16; ribosome structure 7e-25
>3bn0_A (A:) 30S ribosomal protein S16; ribonucleoprotein, ribosome; 2.00A {Aquifex aeolicus}Length = 112 Back     alignment and structure
 Score =  112 bits (283), Expect = 1e-26
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 6/116 (5%)

Query: 1   MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQ 60
           M ++IRLA  G K    YRIVV +++SPR+GK+I+ LGT++P           +  E+++
Sbjct: 1   MAVRIRLAKFGRKHHPIYRIVVMDAKSPREGKYIDILGTYDPKRKV----LINVYPEKVK 56

Query: 61  HWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKAL--ERLASKKNADEHA 114
            W+ KG + + R    L   G++K       +  +     +  +R + K    E A
Sbjct: 57  EWVLKGVELSHRAKAILWNHGILKEVVPEGYEMKRVGDYYVFEKRESKKSKGGEAA 112


>3bbn_P (P:) Ribosomal protein S16; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 88 Back     alignment and structure
>3i1m_P (P:) 30S ribosomal protein S16; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1p6g_P 1p87_P* 1vs7_P* 2avy_P 2aw7_P 1vs5_P 2i2u_P 2i2p_P* 2qan_P* 2qb9_P* 2qbb_P* 2qbd_P 2qbf_P 2qbh_P* 2qbj_P* 2qou_P* 2qow_P* 2qoy_P* 2qp0_P* 2vho_P ...Length = 82 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target116 30S ribosomal protein S16 [Candidatus Liberibacter asia
3bn0_A_112 30S ribosomal protein S16; ribonucleoprotein, ribo 100.0
3i1m_P_82 30S ribosomal protein S16; ribosome structure, pro 100.0
1jgq_S_91 30S ribosomal protein S16; ribosome assembly, prot 100.0
3bbn_P_88 Ribosomal protein S16; small ribosomal subunit, sp 100.0
>3bn0_A (A:) 30S ribosomal protein S16; ribonucleoprotein, ribosome; 2.00A {Aquifex aeolicus} Back     alignment and structure
Probab=100.00  E-value=2.3e-39  Score=261.01  Aligned_cols=95  Identities=34%  Similarity=0.582  Sum_probs=84.8

Q ss_pred             CCCHHHHHHCCCCCCCEEEEEEEECCCCCCCCCEEEEEEECCCCCCCCCCEEEECHHHHHHHHHCCCCCCHHHHHHHHHC
Q ss_conf             93014123066878882799992067877684102221215678788864479739999999841983568999999972
Q gi|254780712|r    1 MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLPKENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKA   80 (116)
Q Consensus         1 M~vkIRL~r~G~k~rp~yrIVvadsr~~Rdgk~iE~lG~YnP~~~k~~~~~i~l~~eRi~yWL~~GAqpS~~V~~LL~~~   80 (116)
                      |+|+|||+|+||||+|||||||+|+|++|||+|||+||||||+    +++.+.||+||++|||++|||||++|..||+++
T Consensus         1 MavkIRL~r~G~k~~pfYrIVv~d~r~~rdgk~iE~iG~YdP~----~~k~~~l~~~ri~~Wl~~GAqpt~~V~~ll~~~   76 (112)
T 3bn0_A            1 MAVRIRLAKFGRKHHPIYRIVVMDAKSPREGKYIDILGTYDPK----RKVLINVYPEKVKEWVLKGVELSHRAKAILWNH   76 (112)
T ss_dssp             -CEEEEEEEEEETTEEEEEEEEEECC------CSEEEEEEETT----TTEEEEECHHHHHHHHHTTCEEEHHHHHHHHHT
T ss_pred             CCEEEEHHCCCCCCCCEEEEEEEECCCCCCCCCEEEEEEECCC----CCCCEEECHHHHHHHHHCCCCCCHHHHHHHHHC
T ss_conf             9688712008988898578998645777889742035562799----975423689999999997498479999999976


Q ss_pred             CCCCC-CCCCCCHHHHHHHH
Q ss_conf             98666-80005112254288
Q gi|254780712|r   81 GLIKR-SPQNNPKKSQPKKK   99 (116)
Q Consensus        81 Gl~~~-~~~~~~~~~~~~kk   99 (116)
                      |+++. ++.....+....+.
T Consensus        77 gi~~~~~~~~~~~~~~~~~~   96 (112)
T 3bn0_A           77 GILKEVVPEGYEMKRVGDYY   96 (112)
T ss_dssp             THHHHHCCTTEEEEEETTEE
T ss_pred             CCCCCCCCCCCCCCCCCHHH
T ss_conf             97400044555634434132



>3i1m_P (P:) 30S ribosomal protein S16; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1p6g_P 1p87_P* 1vs7_P* 2avy_P 2aw7_P 1vs5_P 2i2u_P 2i2p_P* 2qan_P* 2qb9_P* 2qbb_P* 2qbd_P 2qbf_P 2qbh_P* 2qbj_P* 2qou_P* 2qow_P* 2qoy_P* 2qp0_P* 2vho_P ... Back     alignment and structure
>3bbn_P (P:) Ribosomal protein S16; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure