254780717

254780717

zinc uptake ABC transporter

GeneID in NCBI database:8209722Locus tag:CLIBASIA_03020
Protein GI in NCBI database:254780717Protein Accession:YP_003065130.1
Gene range:+(548673, 549557)Protein Length:294aa
Gene description:zinc uptake ABC transporter
COG prediction:[P] ABC-type Zn2+ transport system, periplasmic component/surface adhesin
KEGG prediction:znuA; zinc uptake ABC transporter; K09815 zinc transport system substrate-binding protein
SEED prediction:Zinc ABC transporter, periplasmic-binding protein ZnuA
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS
cHHHHHHHHHHHHHHcccccccccEEEEEcHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccccEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHc
ccHHHHHEEHHHcccccHHHccccEEEEccHHHHHHHHHHcccccEEEEEEccccccccccccHHHHHHHHcccEEEEccccHHHHHHHHHHHccccccEEEEEccccEEEcccccccccccccccEcccHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEcHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHHHccc
MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMqgigtpallvkgasspheySLRISEAMMLENADIIFWLGAEMESFLvkplhslnkqsnvvtlshspdlhrillrdnhshfhdseaddlhlwlnplnVQYIAHVIAMELIkkdprnkiiyEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDkisclfygpefdsKIIRSITndtgvmsaildpegmliaegPELYFQLMRSMSNSIAKNCS
MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS
MKNfliiliflffilSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS
*KNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNV**************************DDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPM*********SLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS
MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS
*KNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNxxxxxxxxxxxxxxxxxxxxxLHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS
MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS
MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target294 zinc uptake ABC transporter [Candidatus Liberibacter as
254780537294 periplasmic solute binding protein [Candidatus Lib 5e-12
>gi|254780537|ref|YP_003064950.1| periplasmic solute binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 294 Back     alignment
 Score = 63.2 bits (152), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 126/288 (43%), Gaps = 10/288 (3%)

Query: 1   MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEY 60
           M  + I L+F +  +S+ A      V+ S   I  I   I + + T   LV+  +  H Y
Sbjct: 1   MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSY 60

Query: 61  SLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSH 120
            +  ++A+ ++NAD+I   G  +E   +K   +L K + ++T++    ++ I + ++ S 
Sbjct: 61  QVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDG--INPIGVSEDTS- 117

Query: 121 FHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHS 180
             DSE +  H W++  N       I   L   DP N   YE N  E+  ++      L +
Sbjct: 118 -VDSEPNP-HAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKT 175

Query: 181 ILQPV--EKKKIIVFHEAYRYFASHYNL-SIVTFPMSHSVFMGAASLRNIRSKIISDKIS 237
            ++ V  EK+  +       Y A  +   S+  +P++       + +R+  +++ S KI 
Sbjct: 176 RIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIK 235

Query: 238 CLFYGPEFDSKIIRSITNDTGV-MSAILDPEGMLIAEGPE-LYFQLMR 283
            +F       +  + +  +T      +L  + +   +GP   Y  L+R
Sbjct: 236 FIFSESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLR 283

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target294 zinc uptake ABC transporter [Candidatus Liberibacter as
315121882297 zinc uptake ABC transporter [Candidatus Liberibacter so 1 1e-104
222086278313 zinc uptake ABC transporter [Agrobacterium radiobacter 1 2e-60
86358318352 zinc uptake ABC transporter, substrate-binding protein 1 1e-55
241205424344 periplasmic solute binding protein [Rhizobium leguminos 1 2e-55
209549968351 periplasmic solute binding protein [Rhizobium leguminos 1 8e-55
325292922328 High-affinity zinc uptake system protein znuA [Agrobact 1 1e-54
23500837334 zinc ABC transporter periplasmic zinc-binding protein [ 1 7e-54
62317941334 zinc ABC transporter periplasmic zinc-bnding protein [B 1 7e-54
110636330303 periplasmic solute binding protein [Mesorhizobium sp. B 1 7e-54
225628412340 zinc ABC transporter, periplasmic zinc-binding protein 1 7e-54
>gi|315121882|ref|YP_004062371.1| zinc uptake ABC transporter [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 297 Back     alignment and organism information
 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 232/295 (78%), Gaps = 2/295 (0%)

Query: 1   MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEY 60
           MKN LI  IF F +L + +RA SLQVV SIKPIHSIV+ IM G+G P+LLVKG SSPHEY
Sbjct: 1   MKNTLISFIFFFPLLCATSRASSLQVVASIKPIHSIVASIMNGVGKPSLLVKGNSSPHEY 60

Query: 61  SLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSH 120
           SLR S+ MML+NADIIFWLG+EME FLVKPL  ++KQSN++TLS+SP+LH+I L      
Sbjct: 61  SLRPSDTMMLKNADIIFWLGSEMEFFLVKPLGYVDKQSNIITLSNSPNLHKITLPQKQQD 120

Query: 121 FHDSEA--DDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKEL 178
            H   A   D+HLWL P+N +++AHVIA ELIK DP+NK IY KNEE+F  +L +LDKEL
Sbjct: 121 HHHGGAVVYDMHLWLAPINAKHMAHVIAQELIKNDPKNKEIYTKNEEDFGTKLDKLDKEL 180

Query: 179 HSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISC 238
           H IL PV+ KKIIV H AYRYF  HYNL I+   M +++ +GA SL+ I+ +I+S+K+SC
Sbjct: 181 HDILLPVQGKKIIVSHGAYRYFEKHYNLQIIDSIMPNTILLGAKSLQKIKDRIVSEKVSC 240

Query: 239 LFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNC 293
           LFY PEFDSKII+SI N+TG++  +LDPEG+L+ EGP+LYFQL+R++S SIA+NC
Sbjct: 241 LFYEPEFDSKIIQSIANNTGIIVGMLDPEGLLLPEGPDLYFQLLRNLSKSIAQNC 295


