254780716

254780716

6-phosphogluconate dehydrogenase

GeneID in NCBI database:8209721Locus tag:CLIBASIA_03015
Protein GI in NCBI database:254780716Protein Accession:YP_003065129.1
Gene range:-(549554, 550981)Protein Length:475aa
Gene description:6-phosphogluconate dehydrogenase
COG prediction:[G] 6-phosphogluconate dehydrogenase
KEGG prediction:gnd; 6-phosphogluconate dehydrogenase (EC:1.1.1.44); K00033 6-phosphogluconate dehydrogenase [EC:1.1.1.44]
SEED prediction:6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)
Pathway involved in KEGG:Pentose phosphate pathway [PATH:las00030]
Glutathione metabolism [PATH:las00480]
Subsystem involved in SEED:Pentose phosphate pathway;
Formaldehyde assimilation: Ribulose monophosphate pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES
cccccEEEEEccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHcccccccccccHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccEEEccccccHHHHHcccEEEccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHcHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccEEHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEcccccccccccccccccc
cccEcEEEEcccHHHHHHHHHHHcccccEEEEccccHHHHHHHHcccccccccEEcccHHHHHHHEccccEEEEcccccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHcccEEEEEEEEcHHHHHHHccEEEEEEccccHHHHHHHHHHHccEcccccEccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEHHHHHHHHHHHcEcccccccHHHHHHHHHcccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccEcHHHHHHHHHHHccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEcEcccccccccccHHccccc
MKQADIGIIglgsmgsnlslnildkGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKilmmvtdgdpvdQLIDKlkpllspedilldggnshfcdTQIRSLQLSEKGIYFIGIgvsggvkgarsgaslmvggnekayNRVENILLSISAkyqnspccallgpdgsghFVKMIHNGIEYANMQLIADIYGILRDslnknpleishlfskwdtgklSSYLIKITAEIlsssdtitgmPIIDVICdkasqkgtgiRSIIeghklsssmtITETAIFARNLSLyrdeskkmqsffnpsshfplkcFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSltedpsstnllnipsisekvkktiPSLRRIVVTctengypvpslsaALSYFDTFIHDRGTANLIQAQRDffgshgfdrkdkisephgpwqkvstes
MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIlsssdtitgMPIIDVICDKASQKGTGIRSIieghklsssmtiTETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLtedpsstnllnipsisekvkktipSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKdkisephgpwqkvstes
MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES
**QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSL**********************FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHG**Q******
MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP***********
*KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW**V****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES
MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES
MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target475 6-phosphogluconate dehydrogenase [Candidatus Liberibact
315121881473 6-phosphogluconate dehydrogenase [Candidatus Liberibact 1 0.0
222086194489 6-phosphogluconate dehydrogenase (decarboxylating) [Agr 1 1e-136
15965685476 6-phosphogluconate dehydrogenase [Sinorhizobium melilot 1 1e-135
241205065476 6-phosphogluconate dehydrogenase [Rhizobium leguminosar 1 1e-135
86358080483 6-phosphogluconate dehydrogenase [Rhizobium etli CFN 42 1 1e-134
190892158483 6-phosphogluconate dehydrogenase (decarboxylating) prot 1 1e-134
227822335476 6-phosphogluconate dehydrogenase [Sinorhizobium fredii 1 1e-134
150396935476 6-phosphogluconate dehydrogenase [Sinorhizobium medicae 1 1e-134
116252554483 6-phosphogluconate dehydrogenase [Rhizobium leguminosar 1 1e-134
209549700476 6-phosphogluconate dehydrogenase [Rhizobium leguminosar 1 1e-134
>gi|315121881|ref|YP_004062370.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 473 Back     alignment and organism information
 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/469 (76%), Positives = 408/469 (86%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++A+IGIIGLG+MGSNL+LN+L+KGFRLAVYN++ ELT+VF+KK  GLSQK I TKNL+
Sbjct: 1   MQKAEIGIIGLGAMGSNLALNMLEKGFRLAVYNQEIELTEVFVKKAHGLSQKFIATKNLQ 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           QMVEA+ +PRKILMM+TDG+PVDQLI+KLKPLLS EDILLDGGNSHF DTQ RSL L++K
Sbjct: 61  QMVEAISQPRKILMMITDGNPVDQLIEKLKPLLSSEDILLDGGNSHFADTQTRSLGLNQK 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GIYFIGIGVSGG  GAR G SLMVGGNEKAY+ +E+ILLSISA YQN+PCCALLGPDG+G
Sbjct: 121 GIYFIGIGVSGGTNGARYGPSLMVGGNEKAYHSIEHILLSISANYQNNPCCALLGPDGTG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYANMQLIADIYGILRD LNK  +E SHLFSKW+TGKL+SYL KITAEIL
Sbjct: 181 HFVKTIHNGIEYANMQLIADIYGILRDGLNKTSVETSHLFSKWNTGKLNSYLTKITAEIL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           SS D ITG+ +IDVICD ASQKGTGIRSIIEGHKL SS+TITE AIFARNLSL+ DE KK
Sbjct: 241 SSIDPITGLSMIDVICDTASQKGTGIRSIIEGHKLFSSLTITEIAIFARNLSLHNDECKK 300

