254780714

254780714

tRNA (guanine-N(1)-)-methyltransferase

GeneID in NCBI database:8209719Locus tag:CLIBASIA_03005
Protein GI in NCBI database:254780714Protein Accession:YP_003065127.1
Gene range:-(551696, 552406)Protein Length:236aa
Gene description:tRNA (guanine-N(1)-)-methyltransferase
COG prediction:[J] tRNA-(guanine-N1)-methyltransferase
KEGG prediction:trmD; tRNA (guanine-N(1)-)-methyltransferase (EC:2.1.1.31); K00554 tRNA (guanine-N1-)-methyltransferase [EC:2.1.1.31]
SEED prediction:tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA modification Archaea;
Ribosome biogenesis bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKGTLNTQ
ccEEEEEEEEcHHHHHHHHHHHHHHHHHHcccEEEEEEEcHHccccccccccccccccccccEEcHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEccEEEcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccHHHccccccHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHccccccccc
cccEEEEEEccHHHcccccccccccHHHHcccEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHcccEEEEEcccccccHHHHHHccccccccccEEEccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHccccccccHHccccHHHHHHHHHHHHHcccHHHcHHHHHHccccccc
mtfhasiltlypemfpghlekSVAGKALACNLWSMDAIQirnfstdrhhsvddtpagggagMVLRVDILGKAIDHAVsqythediprilmsprgktlTQKRVRQLSQKLGVIIVCGRFEGIDERIIEardleeisvgdyilsggePAALILLDAVVRLlpgvlgnqqstiHESFengllefpqytrpqiweglaippilnsgdheRIKKWRKEQSFALtkkhrpdllskkgtlntq
MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSqythediprilmsprgktltqKRVRqlsqklgviivcgrfegIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQsfaltkkhrpdllskkgtlntq
MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKGTLNTQ
*TFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLS*KG*****
MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLS********
*TFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQ****HESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKGT****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKGTLNTQ
MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKGTLNTQ
MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKGTLNTQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe
315121879237 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe 1 1e-111
15889955232 tRNA (guanine-N(1)-)-methyltransferase [Agrobacterium t 1 1e-88
325294072229 tRNA guanine-N1-methyltransferase [Agrobacterium sp. H1 1 1e-87
222150104249 tRNA (guanine-N1)-methyltransferase [Agrobacterium viti 1 1e-86
241206761243 tRNA (guanine-N(1)-)-methyltransferase [Rhizobium legum 1 3e-86
222087528230 tRNA (guanine-N1)-methyltransferase [Agrobacterium radi 1 4e-86
116254278244 tRNA (guanine-N(1)-)-methyltransferase [Rhizobium legum 1 5e-86
209551325233 tRNA (guanine-N(1)-)-methyltransferase [Rhizobium legum 1 7e-86
190893808233 tRNA guanine-N-1-methyltransferase [Rhizobium etli CIAT 1 1e-85
218680102233 tRNA (guanine-N(1)-)-methyltransferase [Rhizobium etli 1 1e-85
>gi|315121879|ref|YP_004062368.1| tRNA (guanine-N(1)-)-methyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 237 Back     alignment and organism information
 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/230 (79%), Positives = 217/230 (94%)

Query: 1   MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGA 60
           MTFHA++LTLYPE+FPGHL KS+AGKALACN+WS+D +QIR+F+TDR++SVDDTPAGGGA
Sbjct: 1   MTFHATVLTLYPEIFPGHLGKSMAGKALACNVWSIDTVQIRHFATDRNNSVDDTPAGGGA 60

Query: 61  GMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEG 120
           GM+L+ D+LGKAIDHA+S+YT +DIPRILMSPRG+ L Q+RVRQ+S K G II+CG FEG
Sbjct: 61  GMILKADVLGKAIDHAISKYTQKDIPRILMSPRGQPLKQERVRQISNKSGAIIICGHFEG 120

Query: 121 IDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLE 180
           +DERI++ARDLEEISVGDYILSGGEPAAL+LLDA+VRLLPGVLGN+QSTIHESFENGLLE
Sbjct: 121 VDERIVKARDLEEISVGDYILSGGEPAALVLLDAIVRLLPGVLGNKQSTIHESFENGLLE 180

Query: 181 FPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKK 230
           FPQYT+PQIWEGL IP +LNSG+HE+I++WR+EQS ALTKKHRPDLLSKK
Sbjct: 181 FPQYTKPQIWEGLRIPSVLNSGNHEKIRQWREEQSLALTKKHRPDLLSKK 230