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086278|ref|YP_002544811.1| zinc uptake ABC transporter [Agrobacterium radiobacter K84] Length = 313 Back     alignment and organism information
>gi|86358318|ref|YP_470210.1| zinc uptake ABC transporter, substrate-binding protein [Rhizobium etli CFN 42] Length = 352 Back     alignment and organism information
>gi|241205424|ref|YP_002976520.1| periplasmic solute binding protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 344 Back     alignment and organism information
>gi|209549968|ref|YP_002281885.1| periplasmic solute binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 351 Back     alignment and organism information
>gi|325292922|ref|YP_004278786.1| High-affinity zinc uptake system protein znuA [Agrobacterium sp. H13-3] Length = 328 Back     alignment and organism information
>gi|23500837|ref|NP_700277.1| zinc ABC transporter periplasmic zinc-binding protein [Brucella suis 1330] Length = 334 Back     alignment and organism information
>gi|62317941|ref|YP_223794.1| zinc ABC transporter periplasmic zinc-bnding protein [Brucella abortus bv. 1 str. 9-941] Length = 334 Back     alignment and organism information
>gi|110636330|ref|YP_676538.1| periplasmic solute binding protein [Mesorhizobium sp. BNC1] Length = 303 Back     alignment and organism information
>gi|225628412|ref|ZP_03786446.1| zinc ABC transporter, periplasmic zinc-binding protein [Brucella ceti str. Cudo] Length = 340 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target294 zinc uptake ABC transporter [Candidatus Liberibacter as
cd01019286 cd01019, ZnuA, Zinc binding protein ZnuA 4e-59
pfam01297272 pfam01297, SBP_bac_9, Periplasmic solute binding protei 5e-57
PRK09545311 PRK09545, znuA, high-affinity zinc transporter periplas 1e-48
COG0803303 COG0803, LraI, ABC-type metal ion transport system, per 7e-37
cd01017282 cd01017, AdcA, Metal binding protein AcdA 5e-32
cd01018266 cd01018, ZntC, Metal binding protein ZntC 7e-29
cd01137287 cd01137, PsaA, Metal binding protein PsaA 5e-28
cd01016276 cd01016, TroA, Metal binding protein TroA 4e-15
COG4531318 COG4531, ZnuA, ABC-type Zn2+ transport system, periplas 1e-64
cd01145203 cd01145, TroA_c, Periplasmic binding protein TroA_c 5e-16
cd01020264 cd01020, TroA_b, Metal binding protein TroA_b 3e-13
TIGR03772479 TIGR03772, anch_rpt_subst, anchored repeat ABC transpor 1e-10
>gnl|CDD|29738 cd01019, ZnuA, Zinc binding protein ZnuA Back     alignment and domain information
>gnl|CDD|144773 pfam01297, SBP_bac_9, Periplasmic solute binding protein family Back     alignment and domain information
>gnl|CDD|181940 PRK09545, znuA, high-affinity zinc transporter periplasmic component; Reviewed Back     alignment and domain information
>gnl|CDD|31146 COG0803, LraI, ABC-type metal ion transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|29736 cd01017, AdcA, Metal binding protein AcdA Back     alignment and domain information
>gnl|CDD|29737 cd01018, ZntC, Metal binding protein ZntC Back     alignment and domain information
>gnl|CDD|29740 cd01137, PsaA, Metal binding protein PsaA Back     alignment and domain information
>gnl|CDD|29735 cd01016, TroA, Metal binding protein TroA Back     alignment and domain information
>gnl|CDD|34180 COG4531, ZnuA, ABC-type Zn2+ transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|29748 cd01145, TroA_c, Periplasmic binding protein TroA_c Back     alignment and domain information
>gnl|CDD|29739 cd01020, TroA_b, Metal binding protein TroA_b Back     alignment and domain information
>gnl|CDD|163484 TIGR03772, anch_rpt_subst, anchored repeat ABC transporter, substrate-binding protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 294 zinc uptake ABC transporter [Candidatus Liberibacter as
PRK09545308 znuA high-affinity zinc transporter periplasmic compone 100.0
cd01019286 ZnuA Zinc binding protein ZnuA. These proteins have bee 100.0
cd01017282 AdcA Metal binding protein AcdA. These proteins have be 100.0
cd01137287 PsaA Metal binding protein PsaA. These proteins have be 100.0
cd01016276 TroA Metal binding protein TroA. These proteins have be 100.0
cd01018266 ZntC Metal binding protein ZntC. These proteins are pre 100.0
pfam01297272 SBP_bac_9 Periplasmic solute binding protein family. Th 100.0
cd01020264 TroA_b Metal binding protein TroA_b. These proteins are 100.0
COG0803303 LraI ABC-type metal ion transport system, periplasmic c 100.0
COG4531318 ZnuA ABC-type Zn2+ transport system, periplasmic compon 100.0
COG4607320 CeuA ABC-type enterochelin transport system, periplasmi 96.12
cd01145203 TroA_c Periplasmic binding protein TroA_c. These protei 100.0
cd00636148 TroA-like Helical backbone metal receptor (TroA-like do 98.21
cd01977415 Nitrogenase_VFe_alpha Nitrogenase_VFe_alpha -like: Nitr 94.78
>PRK09545 znuA high-affinity zinc transporter periplasmic component; Reviewed Back     alignment and domain information
>cd01019 ZnuA Zinc binding protein ZnuA Back     alignment and domain information
>cd01017 AdcA Metal binding protein AcdA Back     alignment and domain information
>cd01137 PsaA Metal binding protein PsaA Back     alignment and domain information
>cd01016 TroA Metal binding protein TroA Back     alignment and domain information
>cd01018 ZntC Metal binding protein ZntC Back     alignment and domain information
>pfam01297 SBP_bac_9 Periplasmic solute binding protein family Back     alignment and domain information
>cd01020 TroA_b Metal binding protein TroA_b Back     alignment and domain information
>COG0803 LraI ABC-type metal ion transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4531 ZnuA ABC-type Zn2+ transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4607 CeuA ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01145 TroA_c Periplasmic binding protein TroA_c Back     alignment and domain information
>cd00636 TroA-like Helical backbone metal receptor (TroA-like domain) Back     alignment and domain information
>cd01977 Nitrogenase_VFe_alpha Nitrogenase_VFe_alpha -like: Nitrogenase VFe protein, alpha subunit like Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target294 zinc uptake ABC transporter [Candidatus Liberibacter as
1psz_A303 Pneumococcal Surface Antigen Psaa Length = 303 5e-45
2xh8_A291 X-Ray Structure Of 119-141 Znua Deletion Mutant Fro 9e-45
2xqv_A288 The X-Ray Structure Of The Zn(Ii) Bound Znua From S 3e-44
1xvl_A321 The Three-Dimensional Structure Of Mntc From Synech 5e-44
2osv_A284 Crystal Structure Of Znua From E. Coli Length = 284 7e-44
3hh8_A294 Crystal Structure And Metal Binding Properties Of T 3e-43
2ogw_A310 Structure Of Abc Type Zinc Transporter From E. Coli 7e-43
2o1e_A312 Crystal Structure Of The Metal-Dependent Lipoprotei 9e-43
3gi1_A286 Crystal Structure Of The Laminin-Binding Protein Lb 7e-41
3hjt_A287 Structure Of Laminin Binding Protein (Lmb) Of Strep 2e-38
3cx3_A284 Crystal Structure Analysis Of The Streptococcus Pne 1e-37
2ov1_A260 Crystal Structure Of Apo Form Of Znua With Flexible 6e-37
1toa_A313 Periplasmic Zinc Binding Protein Troa From Treponem 1e-35
1pq4_A291 Crystal Structure Of Znua Length = 291 3e-35
1k0f_A277 Crystal Structure Of Zn(Ii)-Free T. Pallidum Troa L 1e-34
3mfq_A282 A Glance Into The Metal Binding Specificity Of Troa 2e-31
>gi|7767025|pdb|1PSZ|A Chain A, Pneumococcal Surface Antigen Psaa Length = 303 Back     alignment and structure
 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 72/287 (25%), Positives = 121/287 (42%), Gaps = 15/287 (5%)