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           MQ  F   S F LK  D+ +KDLENALY S ILSFTQGF +I KSS+KY+W+L L+ IAR
Sbjct: 301 MQLVFKNPSSFCLKYSDTLIKDLENALYVSKILSFTQGFLLIHKSSKKYNWNLQLSKIAR 360

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIRSQ+LNDIV+SL E+P+  NLL IPSIS+KVK TI SLRR+V+ CT+ GYPV
Sbjct: 361 IWRAGCIIRSQLLNDIVESLIENPNDANLLMIPSISQKVKSTISSLRRVVIDCTKQGYPV 420

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ 469
           P+LSAALSYFD + H  GTA+LIQAQRDFFGSHGFDRKD I + HGPWQ
Sbjct: 421 PALSAALSYFDAYTHGNGTAHLIQAQRDFFGSHGFDRKDGILKNHGPWQ 469


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086194|ref|YP_002544726.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Agrobacterium radiobacter K84] Length = 489 Back     alignment and organism information
>gi|15965685|ref|NP_386038.1| 6-phosphogluconate dehydrogenase [Sinorhizobium meliloti 1021] Length = 476 Back     alignment and organism information
>gi|241205065|ref|YP_002976161.1| 6-phosphogluconate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 476 Back     alignment and organism information
>gi|86358080|ref|YP_469972.1| 6-phosphogluconate dehydrogenase [Rhizobium etli CFN 42] Length = 483 Back     alignment and organism information
>gi|190892158|ref|YP_001978700.1| 6-phosphogluconate dehydrogenase (decarboxylating) protein [Rhizobium etli CIAT 652] Length = 483 Back     alignment and organism information
>gi|227822335|ref|YP_002826306.1| 6-phosphogluconate dehydrogenase [Sinorhizobium fredii NGR234] Length = 476 Back     alignment and organism information
>gi|150396935|ref|YP_001327402.1| 6-phosphogluconate dehydrogenase [Sinorhizobium medicae WSM419] Length = 476 Back     alignment and organism information
>gi|116252554|ref|YP_768392.1| 6-phosphogluconate dehydrogenase [Rhizobium leguminosarum bv. viciae 3841] Length = 483 Back     alignment and organism information
>gi|209549700|ref|YP_002281617.1| 6-phosphogluconate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 476 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target475 6-phosphogluconate dehydrogenase [Candidatus Liberibact
PRK09287459 PRK09287, PRK09287, 6-phosphogluconate dehydrogenase; V 1e-173
TIGR00873467 TIGR00873, gnd, 6-phosphogluconate dehydrogenase, decar 1e-148
PTZ00142470 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; P 1e-136
KOG2653487 KOG2653, KOG2653, KOG2653, 6-phosphogluconate dehydroge 1e-126
PLN02350493 PLN02350, PLN02350, phosphogluconate dehydrogenase (dec 1e-112
COG0362473 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohy 1e-163
pfam00393290 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, C-te 2e-97
PRK09599301 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-li 5e-59
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenas 2e-50
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-li 2e-49
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (d 5e-41
pfam03446163 pfam03446, NAD_binding_2, NAD binding domain of 6-phosp 2e-41
COG2084286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and r 3e-20
KOG0409327 KOG0409, KOG0409, KOG0409, Predicted dehydrogenase [Gen 1e-11
TIGR01505291 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate re 2e-09
PRK11559296 PRK11559, garR, tartronate semialdehyde reductase; Prov 2e-08
TIGR01692288 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase 1e-06
PRK15059292 PRK15059, PRK15059, tartronate semialdehyde reductase; 3e-06
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 4e-05
PRK15461296 PRK15461, PRK15461, NADH-dependent gamma-hydroxybutyrat 4e-05
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-li 6e-08
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenas 3e-06
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (d 1e-05
PRK09599301 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-li 5e-04
>gnl|CDD|181758 PRK09287, PRK09287, 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|129951 TIGR00873, gnd, 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>gnl|CDD|185475 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|37864 KOG2653, KOG2653, KOG2653, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|177984 PLN02350, PLN02350, phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|30711 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|109451 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|181980 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|31226 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|183555 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|162080 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|146202 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>gnl|CDD|32267 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|35630 KOG0409, KOG0409, KOG0409, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|130569 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>gnl|CDD|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|185019 PRK15059, PRK15059, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|178449 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|185358 PRK15461, PRK15461, NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183555 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|31226 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|162080 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|181980 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 475 6-phosphogluconate dehydrogenase [Candidatus Liberibact