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15889955|ref|NP_355636.1| tRNA (guanine-N(1)-)-methyltransferase [Agrobacterium tumefaciens str. C58] Length = 232 Back     alignment and organism information
>gi|325294072|ref|YP_004279936.1| tRNA guanine-N1-methyltransferase [Agrobacterium sp. H13-3] Length = 229 Back     alignment and organism information
>gi|222150104|ref|YP_002551061.1| tRNA (guanine-N1)-methyltransferase [Agrobacterium vitis S4] Length = 249 Back     alignment and organism information
>gi|241206761|ref|YP_002977857.1| tRNA (guanine-N(1)-)-methyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 243 Back     alignment and organism information
>gi|222087528|ref|YP_002546065.1| tRNA (guanine-N1)-methyltransferase [Agrobacterium radiobacter K84] Length = 230 Back     alignment and organism information
>gi|116254278|ref|YP_770116.1| tRNA (guanine-N(1)-)-methyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 244 Back     alignment and organism information
>gi|209551325|ref|YP_002283242.1| tRNA (guanine-N(1)-)-methyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 233 Back     alignment and organism information
>gi|190893808|ref|YP_001980350.1| tRNA guanine-N-1-methyltransferase [Rhizobium etli CIAT 652] Length = 233 Back     alignment and organism information
>gi|218680102|ref|ZP_03527999.1| tRNA (guanine-N(1)-)-methyltransferase [Rhizobium etli CIAT 894] Length = 233 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe
PRK00026244 PRK00026, trmD, tRNA (guanine-N(1)-)-methyltransferase; 1e-105
TIGR00088233 TIGR00088, trmD, tRNA (guanine-N1)-methyltransferase 4e-73
PRK01037 357 PRK01037, trmD, tRNA (guanine-N(1)-)-methyltransferase/ 2e-55
PRK14599222 PRK14599, trmD, tRNA (guanine-N(1)-)-methyltransferase/ 3e-37
COG0336240 COG0336, TrmD, tRNA-(guanine-N1)-methyltransferase [Tra 2e-89
pfam01746185 pfam01746, tRNA_m1G_MT, tRNA (Guanine-1)-methyltransfer 3e-33
>gnl|CDD|178803 PRK00026, trmD, tRNA (guanine-N(1)-)-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|129196 TIGR00088, trmD, tRNA (guanine-N1)-methyltransferase Back     alignment and domain information
>gnl|CDD|134469 PRK01037, trmD, tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|173063 PRK14599, trmD, tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|30684 COG0336, TrmD, tRNA-(guanine-N1)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|110724 pfam01746, tRNA_m1G_MT, tRNA (Guanine-1)-methyltransferase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe
TIGR00088247 trmD tRNA (guanine-N1)-methyltransferase; InterPro: IPR 100.0
PRK00026226 trmD tRNA (guanine-N(1)-)-methyltransferase; Reviewed 100.0
COG0336240 TrmD tRNA-(guanine-N1)-methyltransferase [Translation, 100.0
PRK01037 357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown dom 100.0
pfam01746185 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase. This is 100.0
COG1576155 Uncharacterized conserved protein [Function unknown] 96.08
pfam02590155 SPOUT_MTase Predicted SPOUT methyltransferase. This fam 95.87
PRK00103156 SPOUT methyltransferase superfamily protein; Provisiona 95.67
KOG3073236 consensus 90.15
>TIGR00088 trmD tRNA (guanine-N1)-methyltransferase; InterPro: IPR002649 In transfer RNA many different modified nucleosides are found, especially in the anticodon region Back     alignment and domain information
>PRK00026 trmD tRNA (guanine-N(1)-)-methyltransferase; Reviewed Back     alignment and domain information
>COG0336 TrmD tRNA-(guanine-N1)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>pfam01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase Back     alignment and domain information
>COG1576 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam02590 SPOUT_MTase Predicted SPOUT methyltransferase Back     alignment and domain information
>PRK00103 SPOUT methyltransferase superfamily protein; Provisional Back     alignment and domain information
>KOG3073 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe
3ky7_A269 2.35 Angstrom Resolution Crystal Structure Of A Put 4e-79
1p9p_A261 The Crystal Structure Of A M1g37 Trna Methyltransfe 9e-76
1uaj_A274 Crystal Structure Of Trna(M1g37)methyltransferase: 2e-75
3knu_A253 Crystal Structure Of Trna (Guanine-N1)-Methyltransf 2e-72
3ief_A233 Crystal Structure Of Trna Guanine-N1-Methyltransfer 5e-72
3quv_A246 Crystal Structure Of A Trna-Guanine-N1-Methyltransf 5e-64
1oy5_A257 Crystal Structure Of Trna (M1g37) Methyltransferase 9e-60
>gi|281501004|pdb|3KY7|A Chain A, 2.35 Angstrom Resolution Crystal Structure Of A Putative Trna (Guanine-7-)-Methyltransferase (Trmd) From Staphylococcus Aureus Subsp. Aureus Mrsa252 Length = 269 Back     alignment and structure
 Score =  298 bits (764), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 98/233 (42%), Positives = 144/233 (61%), Gaps = 3/233 (1%)

Query: 2   TFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAG 61
                 LTL+PEMF G L  S+  +A   N   ++ +  R+++ ++H+ VDD P GGG G
Sbjct: 24  AMKIDYLTLFPEMFDGVLNHSIMKRAQENNKLQINTVNFRDYAINKHNQVDDYPYGGGQG 83

Query: 62  MVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGI 121
           MVL+ + +  A++        E    ILM P+G+  + ++  +LS+   ++ +CG +EG 
Sbjct: 84  MVLKPEPVFNAMEDLDVT---EQARVILMXPQGEPFSHQKAVELSKADHIVFICGHYEGY 140

Query: 122 DERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEF 181
           DERI      +EIS+GDY+L+GGE  A+ + DA+VRL+PGVLGN+QS   +SF +GLLEF
Sbjct: 141 DERIRTHLVTDEISMGDYVLTGGELPAMTMTDAIVRLIPGVLGNEQSHQDDSFSDGLLEF 200