Query: 18  VARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIF 77
                 L+VV +   I  I   I         +V     PHEY     +      AD+IF
Sbjct: 21  TTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIF 80

Query: 78  WLGAEMES----FLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEADDLHLWL 133
           + G  +E+    +  K + +  K  N    + S  +  I L   +    +   +D H WL
Sbjct: 81  YNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQN----EKGKEDPHAWL 136

Query: 134 NPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQ--PVEKKKII 191
           N  N    A  IA +L  KDP NK  YEKN +E+ ++L +LDKE        P EKK I+
Sbjct: 137 NLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIV 196

Query: 192 VFHEAYRYFASHYNL-SIVTFPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKII 250
               A++YF+  Y + S   + ++         ++ +  K+   K+  LF     D + +
Sbjct: 197 TSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPM 256

Query: 251 RSITNDTGVMSAI---LDPEGMLIAEGPELYFQLMRSMSNSIAKNCS 294
           ++++ DT +        D       EG + Y+ +M+   + IA+  +
Sbjct: 257 KTVSQDTNIPIYAQIFTDSIAEQGKEG-DSYYSMMKYNLDKIAEGLA 302


>gi|330689298|pdb|2XH8|A Chain A, X-Ray Structure Of 119-141 Znua Deletion Mutant From Salmonella Enterica Length = 291 Back     alignment and structure
>gi|330689303|pdb|2XQV|A Chain A, The X-Ray Structure Of The Zn(Ii) Bound Znua From Salmonella Enterica Length = 288 Back     alignment and structure
>gi|66360618|pdb|1XVL|A Chain A, The Three-Dimensional Structure Of Mntc From Synechocystis 6803 Length = 321 Back     alignment and structure
>gi|146387330|pdb|2OSV|A Chain A, Crystal Structure Of Znua From E. Coli Length = 284 Back     alignment and structure
>gi|134105166|pdb|2OGW|A Chain A, Structure Of Abc Type Zinc Transporter From E. Coli Length = 310 Back     alignment and structure
>gi|122921273|pdb|2O1E|A Chain A, Crystal Structure Of The Metal-Dependent Lipoprotein Ycdh From Bacillus Subtilis, Northeast Structural Genomics Target Sr583 Length = 312 Back     alignment and structure
>gi|255311808|pdb|3GI1|A Chain A, Crystal Structure Of The Laminin-Binding Protein Lbp Of Streptococcus Pyogenes Length = 286 Back     alignment and structure
>gi|270047650|pdb|3HJT|A Chain A, Structure Of Laminin Binding Protein (Lmb) Of Streptococcus Agalactiae A Bifunctional Protein With Adhesin And Metal Transporting Activity Length = 287 Back     alignment and structure
>gi|195927500|pdb|3CX3|A Chain A, Crystal Structure Analysis Of The Streptococcus Pneumoniae Adcaii Protein Length = 284 Back     alignment and structure
>gi|152149231|pdb|2OV1|A Chain A, Crystal Structure Of Apo Form Of Znua With Flexible Loop Deletion Length = 260 Back     alignment and structure
>gi|5542493|pdb|1TOA|A Chain A, Periplasmic Zinc Binding Protein Troa From Treponema Pallidum Length = 313 Back     alignment and structure
>gi|38492833|pdb|1PQ4|A Chain A, Crystal Structure Of Znua Length = 291 Back     alignment and structure
>gi|20663982|pdb|1K0F|A Chain A, Crystal Structure Of Zn(Ii)-Free T. Pallidum Troa Length = 277 Back     alignment and structure
>gi|328877178|pdb|3MFQ|A Chain A, A Glance Into The Metal Binding Specificity Of Troa: Where Elaborate Behaviors Occur In The Active Center Length = 282 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target294 zinc uptake ABC transporter [Candidatus Liberibacter as
3gi1_A286 LBP, laminin-binding protein of group A streptococci; z 2e-47
1pq4_A291 Periplasmic binding protein component of AN ABC type zi 3e-45
3hh8_A294 Metal ABC transporter substrate-binding lipoprotein; me 2e-43
2prs_A284 High-affinity zinc uptake system protein ZNUA; protein 4e-42
2o1e_A312 YCDH; alpha-beta protein, structural genomics, PSI-2, p 8e-40
3cx3_A284 Lipoprotein; zinc-binding, transport, lipid binding pro 1e-33
1xvl_A321 Mn transporter, MNTC protein; manganese, ABC-type trans 2e-32
1toa_A313 Tromp-1, protein (periplasmic binding protein TROA); zi 1e-31
>3gi1_A LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A Length = 286 Back     alignment and structure
 Score =  184 bits (467), Expect = 2e-47
 Identities = 55/277 (19%), Positives = 105/277 (37%), Gaps = 7/277 (2%)