Query: 182 PQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKGTLN 234
           PQYTRP+ ++GL +P +L SG+H  I  WR EQ    T   RPDL+ K    N
Sbjct: 201 PQYTRPREFKGLTVPDVLLSGNHANIDAWRHEQKLIRTYNKRPDLIEKYPLTN 253


>gi|49258440|pdb|1P9P|A Chain A, The Crystal Structure Of A M1g37 Trna Methyltransferase, Trmd Length = 261 Back     alignment and structure
>gi|33358175|pdb|1UAJ|A Chain A, Crystal Structure Of Trna(M1g37)methyltransferase: Insight Into Trna Recognition Length = 274 Back     alignment and structure
>gi|269914658|pdb|3KNU|A Chain A, Crystal Structure Of Trna (Guanine-N1)-Methyltransferase From Anaplasma Phagocytophilum Length = 253 Back     alignment and structure
>gi|255918022|pdb|3IEF|A Chain A, Crystal Structure Of Trna Guanine-N1-Methyltransferase From Bartonella Henselae Using Mpcs. Length = 233 Back     alignment and structure
>gi|326328080|pdb|3QUV|A Chain A, Crystal Structure Of A Trna-Guanine-N1-Methyltransferase From Mycobacterium Abscessus Length = 246 Back     alignment and structure
gi|39654400|pdb|1OY5|A Chain A, Crystal Structure Of Trna (M1g37) Methyltransferase From Aquifex Aeolicus Length = 257 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe
3ief_A233 TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, 5e-97
3ky7_A269 TRNA (guanine-N(1)-)-methyltransferase; putative tRNA ( 5e-84
1oy5_A257 TRNA (guanine-N(1)-)-methyltransferase; structural geno 4e-80
3knu_A253 TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, 8e-71
1ual_A274 TRNA (guanine-N(1)-)-methyltransferase; spout class, TR 1e-70
2v3j_A258 Essential for mitotic growth 1; EMG1, rRNA processing, 5e-13
>3ief_A TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious diseases; 2.50A {Bartonella henselae} Length = 233 Back     alignment and structure
 Score =  348 bits (896), Expect = 5e-97
 Identities = 141/229 (61%), Positives = 178/229 (77%), Gaps = 5/229 (2%)

Query: 1   MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGA 60
           M F A +LTLYPEMFPG L  S+AG+AL   +WS++ +QIR+F+ D+HHSVDDTPAGGGA
Sbjct: 2   MKFQARVLTLYPEMFPGFLGCSLAGQALKQGIWSLETVQIRDFALDKHHSVDDTPAGGGA 61

Query: 61  GMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEG 120
           GMV+R D+L  A+D         D PR+LMSPRG+ L Q   R L++  GV +VCGRFEG
Sbjct: 62  GMVMRADVLAAALDSC-----PNDSPRLLMSPRGRLLNQAYARSLARSSGVTLVCGRFEG 116

Query: 121 IDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLE 180
           +DERIIEAR+LEE+S+GDYILSGGE AAL+LLDA+VRLLPGV+GN+ S   ESFENGLLE
Sbjct: 117 VDERIIEARELEEVSIGDYILSGGETAALVLLDAIVRLLPGVMGNEISAKCESFENGLLE 176

Query: 181 FPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSK 229
            PQYTRP ++EG  IPP+L SG H+ I  WR++Q+ +LT++ RPDL + 
Sbjct: 177 HPQYTRPAVFEGRGIPPVLTSGHHKAIANWRQQQAESLTRQRRPDLYAL 225


>3ky7_A TRNA (guanine-N(1)-)-methyltransferase; putative tRNA (guanine-7-)-methyltransferase, structural genomics, infectious diseases; 2.35A {Staphylococcus aureus subsp} Length = 269 Back     alignment and structure
>1oy5_A TRNA (guanine-N(1)-)-methyltransferase; structural genomics, TRMD, tRNA (M1G37) methyltransferase, BSGC structure funded by NIH; 2.60A {Aquifex aeolicus} SCOP: c.116.1.4 Length = 257 Back     alignment and structure
>3knu_A TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease; 2.25A {Anaplasma phagocytophilum HZ} Length = 253 Back     alignment and structure
>1ual_A TRNA (guanine-N(1)-)-methyltransferase; spout class, TRMD, tRNA(M1G37) methyltransferase, tRNA modification; HET: SAH; 1.80A {Haemophilus influenzae} SCOP: c.116.1.4 PDB: 1uak_A* 1uaj_A* 1uam_A* 1p9p_A* Length = 274 Back     alignment and structure
>2v3j_A Essential for mitotic growth 1; EMG1, rRNA processing, nuclear protein, ribonucleoprotein, ribosome biogenesis; 2.00A {Saccharomyces cerevisiae} SCOP: c.116.1.6 PDB: 2v3k_A* Length = 258 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe
1ual_A274 TRNA (guanine-N(1)-)-methyltransferase; spout class, TR 100.0
3ky7_A269 TRNA (guanine-N(1)-)-methyltransferase; putative tRNA ( 100.0
3ief_A233 TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, 100.0
3knu_A253 TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, 100.0
1oy5_A257 TRNA (guanine-N(1)-)-methyltransferase; structural geno 100.0
2v3j_A258 Essential for mitotic growth 1; EMG1, rRNA processing, 99.16
1o6d_A163 Hypothetical UPF0247 protein TM0844; structural genomic 97.48
1vh0_A161 Hypothetical UPF0247 protein SAV0024/SA0023; structural 97.25
1to0_A167 Hypothetical UPF0247 protein YYDA; structural genomics, 96.73
1ns5_A155 Hypothetical protein YBEA; structural genomics, PSI, pr 94.25
>1ual_A TRNA (guanine-N(1)-)-methyltransferase; spout class, TRMD, tRNA(M1G37) methyltransferase, tRNA modification; HET: SAH; 1.80A {Haemophilus influenzae} SCOP: c.116.1.4 PDB: 1uak_A* 1uaj_A* 1uam_A* 1p9p_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=768.08  Aligned_cols=234  Identities=45%  Similarity=0.791  Sum_probs=227.4

Q ss_pred             CEEEEEEEECHHHHHHHHCCCHHHHHHHCCCEEEEEECCHHHCCCCCCEEEECCCCCCCCEEEECHHHHHHHHHHHHHCC
Q ss_conf             54589985183564456403367999974965999960256358985135311306888617750588999998753114
Q gi|254780714|r    2 TFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYT   81 (236)
Q Consensus         2 ~Mki~IITlFPe~f~~~l~~sIigkA~~~gli~i~~~dlRdfs~~kh~~VDD~PyGGG~GMVlk~epi~~ai~~~~~~~~   81 (236)
                      .|+|+|||||||||++++++||+|||+++|+|+++++|||||+.|||++|||+||||||||||||||+++|++++++.. 
T Consensus        20 ~M~i~IiTLFPe~f~~~l~~sIigrA~~kgli~i~~~nlRdfs~~kh~~VDD~PyGGG~GMVm~~ePl~~ai~~~~~~~-   98 (274)
T 1ual_A           20 HMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAA-   98 (274)
T ss_dssp             CEEEEEECSCGGGGHHHHSSHHHHHHHHTTSEEEEEECGGGGCCSTTCCCEECCTTCCSCCEECHHHHHHHHHHHHHHH-
T ss_pred             CCEEEEEEECHHHHHHHHHCCHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCCCCCCCCEEECHHHHHHHHHHHHCC-
T ss_conf             7879999988565231433338999998797699987836608898886567868999852664488899999977415-


Q ss_pred             CCCCCEEEECCCCCEECHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCCEEEHHEEECCCCHHHHHHHHHHHHHHCC
Q ss_conf             77830899879987604899999730287599941501144899974045310033401117327799999999985057
Q gi|254780714|r   82 HEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPG  161 (236)
Q Consensus        82 ~~~~~vI~lSP~Gk~l~Q~~a~~ls~~~~liliCGrYEGiDeRvid~~~d~eiSiGDyVLsGGEl~a~v~~dai~RlipG  161 (236)
                      .++.+|||+||||++|||+.|++|+++++|||||||||||||||+|+++|+|||||||||||||+||||++||++||+||
T Consensus        99 ~~~~~VI~lSP~Gk~f~Q~~a~~ls~~~~liliCGrYEGiDeRvie~~vd~eiSIGDyVLsGGEl~AmviiDav~RllPG  178 (274)
T 1ual_A           99 GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPG  178 (274)
T ss_dssp             CTTCEEEEEEEEEEECCHHHHHHHTTCSEEEEECCCTTCCCHHHHHHHCSEEEESSSSCCSCSHHHHHHHHHHHHTTSTT
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCEEEECCCEEEECCHHHHHHHHHHHHHHCCC
T ss_conf             88743998787507666899985335662899965510075999986351585404688608479999999999995788


Q ss_pred             CCCCCCCCCCCCHHCCCCCCCCCCCHHHCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHCHHHHHHHCCCCCC
Q ss_conf             467822233440114884621116725408988984341899899999999999999987686268630563469
Q gi|254780714|r  162 VLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKGTLNTQ  236 (236)
Q Consensus       162 vlg~~~S~~~eSf~~~lLe~P~YTrP~~~~g~~VP~VLlSGnH~~I~~Wr~~~s~~~T~~~RPDL~~~~~~~~~e  236 (236)
                      ||||++|+.+|||+||||||||||||++|+|++||+|||||||++|++||++||+++|+++|||||++.+++++|
T Consensus       179 VLgn~~S~~~eSF~~~lLe~P~YTRP~~~~g~~VPeVLlSGnH~~I~~WR~~~sl~~T~~~RPDLl~~~~l~~~e  253 (274)
T 1ual_A          179 VLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQ  253 (274)
T ss_dssp             CC---------CCSSSSCCCCCCCSCSEETTEECCGGGGSCCHHHHHHHHHHHHHHHHHHHCHHHHHTCCCCHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCHHHHHHCCCCHHH
T ss_conf             668800111145758988898769942129998994224899799999999999999987696899875899999