Query: 21  AGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLG 80
              + VV S  P++++   +   +    ++  GA   H +   +++   + +AD+  +  
Sbjct: 10  TQGMSVVTSFYPMYAMTKEVSGDLNDVRMIQSGAG-IHSFEPSVNDVAAIYDADLFVYHS 68

Query: 81  AEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEAD----DLHLWLNPL 136
             +E++      +L K    V  +  P     +                  D H W +P+
Sbjct: 69  HTLEAWARDLDPNLKKSKVDVFEASKPLTLDRVKGLEDMEVTQGIDPATLYDPHTWTDPV 128

Query: 137 NVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEA 196
                A  IA EL + DP++K  Y KN + FK +  QL +E     + V  K  +  H A
Sbjct: 129 LAGEEAVNIAKELGRLDPKHKDSYTKNAKAFKKEAEQLTEEYTQKFKKVRSKTFVTQHTA 188

Query: 197 YRYFASHYNLSIVTFP-MSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRSITN 255
           + Y A  + L  +    +S         L+ I+  +    +  +F     + KI  +I  
Sbjct: 189 FSYLAKRFGLKQLGISGISPEQEPSPRQLKEIQDFVKEYNVKTIFAEDNVNPKIAHAIAK 248

Query: 256 DTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKN 292
            TG     L P       G + Y + +R+    + + 
Sbjct: 249 STGAKVKTLSPLEAAP-SGNKTYLENLRANLEVLYQQ 284


>1pq4_A Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} SCOP: c.92.2.2 PDB: 2ov3_A 2ov1_A Length = 291 Back     alignment and structure
>2prs_A High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A Length = 284 Back     alignment and structure
>2o1e_A YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis} Length = 312 Back     alignment and structure
>3cx3_A Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae} Length = 284 Back     alignment and structure
>1xvl_A Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} SCOP: c.92.2.2 Length = 321 Back     alignment and structure
>1toa_A Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} SCOP: c.92.2.2 PDB: 1k0f_A Length = 313 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target294 zinc uptake ABC transporter [Candidatus Liberibacter as
2o1e_A312 YCDH; alpha-beta protein, structural genomics, PSI-2, p 100.0
2prs_A284 High-affinity zinc uptake system protein ZNUA; protein 100.0
3cx3_A284 Lipoprotein; zinc-binding, transport, lipid binding pro 100.0
3gi1_A286 LBP, laminin-binding protein of group A streptococci; z 100.0
3hh8_A294 Metal ABC transporter substrate-binding lipoprotein; me 100.0
1toa_A313 Tromp-1, protein (periplasmic binding protein TROA); zi 100.0
1pq4_A291 Periplasmic binding protein component of AN ABC type zi 100.0
1xvl_A321 Mn transporter, MNTC protein; manganese, ABC-type trans 100.0
>2o1e_A YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=0  Score=453.62  Aligned_cols=274  Identities=24%  Similarity=0.394  Sum_probs=243.6

Q ss_pred             CCCCEEEEEECHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCCC
Q ss_conf             23880599972289999999707944178870589983533568024566502578999676610356899973145576
Q gi|254780717|r   20 RAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSN   99 (294)
Q Consensus        20 ~~~~~~Vv~s~~pl~~lv~~I~gd~~~V~~L~~~g~dpH~y~~tp~d~~~l~~Adlii~~G~~~E~~~~~~~~~~~~~~~   99 (294)
                      +.++++||||++|+++||++|+||+++|++|+|+|.|||+|+|+|+|+++|++||+|||||++||+|+.++++.+.+...
T Consensus        18 ~~~kl~VvtS~~pl~~~v~~I~gd~v~V~~li~~g~dPH~ye~~p~d~~~l~~Adliv~~G~~le~~l~~~~~~~~~~~~   97 (312)
T 2o1e_A           18 KGDKLHVVTTFYPMYEFTKQIVKDKGDVDLLIPSSVEPHDWEPTPKDIANIQDADLFVYNSEYMETWVPSAEKSMGQGHA   97 (312)
T ss_dssp             ---CEEEEESSHHHHHHHHHHHGGGEEEEESSCTTSCTTTCCCCHHHHHHHHHSSEEEESCTTTSTTHHHHHHTTCSSSC
T ss_pred             CCCCCEEEEECHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHCCCEEEECCCCHHHHHHHHHHHCCCCCC
T ss_conf             78985899987899999999828951799805989898367589999999971999999287516789999986457784