>3ky7_A TRNA (guanine-N(1)-)-methyltransferase; putative tRNA (guanine-7-)-methyltransferase, structural genomics, infectious diseases; 2.35A {Staphylococcus aureus subsp} Back     alignment and structure
>3ief_A TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious diseases; 2.50A {Bartonella henselae} Back     alignment and structure
>3knu_A TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease; 2.25A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>1oy5_A TRNA (guanine-N(1)-)-methyltransferase; structural genomics, TRMD, tRNA (M1G37) methyltransferase, BSGC structure funded by NIH; 2.60A {Aquifex aeolicus} SCOP: c.116.1.4 Back     alignment and structure
>2v3j_A Essential for mitotic growth 1; EMG1, rRNA processing, nuclear protein, ribonucleoprotein, ribosome biogenesis; 2.00A {Saccharomyces cerevisiae} SCOP: c.116.1.6 PDB: 2v3k_A* Back     alignment and structure
>1o6d_A Hypothetical UPF0247 protein TM0844; structural genomics, unknown function; 1.66A {Thermotoga maritima} SCOP: c.116.1.3 Back     alignment and structure
>1vh0_A Hypothetical UPF0247 protein SAV0024/SA0023; structural genomics, unknown function; 2.31A {Staphylococcus aureus} SCOP: c.116.1.3 Back     alignment and structure
>1to0_A Hypothetical UPF0247 protein YYDA; structural genomics, unknown function, PSI, protein structure initiative; 2.50A {Bacillus subtilis} SCOP: c.116.1.3 Back     alignment and structure
>1ns5_A Hypothetical protein YBEA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.68A {Escherichia coli} SCOP: c.116.1.3 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe
d1uala_252 c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Haem 1e-69
d1oy5a_232 c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Aqui 2e-64
d2v3ka1227 c.116.1.6 (A:25-251) Essential for mitotic growth 1, EM 5e-18
>d1uala_ c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Haemophilus influenzae [TaxId: 727]} Length = 252 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta knot
superfamily: alpha/beta knot
family: tRNA(m1G37)-methyltransferase TrmD
domain: tRNA(m1G37)-methyltransferase TrmD
species: Haemophilus influenzae [TaxId: 727]
 Score =  256 bits (655), Expect = 1e-69
 Identities = 105/226 (46%), Positives = 145/226 (64%), Gaps = 1/226 (0%)

Query: 6   SILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLR 65
            +++L+PEMF    E  V G+A+  NL  ++    R+F+ D+H +VDD P GGG GM++ 
Sbjct: 6   GVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMM 65

Query: 66  VDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERI 125
           V  L  AI  A      E    I +SP+G+ L Q  V +L+Q   +I+VCGR+EGIDER+
Sbjct: 66  VQPLRDAIHTAK-AAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERL 124

Query: 126 IEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHESFENGLLEFPQYT 185
           I+    EE S+GDY+L+GGE  A+ L+DAV R +PGVLG Q S   +SF +GLL+ P YT
Sbjct: 125 IQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYT 184

Query: 186 RPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKG 231
           RP++ EGL +PP+L SG HE I+KWR +QS   T   RP+LL    
Sbjct: 185 RPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLA 230


>d1oy5a_ c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Aquifex aeolicus [TaxId: 63363]} Length = 232 Back     information, alignment and structure
>d2v3ka1 c.116.1.6 (A:25-251) Essential for mitotic growth 1, EMG1 {Saccharomyces cerevisiae [TaxId: 4932]} Length = 227 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe
d1uala_252 tRNA(m1G37)-methyltransferase TrmD {Haemophilus influen 100.0
d1oy5a_232 tRNA(m1G37)-methyltransferase TrmD {Aquifex aeolicus [T 100.0
d2v3ka1227 Essential for mitotic growth 1, EMG1 {Saccharomyces cer 99.31
d1o6da_147 Hypothetical protein TM0844 {Thermotoga maritima [TaxId 96.76
d1vh0a_157 Hypothetical protein SAV0024/SA0023 {Staphylococcus aur 95.21
d1to0a_157 Hypothetical protein YydA {Bacillus subtilis [TaxId: 14 94.43
d1ns5a_153 Hypothetical protein YbeA {Escherichia coli [TaxId: 562 94.17
>d1uala_ c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta knot
superfamily: alpha/beta knot
family: tRNA(m1G37)-methyltransferase TrmD
domain: tRNA(m1G37)-methyltransferase TrmD
species: Haemophilus influenzae [TaxId: 727]
Probab=100.00  E-value=0  Score=769.94  Aligned_cols=234  Identities=45%  Similarity=0.795  Sum_probs=227.4

Q ss_pred             CEEEEEEEECHHHHHHHHCCCHHHHHHHCCCEEEEEECCHHHCCCCCCEEEECCCCCCCCEEEECHHHHHHHHHHHHHCC
Q ss_conf             54589985183564456403367999974965999960256358985135311306888617750588999998753114
Q gi|254780714|r    2 TFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYT   81 (236)
Q Consensus         2 ~Mki~IITlFPe~f~~~l~~sIigkA~~~gli~i~~~dlRdfs~~kh~~VDD~PyGGG~GMVlk~epi~~ai~~~~~~~~   81 (236)
                      .|+|+|||||||||++++++||+|||+++|+|++++||||||+.|||++|||+||||||||||||||+++|++++++. .
T Consensus         2 ~M~i~IiTLFPe~f~~~l~~sIigrA~~~~lv~i~~~nlRdfs~dkhr~VDD~PyGGGpGMVmk~ePl~~ai~~~~~~-~   80 (252)
T d1uala_           2 HMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAA-A   80 (252)
T ss_dssp             CEEEEEECSCGGGGHHHHSSHHHHHHHHTTSEEEEEECGGGGCCSTTCCCEECCTTCCSCCEECHHHHHHHHHHHHHH-H
T ss_pred             CCEEEEEEECHHHHHHHHHCCHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCCCCCCCCEEECHHHHHHHHHHHHC-C
T ss_conf             867999998846401122243899999879669999881661789886727786789986304135688999997640-3