Q ss_pred             EEEEEECCCCCCCC------CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             79975135446210------012111233212247567765555678999999997421865658899899998631222
Q gi|254780717|r  100 VVTLSHSPDLHRIL------LRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQ  173 (294)
Q Consensus       100 ~i~~~~~~~~~~~~------~~~~~~~~~~~~~~dpH~Wl~p~n~~~~a~~I~~~L~~~dP~~~~~y~~N~~~~~~~L~~  173 (294)
                       +......++..+.      ..+++++++++++.|||+|+||.|++.++++|+++|+++||+++++|++|+++|.++|++
T Consensus        98 -~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~dPH~Wldp~~~~~~a~~I~~~L~~~dP~~~~~y~~n~~~~~~~l~~  176 (312)
T 2o1e_A           98 -VFVNASKGIDLMEGSEEEHEEHDHGEHEHSHAMDPHVWLSPVLAQKEVKNITAQIVKQDPDNKEYYEKNSKEYIAKLQD  176 (312)
T ss_dssp             -EEEETTTTCCCCCC----------------CCCCCGGGGSHHHHHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHH
T ss_pred             -EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             -1454046754332222223456665444457889821330889999999999998521800069999999999988999


Q ss_pred             HHHHHHHHCCCCCCCEEEECCCHHHHHHHHCCCCEEC-CCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHH
Q ss_conf             3589998503002781462062157789874981200-346775444978899999999754993899818889789999
Q gi|254780717|r  174 LDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVT-FPMSHSVFMGAASLRNIRSKIISDKISCLFYGPEFDSKIIRS  252 (294)
Q Consensus       174 l~~~~~~~~~~~~~~~~i~~H~a~~Yf~~~~gl~~~~-~~~~~~~~~s~~~l~~~~~~ik~~~v~~if~e~~~~~~~~~~  252 (294)
                      |++++++.+.+.+++.++++|++|+||+++|||++.+ ++.+++.+||++++.++++.||+++|+|||+|++++++.++.
T Consensus       177 l~~~~~~~~~~~~~~~~v~~H~a~~Yf~~~~gl~~~~~~~~~~~~eps~~~l~~l~~~ik~~~v~~if~e~~~~~~~~~~  256 (312)
T 2o1e_A          177 LDKLYRTTAKKAEKKEFITQHTAFGYLAKEYGLKQVPIAGLSPDQEPSAASLAKLKTYAKEHNVKVIYFEEIASSKVADT  256 (312)
T ss_dssp             HHHHHHHHHHSCSCCEEEESSCTTHHHHHHTTCEEEECSSCCSSSCCCHHHHHHHHHHTTSSCCCEEECSSCCCHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCEEECCCCHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHH
T ss_conf             99999998655124531012430010687689658863035764576756799999999983997899828989099999


Q ss_pred             HHHHHCCCEEEECCCCCCCCC---CCCCHHHHHHHHHHHHHHHCC
Q ss_conf             999719908998053367877---816789999999999987419
Q gi|254780717|r  253 ITNDTGVMSAILDPEGMLIAE---GPELYFQLMRSMSNSIAKNCS  294 (294)
Q Consensus       253 ia~e~~~~~~~ld~~~~~~~~---~~~~Y~~~m~~n~~~l~k~ls  294 (294)
                      |++++|++++.++|++.....   .+.+|++||+.|+++|.++|+
T Consensus       257 la~e~g~~~~~l~~l~~~~~~~~~~~~~Y~~~m~~N~~~i~~aL~  301 (312)
T 2o1e_A          257 LASEIGAKTEVLNTLEGLSKEEQDKGLGYIDIMKQNLDALKDSLL  301 (312)
T ss_dssp             HHHHTCCEEECCCCTTCCCHHHHHHCCCHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             999829976644566566645687647799999999999999866



>2prs_A High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A Back     alignment and structure
>3cx3_A Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae} Back     alignment and structure
>3gi1_A LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A Back     alignment and structure
>1toa_A Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} SCOP: c.92.2.2 PDB: 1k0f_A Back     alignment and structure
>1pq4_A Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} SCOP: c.92.2.2 PDB: 2ov3_A 2ov1_A Back     alignment and structure
>1xvl_A Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} SCOP: c.92.2.2 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 294 zinc uptake ABC transporter [Candidatus Liberibacter as
d1pq4a_289 c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Sy 1e-38
d1psza_286 c.92.2.2 (A:) Pneumococcal surface antigen PssA {Pneumo 2e-34
d1xvla1279 c.92.2.2 (A:49-327) Mn transporter MntC {Synechocystis 2e-32
d1toaa_277 c.92.2.2 (A:) Periplasmic zinc binding protein TroA {Tr 1e-31
>d1pq4a_ c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 289 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Chelatase-like
superfamily: "Helical backbone" metal receptor
family: TroA-like
domain: Periplasmic zinc binding protein ZnuA
species: Synechocystis sp. pcc 6803 [TaxId: 1148]
 Score =  153 bits (388), Expect = 1e-38
 Identities = 69/295 (23%), Positives = 121/295 (41%), Gaps = 32/295 (10%)

Query: 24  LQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEM 83
           + + VSI P    +  I   +   ++LV G + PH Y  +  +   L  A+    +G   
Sbjct: 3   MDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGF 62

Query: 84  ESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEAD---------------- 127
           E   ++ L + N    ++  +       +   D+     +   D                
Sbjct: 63  EQPWLEKLKAANANMKLIDSAQGITPLEMEKHDHSHGEEEGHDDHSHDGHDHGSESEKEK 122