Q ss_pred             CCCCCEEEECCCCCEECHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCCEEEHHEEECCCCHHHHHHHHHHHHHHCC
Q ss_conf             77830899879987604899999730287599941501144899974045310033401117327799999999985057
Q gi|254780714|r   82 HEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPG  161 (236)
Q Consensus        82 ~~~~~vI~lSP~Gk~l~Q~~a~~ls~~~~liliCGrYEGiDeRvid~~~d~eiSiGDyVLsGGEl~a~v~~dai~RlipG  161 (236)
                      .++.+||||||||++|||++|++||+.++|||||||||||||||+|+++|+|||||||||||||+||||++||++||+||
T Consensus        81 ~~~~~vI~lSP~Gk~f~Q~~a~~ls~~~~liliCGrYEGiDeRv~~~~~d~eiSiGDyVLsGGEl~A~v~idai~Rl~PG  160 (252)
T d1uala_          81 GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPG  160 (252)
T ss_dssp             CTTCEEEEEEEEEEECCHHHHHHHTTCSEEEEECCCTTCCCHHHHHHHCSEEEESSSSCCSCSHHHHHHHHHHHHTTSTT
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCEEEECCCEEEECCCHHHHHHHHHHHHHHCC
T ss_conf             77783798889987503699987513562899956510076788875211353314688716645776668999998448


Q ss_pred             CCCCCCCCCCCCHHCCCCCCCCCCCHHHCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHCHHHHHHHCCCCCC
Q ss_conf             467822233440114884621116725408988984341899899999999999999987686268630563469
Q gi|254780714|r  162 VLGNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKHRPDLLSKKGTLNTQ  236 (236)
Q Consensus       162 vlg~~~S~~~eSf~~~lLe~P~YTrP~~~~g~~VP~VLlSGnH~~I~~Wr~~~s~~~T~~~RPDL~~~~~~~~~e  236 (236)
                      ||||++|+.+|||+||||||||||||++|+|++||+|||||||++|++||++||+++|+++|||||+++.++++|
T Consensus       161 vlg~~~S~~~eSF~~~lLe~P~YTrP~~~~g~~VPeVLlSG~H~~I~~Wr~~~sl~~T~~~RPDL~~~~~l~~~~  235 (252)
T d1uala_         161 VLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQ  235 (252)
T ss_dssp             CC---------CCSSSSCCCCCCCSCSEETTEECCGGGGSCCHHHHHHHHHHHHHHHHHHHCHHHHHTCCCCHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHCHHHHHHCCCCHHH
T ss_conf             567732221023548886875224745238999890110799699999999999999987796899866899999



>d1oy5a_ c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2v3ka1 c.116.1.6 (A:25-251) Essential for mitotic growth 1, EMG1 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1o6da_ c.116.1.3 (A:) Hypothetical protein TM0844 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vh0a_ c.116.1.3 (A:) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1to0a_ c.116.1.3 (A:) Hypothetical protein YydA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ns5a_ c.116.1.3 (A:) Hypothetical protein YbeA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus
3ief_A_1-168168 (A:1-168) TRNA (guanine-N(1)-)-methyltransferase; 4e-66
3ky7_A_1-192192 (A:1-192) TRNA (guanine-N(1)-)-methyltransferase; 9e-66
1ual_A_1-189189 (A:1-189) TRNA (guanine-N(1)-)-methyltransferase; 1e-65
3knu_A_1-188188 (A:1-188) TRNA (guanine-N(1)-)-methyltransferase; 1e-65
1oy5_A_1-171171 (A:1-171) TRNA (guanine-N(1)-)-methyltransferase; 2e-63
3ief_A_169-23365 (A:169-233) TRNA (guanine-N(1)-)-methyltransferase 5e-22
1ual_A_190-27485 (A:190-274) TRNA (guanine-N(1)-)-methyltransferase 9e-22
3knu_A_189-25365 (A:189-253) TRNA (guanine-N(1)-)-methyltransferase 8e-21
1oy5_A_172-22150 (A:172-221) TRNA (guanine-N(1)-)-methyltransferase 2e-18
3ky7_A_219-26951 (A:219-269) TRNA (guanine-N(1)-)-methyltransferase 4e-07
>3ief_A (A:1-168) TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious diseases; 2.50A {Bartonella henselae}Length = 168 Back     alignment and structure
 Score =  245 bits (627), Expect = 4e-66
 Identities = 108/172 (62%), Positives = 134/172 (77%), Gaps = 5/172 (2%)

Query: 1   MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGA 60
           M F A +LTLYPEMFPG L  S+AG+AL   +WS++ +QIR+F+ D+HHSVDDTPAGGGA
Sbjct: 2   MKFQARVLTLYPEMFPGFLGCSLAGQALKQGIWSLETVQIRDFALDKHHSVDDTPAGGGA 61