Query: 128 --------DLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELH 179
                   D H+WL+P  V+  A  IA EL + DP N+  YE N   F  +L +L++EL 
Sbjct: 123 AKGALMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQELG 182

Query: 180 SILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKISCL 239
            ILQP+ ++K IVFH ++ YFA  YNL +            A  L+ +      + ++ +
Sbjct: 183 QILQPLPQRKFIVFHPSWAYFARDYNL-VQIPIEVEGQEPSAQELKQLIDTAKENNLTMV 241

Query: 240 FYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS 294
           F   +F +K   +I  + G    +LDP           +   +++++  IA   S
Sbjct: 242 FGETQFSTKSSEAIAAEIGAGVELLDPLA-------ADWSSNLKAVAQKIANANS 289


>d1psza_ c.92.2.2 (A:) Pneumococcal surface antigen PssA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} Length = 286 Back     information, alignment and structure
>d1xvla1 c.92.2.2 (A:49-327) Mn transporter MntC {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 279 Back     information, alignment and structure
>d1toaa_ c.92.2.2 (A:) Periplasmic zinc binding protein TroA {Treponema pallidum [TaxId: 160]} Length = 277 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target294 zinc uptake ABC transporter [Candidatus Liberibacter as
d1pq4a_289 Periplasmic zinc binding protein ZnuA {Synechocystis sp 100.0
d1psza_286 Pneumococcal surface antigen PssA {Pneumococcus (Strept 100.0
d1xvla1279 Mn transporter MntC {Synechocystis sp. pcc 6803 [TaxId: 100.0
d1toaa_277 Periplasmic zinc binding protein TroA {Treponema pallid 100.0
>d1pq4a_ c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Chelatase-like
superfamily: "Helical backbone" metal receptor
family: TroA-like
domain: Periplasmic zinc binding protein ZnuA
species: Synechocystis sp. pcc 6803 [TaxId: 1148]
Probab=100.00  E-value=0  Score=456.44  Aligned_cols=265  Identities=25%  Similarity=0.399  Sum_probs=238.1

Q ss_pred             CCEEEEEECHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCCCEE
Q ss_conf             88059997228999999970794417887058998353356802456650257899967661035689997314557679
Q gi|254780717|r   22 GSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVV  101 (294)
Q Consensus        22 ~~~~Vv~s~~pl~~lv~~I~gd~~~V~~L~~~g~dpH~y~~tp~d~~~l~~Adlii~~G~~~E~~~~~~~~~~~~~~~~i  101 (294)
                      .+++||||++|+++||++|+||+++|++|+|+|.|||+|+|||+|+++|++||+|||||.+||.|+.+.+.+.+++..++
T Consensus         1 d~l~Vv~si~pl~~lv~~i~gd~~~V~~L~p~g~dPH~y~~~psd~~~l~~ADliv~~G~~lE~~~~~~~~~~~~~~~~v   80 (289)
T d1pq4a_           1 DAMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGFEQPWLEKLKAANANMKLI   80 (289)
T ss_dssp             CCEEEEESSHHHHHHHHHHHGGGEEEEESSCTTSCGGGCCCCHHHHHHGGGCSEEEECCTTTTTTTHHHHHHHCSSSEEE
T ss_pred             CCCEEEEECHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCCCCCC
T ss_conf             99889997689999999983893479980698979835768999999996599999969632678999998745698741


Q ss_pred             EEEECCCCCCCC------------------------CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             975135446210------------------------01211123321224756776555567899999999742186565
Q gi|254780717|r  102 TLSHSPDLHRIL------------------------LRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNK  157 (294)
Q Consensus       102 ~~~~~~~~~~~~------------------------~~~~~~~~~~~~~~dpH~Wl~p~n~~~~a~~I~~~L~~~dP~~~  157 (294)
                      ..+.+.......                        ..++++++|+++..|||+||||.|++.++++|+++|+++||+++
T Consensus        81 ~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DPH~Wldp~n~~~~a~~I~~~L~~~dP~~~  160 (289)
T d1pq4a_          81 DSAQGITPLEMEKHDHSHGEEEGHDDHSHDGHDHGSESEKEKAKGALMVADPHIWLSPTLVKRQATTIAKELAELDPDNR  160 (289)
T ss_dssp             ETTTTCCCCBSCC----------------------------------CCBCCCGGGCHHHHHHHHHHHHHHHHHHCGGGH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             02366443110135665532466665544564455421211000133455512200430178999999999987504203


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHCCCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             88998999986312223589998503002781462062157789874981200346775444978899999999754993
Q gi|254780717|r  158 IIYEKNEEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAASLRNIRSKIISDKIS  237 (294)
Q Consensus       158 ~~y~~N~~~~~~~L~~l~~~~~~~~~~~~~~~~i~~H~a~~Yf~~~~gl~~~~~~~~~~~~~s~~~l~~~~~~ik~~~v~  237 (294)
                      +.|++|+++|.++|.+|++++++++++++++.++++||+|+||+++|||++.++. .++.+||++++.++++.+|+++|+
T Consensus       161 ~~y~~N~~~~~~~L~~l~~~~~~~l~~~~~~~~v~~H~a~~Yf~~~ygl~~~~~~-~~~~eps~~~l~~l~~~ik~~~i~  239 (289)
T d1pq4a_         161 DQYEANLAAFLAELERLNQELGQILQPLPQRKFIVFHPSWAYFARDYNLVQIPIE-VEGQEPSAQELKQLIDTAKENNLT  239 (289)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTTCSCCEEEESSCCCHHHHHHTTCEEEESC-BTTBCCCHHHHHHHHHHHHTTTCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHCCCEEEEEE-CCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             4565518988765899989999872532478323325328779885485044421-368899989999999999974998


Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             899818889789999999719908998053367877816789999999999987419
Q gi|254780717|r  238 CLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQLMRSMSNSIAKNCS  294 (294)
Q Consensus       238 ~if~e~~~~~~~~~~ia~e~~~~~~~ld~~~~~~~~~~~~Y~~~m~~n~~~l~k~ls  294 (294)
                      |||+|+|++++.++.|++++|++++.+||+|.       +|.++|+.|+++|++|+|
T Consensus       240 ~if~e~q~~~~~~~~la~~~gv~v~~ldpl~~-------~y~~~m~~n~~~i~~A~s  289 (289)
T d1pq4a_         240 MVFGETQFSTKSSEAIAAEIGAGVELLDPLAA-------DWSSNLKAVAQKIANANS  289 (289)
T ss_dssp             EEEEETTSCCHHHHHHHHHHTCEEEEECTTCS-------SHHHHHHHHHHHHHHHHC
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCC-------CHHHHHHHHHHHHHHHCC
T ss_conf             99973898939999999980998798788732-------599999999999998649



>d1psza_ c.92.2.2 (A:) Pneumococcal surface antigen PssA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} Back     information, alignment and structure
>d1xvla1 c.92.2.2 (A:49-327) Mn transporter MntC {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1toaa_ c.92.2.2 (A:) Periplasmic zinc binding protein TroA {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 294 zinc uptake ABC transporter [Candidatus Liberibact
2o1e_A_1-189_284-312218 (A:1-189,A:284-312) YCDH; alpha-beta protein, stru 3e-30
1xvl_A_1-201_292-321231 (A:1-201,A:292-321) Mn transporter, MNTC protein; 5e-30
1pq4_A_1-188_271-291209 (A:1-188,A:271-291) Periplasmic binding protein co 3e-29
3cx3_A_1-176_262-284199 (A:1-176,A:262-284) Lipoprotein; zinc-binding, tra 2e-28
3hh8_A_1-179179 (A:1-179) Metal ABC transporter substrate-binding 7e-28
3gi1_A_1-177177 (A:1-177) LBP, laminin-binding protein of group A 6e-26
1toa_A_1-195195 (A:1-195) Tromp-1, protein (periplasmic binding pr 3e-25
2prs_A_1-172172 (A:1-172) High-affinity zinc uptake system protein 2e-24
2prs_A_173-284112 (A:173-284) High-affinity zinc uptake system prote 3e-18
3hh8_A_180-294115 (A:180-294) Metal ABC transporter substrate-bindin 5e-18
3gi1_A_178-286109 (A:178-286) LBP, laminin-binding protein of group 1e-16
1toa_A_196-313118 (A:196-313) Tromp-1, protein (periplasmic binding 1e-16
3cx3_A_177-26185 (A:177-261) Lipoprotein; zinc-binding, transport, 1e-14
1xvl_A_202-29190 (A:202-291) Mn transporter, MNTC protein; manganes 2e-14
2o1e_A_190-27182 (A:190-271) YCDH; alpha-beta protein, structural g 2e-14
1pq4_A_189-27082 (A:189-270) Periplasmic binding protein component 1e-13
>2o1e_A (A:1-189,A:284-312) YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis}Length = 218 Back     alignment and structure
 Score =  126 bits (317), Expect = 3e-30
 Identities = 41/177 (23%), Positives = 79/177 (44%), Gaps = 7/177 (3%)

Query: 16  SSVARAGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADI 75
           S+ ++   L VV +  P +     I++  G   LL+  +  PH++     +   +++AD+
Sbjct: 14  SADSKGDKLHVVTTFYPXYEFTKQIVKDKGDVDLLIPSSVEPHDWEPTPKDIANIQDADL 73

Query: 76  IFWLGAEMESFLVKPLHSLNKQSNVVTLSHSPDLHRILLRDNHSHFHDSEAD------DL 129
             +     E+++     S  +  + V ++ S  +      +     HD          D 
Sbjct: 74  FVYNSEYXETWVPSAEKSXGQ-GHAVFVNASKGIDLXEGSEEEHEEHDHGEHEHSHAXDP 132

Query: 130 HLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHSILQPVE 186
           H+WL+P+  Q     I  +++K+DP NK  YEKN +E+  +L  LDK   +  +  E
Sbjct: 133 HVWLSPVLAQKEVKNITAQIVKQDPDNKEYYEKNSKEYIAKLQDLDKLYRTTAKKAE 189