Query: 61  GMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEG 120
           GMV+R D+L  A+D         D PR+LMSPRG+ L Q   R L++  GV +VCGRFEG
Sbjct: 62  GMVMRADVLAAALDSC-----PNDSPRLLMSPRGRLLNQAYARSLARSSGVTLVCGRFEG 116

Query: 121 IDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVLGNQQSTIHE 172
           +DERIIEAR+LEE+S+GDYILSGGE AAL+LLDA+VRLLPGV+GN+ S   E
Sbjct: 117 VDERIIEARELEEVSIGDYILSGGETAALVLLDAIVRLLPGVMGNEISAKCE 168


>3ky7_A (A:1-192) TRNA (guanine-N(1)-)-methyltransferase; putative tRNA (guanine-7-)-methyltransferase, structural genomics, infectious diseases; 2.35A {Staphylococcus aureus subsp}Length = 192 Back     alignment and structure
>1ual_A (A:1-189) TRNA (guanine-N(1)-)-methyltransferase; spout class, TRMD, tRNA(M1G37) methyltransferase, tRNA modification; HET: SAH; 1.80A {Haemophilus influenzae}Length = 189 Back     alignment and structure
>3knu_A (A:1-188) TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease; 2.25A {Anaplasma phagocytophilum HZ}Length = 188 Back     alignment and structure
>1oy5_A (A:1-171) TRNA (guanine-N(1)-)-methyltransferase; structural genomics, TRMD, tRNA (M1G37) methyltransferase, BSGC structure funded by NIH; 2.60A {Aquifex aeolicus}Length = 171 Back     alignment and structure
>3ief_A (A:169-233) TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious diseases; 2.50A {Bartonella henselae}Length = 65 Back     alignment and structure
>1ual_A (A:190-274) TRNA (guanine-N(1)-)-methyltransferase; spout class, TRMD, tRNA(M1G37) methyltransferase, tRNA modification; HET: SAH; 1.80A {Haemophilus influenzae}Length = 85 Back     alignment and structure
>3knu_A (A:189-253) TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease; 2.25A {Anaplasma phagocytophilum HZ}Length = 65 Back     alignment and structure
>1oy5_A (A:172-221) TRNA (guanine-N(1)-)-methyltransferase; structural genomics, TRMD, tRNA (M1G37) methyltransferase, BSGC structure funded by NIH; 2.60A {Aquifex aeolicus}Length = 50 Back     alignment and structure
>3ky7_A (A:219-269) TRNA (guanine-N(1)-)-methyltransferase; putative tRNA (guanine-7-)-methyltransferase, structural genomics, infectious diseases; 2.35A {Staphylococcus aureus subsp}Length = 51 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target236 tRNA (guanine-N(1)-)-methyltransferase [Candidatus Libe
1ual_A_1-189189 TRNA (guanine-N(1)-)-methyltransferase; spout clas 100.0
3ky7_A_1-192192 TRNA (guanine-N(1)-)-methyltransferase; putative t 100.0
3knu_A_1-188188 TRNA (guanine-N(1)-)-methyltransferase; niaid, ssg 100.0
3ief_A_1-168168 TRNA (guanine-N(1)-)-methyltransferase; niaid, ssg 100.0
1oy5_A_1-171171 TRNA (guanine-N(1)-)-methyltransferase; structural 100.0
1o6d_A_163 Hypothetical UPF0247 protein TM0844; structural ge 94.91
1vh0_A_161 Hypothetical UPF0247 protein SAV0024/SA0023; struc 94.22
1ual_A_190-27485 TRNA (guanine-N(1)-)-methyltransferase; spout clas 99.93
3ief_A_169-23365 TRNA (guanine-N(1)-)-methyltransferase; niaid, ssg 99.92
3knu_A_189-25365 TRNA (guanine-N(1)-)-methyltransferase; niaid, ssg 99.9
1oy5_A_172-22150 TRNA (guanine-N(1)-)-methyltransferase; structural 99.79
3ky7_A_219-26951 TRNA (guanine-N(1)-)-methyltransferase; putative t 99.08
2v3j_A_258 Essential for mitotic growth 1; EMG1, rRNA process 96.75
1to0_A_167 Hypothetical UPF0247 protein YYDA; structural geno 95.05
1ns5_A_155 Hypothetical protein YBEA; structural genomics, PS 95.08
>1ual_A (A:1-189) TRNA (guanine-N(1)-)-methyltransferase; spout class, TRMD, tRNA(M1G37) methyltransferase, tRNA modification; HET: SAH; 1.80A {Haemophilus influenzae} Back     alignment and structure
Probab=100.00  E-value=0  Score=545.22  Aligned_cols=170  Identities=44%  Similarity=0.749  Sum_probs=165.2

Q ss_pred             CEEEEEEEECHHHHHHHHCCCHHHHHHHCCCEEEEEECCHHHCCCCCCEEEECCCCCCCCEEEECHHHHHHHHHHHHHCC
Q ss_conf             54589985183564456403367999974965999960256358985135311306888617750588999998753114
Q gi|254780714|r    2 TFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFSTDRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYT   81 (236)
Q Consensus         2 ~Mki~IITlFPe~f~~~l~~sIigkA~~~gli~i~~~dlRdfs~~kh~~VDD~PyGGG~GMVlk~epi~~ai~~~~~~~~   81 (236)
                      .|+|+|+|||||||++++++||+|||+++|+|++++||||||+.||||+|||+||||||||||||||+++|+++++++. 
T Consensus        20 ~M~i~vlTLFPe~f~~~l~~siigrA~~~gl~~i~~~nlRdf~~dkh~~VDD~pyGGG~GMvm~~ePi~~al~~~~~~~-   98 (189)
T 1ual_A           20 HMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAA-   98 (189)
T ss_dssp             CEEEEEECSCGGGGHHHHSSHHHHHHHHTTSEEEEEECGGGGCCSTTCCCEECCTTCCSCCEECHHHHHHHHHHHHHHH-
T ss_pred             CCEEEEEEECHHHHHHHHHCCHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCCCCCCCCCEECHHHHHHHHHHHHHC-
T ss_conf             7889999988564011222348999998797689988826608898866467857899863152256788999987404-


Q ss_pred             CCCCCEEEECCCCCEECHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCCEEEHHEEECCCCHHHHHHHHHHHHHHCC
Q ss_conf             77830899879987604899999730287599941501144899974045310033401117327799999999985057
Q gi|254780714|r   82 HEDIPRILMSPRGKTLTQKRVRQLSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPG  161 (236)
Q Consensus        82 ~~~~~vI~lSP~Gk~l~Q~~a~~ls~~~~liliCGrYEGiDeRvid~~~d~eiSiGDyVLsGGEl~a~v~~dai~RlipG  161 (236)
                      .++++||||||||++|||++|++||++++|+|||||||||||||+|+++|+|||||||||||||+||||++|||+||+||
T Consensus        99 ~~~~~vi~lsP~G~~f~Q~~a~~La~~~~liliCGrYEGiDeRv~~~~vd~EiSIGDyVLtGGElaAmviiDav~RliPG  178 (189)
T 1ual_A           99 GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPG  178 (189)
T ss_dssp             CTTCEEEEEEEEEEECCHHHHHHHTTCSEEEEECCCTTCCCHHHHHHHCSEEEESSSSCCSCSHHHHHHHHHHHHTTSTT
T ss_pred             CCCCCEEECCCCCHHHHHHHHHHHCCCCCEEEEECCEEHHHHHHHHHHCCEEEECCCEEEECCCHHHHHHHHHHHHHHCC
T ss_conf             88984662476515550799997513563899965554076688875312363421488736645665568999988447


Q ss_pred             CCCCCCCCCCC
Q ss_conf             46782223344
Q gi|254780714|r  162 VLGNQQSTIHE  172 (236)
Q Consensus       162 vlg~~~S~~~e  172 (236)
                      ||||++|+++|
T Consensus       179 VLg~~~S~~~e  189 (189)
T 1ual_A          179 VLGKQASAEED  189 (189)
T ss_dssp             CC---------
T ss_pred             CCCCCCCCCCC
T ss_conf             46773222102



>3ky7_A (A:1-192) TRNA (guanine-N(1)-)-methyltransferase; putative tRNA (guanine-7-)-methyltransferase, structural genomics, infectious diseases; 2.35A {Staphylococcus aureus subsp} Back     alignment and structure
>3knu_A (A:1-188) TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease; 2.25A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>3ief_A (A:1-168) TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious diseases; 2.50A {Bartonella henselae} Back     alignment and structure
>1oy5_A (A:1-171) TRNA (guanine-N(1)-)-methyltransferase; structural genomics, TRMD, tRNA (M1G37) methyltransferase, BSGC structure funded by NIH; 2.60A {Aquifex aeolicus} Back     alignment and structure
>1o6d_A (A:) Hypothetical UPF0247 protein TM0844; structural genomics, unknown function; 1.66A {Thermotoga maritima} Back     alignment and structure
>1vh0_A (A:) Hypothetical UPF0247 protein SAV0024/SA0023; structural genomics, unknown function; 2.31A {Staphylococcus aureus} Back     alignment and structure
>1ual_A (A:190-274) TRNA (guanine-N(1)-)-methyltransferase; spout class, TRMD, tRNA(M1G37) methyltransferase, tRNA modification; HET: SAH; 1.80A {Haemophilus influenzae} Back     alignment and structure
>3ief_A (A:169-233) TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious diseases; 2.50A {Bartonella henselae} Back     alignment and structure
>3knu_A (A:189-253) TRNA (guanine-N(1)-)-methyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease; 2.25A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>1oy5_A (A:172-221) TRNA (guanine-N(1)-)-methyltransferase; structural genomics, TRMD, tRNA (M1G37) methyltransferase, BSGC structure funded by NIH; 2.60A {Aquifex aeolicus} Back     alignment and structure
>3ky7_A (A:219-269) TRNA (guanine-N(1)-)-methyltransferase; putative tRNA (guanine-7-)-methyltransferase, structural genomics, infectious diseases; 2.35A {Staphylococcus aureus subsp} Back     alignment and structure
>2v3j_A (A:) Essential for mitotic growth 1; EMG1, rRNA processing, nuclear protein, ribonucleoprotein, ribosome biogenesis; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1to0_A (A:) Hypothetical UPF0247 protein YYDA; structural genomics, unknown function, PSI, protein structure initiative; 2.50A {Bacillus subtilis} Back     alignment and structure
>1ns5_A (A:) Hypothetical protein YBEA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.68A {Escherichia coli} Back     alignment and structure