>1xvl_A (A:1-201,A:292-321) Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP}Length = 231 Back     alignment and structure
>1pq4_A (A:1-188,A:271-291) Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP}Length = 209 Back     alignment and structure
>3cx3_A (A:1-176,A:262-284) Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae}Length = 199 Back     alignment and structure
>3gi1_A (A:1-177) LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_ALength = 177 Back     alignment and structure
>1toa_A (A:1-195) Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum}Length = 195 Back     alignment and structure
>2prs_A (A:1-172) High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_ALength = 172 Back     alignment and structure
>2prs_A (A:173-284) High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_ALength = 112 Back     alignment and structure
>3gi1_A (A:178-286) LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_ALength = 109 Back     alignment and structure
>1toa_A (A:196-313) Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum}Length = 118 Back     alignment and structure
>3cx3_A (A:177-261) Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae}Length = 85 Back     alignment and structure
>1xvl_A (A:202-291) Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP}Length = 90 Back     alignment and structure
>2o1e_A (A:190-271) YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis}Length = 82 Back     alignment and structure
>1pq4_A (A:189-270) Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP}Length = 82 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target294 zinc uptake ABC transporter [Candidatus Liberibacter as
1xvl_A_1-201_292-321231 Mn transporter, MNTC protein; manganese, ABC-type 100.0
1pq4_A_1-188_271-291209 Periplasmic binding protein component of AN ABC ty 100.0
1toa_A_1-195195 Tromp-1, protein (periplasmic binding protein TROA 100.0
2o1e_A_1-189_284-312218 YCDH; alpha-beta protein, structural genomics, PSI 100.0
3hh8_A_1-179179 Metal ABC transporter substrate-binding lipoprotei 100.0
2prs_A_1-172172 High-affinity zinc uptake system protein ZNUA; pro 100.0
3cx3_A_1-176_262-284199 Lipoprotein; zinc-binding, transport, lipid bindin 100.0
3gi1_A_1-177177 LBP, laminin-binding protein of group A streptococ 100.0
2prs_A_173-284112 High-affinity zinc uptake system protein ZNUA; pro 99.9
3hh8_A_180-294115 Metal ABC transporter substrate-binding lipoprotei 99.9
3gi1_A_178-286109 LBP, laminin-binding protein of group A streptococ 99.89
1toa_A_196-313118 Tromp-1, protein (periplasmic binding protein TROA 99.89
1xvl_A_202-29190 Mn transporter, MNTC protein; manganese, ABC-type 99.78
3cx3_A_177-26185 Lipoprotein; zinc-binding, transport, lipid bindin 99.76
1pq4_A_189-27082 Periplasmic binding protein component of AN ABC ty 99.77
2o1e_A_190-27182 YCDH; alpha-beta protein, structural genomics, PSI 99.76
>1xvl_A (A:1-201,A:292-321) Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} Back     alignment and structure
Probab=100.00  E-value=9.4e-44  Score=297.88  Aligned_cols=176  Identities=19%  Similarity=0.292  Sum_probs=159.6

Q ss_pred             CCCEEEEEECHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCCCE
Q ss_conf             38805999722899999997079441788705899835335680245665025789996766103568999731455767
Q gi|254780717|r   21 AGSLQVVVSIKPIHSIVSCIMQGIGTPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNV  100 (294)
Q Consensus        21 ~~~~~Vv~s~~pl~~lv~~I~gd~~~V~~L~~~g~dpH~y~~tp~d~~~l~~Adlii~~G~~~E~~~~~~~~~~~~~~~~  100 (294)
                      .++++||||++|+++++++|+||+++|++|+|+|.|||+|||||+|++++++||+|||+|.+||+|+.+++.+. ++.++
T Consensus        43 ~~~l~VvaT~~pl~~~vk~IaGd~v~V~~Li~~g~dPH~yeptp~d~~~i~~ADlii~~G~~~e~~l~~~~~~~-~~~~~  121 (231)
T 1xvl_A           43 EEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNV-KDVPS  121 (231)
T ss_dssp             CCCCEEEESSHHHHHHHHHHHTTTSEEEESSCSSCCCSSCCCCHHHHHHHHTCSEEEECCTTSSTTHHHHHHTS-SSCCE
T ss_pred             CCCCEEEEECHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHHHHHHHCCCEEEECCCCCCHHHHHHHHHC-CCCCC
T ss_conf             89858999775999999998088269998269897953576899999999669999995997308999987633-45542


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99751354462100121112332122475677655556789999999974218656588998999986312223589998
Q gi|254780717|r  101 VTLSHSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKNEEEFKNQLSQLDKELHS  180 (294)
Q Consensus       101 i~~~~~~~~~~~~~~~~~~~~~~~~~~dpH~Wl~p~n~~~~a~~I~~~L~~~dP~~~~~y~~N~~~~~~~L~~l~~~~~~  180 (294)
                      +.++++.+..      +..++++++..|||+|+||.|++.++++|++.|+++||+++++|++|+++|.++|+++++++++
T Consensus       122 i~~~~~~~~~------~~~~~~~~~~~dPH~Wldp~~~~~~a~~I~~~L~~~dP~~~~~y~~N~~~~~~~L~~l~~~~~~  195 (231)
T 1xvl_A          122 VVLTEGIEPI------PIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGA  195 (231)
T ss_dssp             EETTTTCCCC------BCCSSSSTTSBCCCGGGSHHHHHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCC------CCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             0111354555------4346765356761110165889999999999987638012579999999999778888999998


Q ss_pred             HCCCCCCCEEEECCCHHHHHHHH
Q ss_conf             50300278146206215778987
Q gi|254780717|r  181 ILQPVEKKKIIVFHEAYRYFASH  203 (294)
Q Consensus       181 ~~~~~~~~~~i~~H~a~~Yf~~~  203 (294)
                      .+++++..++-++-|-+.|=+|-
T Consensus       196 ~~~~i~~~~~~~~~~~~~~~~~~  218 (231)
T 1xvl_A          196 DLEQVPEGPVPTFLDLLEYDARV  218 (231)
T ss_dssp             HHTTSCSSSCCSHHHHHHHHHHH
T ss_pred             HHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             76427798867799999999999



>1pq4_A (A:1-188,A:271-291) Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} Back     alignment and structure
>1toa_A (A:1-195) Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} Back     alignment and structure
>2o1e_A (A:1-189,A:284-312) YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis} Back     alignment and structure
>2prs_A (A:1-172) High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A Back     alignment and structure
>3cx3_A (A:1-176,A:262-284) Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae} Back     alignment and structure
>3gi1_A (A:1-177) LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A Back     alignment and structure
>2prs_A (A:173-284) High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A Back     alignment and structure
>3gi1_A (A:178-286) LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A Back     alignment and structure
>1toa_A (A:196-313) Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} Back     alignment and structure
>1xvl_A (A:202-291) Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} Back     alignment and structure
>3cx3_A (A:177-261) Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae} Back     alignment and structure
>1pq4_A (A:189-270) Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} Back     alignment and structure
>2o1e_A (A:190-271) YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis} Back     alignment and structure