TIGR00873480 gnd 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
PTZ00142474 6-phosphogluconate dehydrogenase; Provisional 100.0
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate tran 100.0
PRK09287459 6-phosphogluconate dehydrogenase; Validated 100.0
KOG2653487 consensus 100.0
TIGR00872341 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylati 100.0
pfam00393290 6PGD 6-phosphogluconate dehydrogenase, C-terminal domai 100.0
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 100.0
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 100.0
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohy 100.0
PRK11559295 garR tartronate semialdehyde reductase; Provisional 100.0
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 100.0
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase; Int 100.0
KOG0409327 consensus 100.0
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 99.42
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 99.27
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.24
PRK07680273 late competence protein ComER; Validated 99.22
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.2
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.16
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.98
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 98.75
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.92
TIGR02717457 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP formi 95.53
TIGR01692290 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IP 100.0
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 99.57
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 99.53
PRK08655441 prephenate dehydrogenase; Provisional 99.3
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 99.12
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.09
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.06
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.01
PRK07660283 consensus 98.99
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 98.98
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.97
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.97
PRK09117282 consensus 98.96
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.94
PRK08268503 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.86
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.77
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 98.74
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] 98.73
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 98.59
PRK11154706 fadJ multifunctional fatty acid oxidation complex subun 98.52
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 98.42
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.25
PRK05479336 ketol-acid reductoisomerase; Provisional 98.0
PRK13403335 ketol-acid reductoisomerase; Provisional 97.9
PRK08269311 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.82
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 97.77
COG4007340 Predicted dehydrogenase related to H2-forming N5,N10-me 97.68
PRK12557341 H(2)-dependent methylenetetrahydromethanopterin dehydro 97.54
KOG2304298 consensus 97.31
PRK06349432 homoserine dehydrogenase; Provisional 96.74
KOG2305313 consensus 96.64
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 96.57
COG5495289 Uncharacterized conserved protein [Function unknown] 96.31
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 96.22
TIGR01921326 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR0101 95.8
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose 95.38
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 95.04
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 93.89
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 92.73
PRK07208474 hypothetical protein; Provisional 92.12
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisional 91.04
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 90.93
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 100.0
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.42
PRK07417280 arogenate dehydrogenase; Reviewed 99.39
PRK08507275 prephenate dehydrogenase; Validated 99.35
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 99.26
PRK06545357 prephenate dehydrogenase; Validated 99.12
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.11
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 98.99
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 98.9
PRK12439340 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; P 98.87
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 98.84
pfam02153258 PDH Prephenate dehydrogenase. Members of this family ar 98.76
COG2085211 Predicted dinucleotide-binding enzymes [General functio 98.73
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 98.72
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 98.6
KOG2380480 consensus 98.57
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+ 98.46
PRK07574385 formate dehydrogenase; Provisional 98.45
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 98.3
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.97
PRK08818373 prephenate dehydrogenase; Provisional 97.92
TIGR01915233 npdG NADPH-dependent F420 reductase; InterPro: IPR01018 97.91
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.91
TIGR02279508 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC; I 97.52
PRK07340304 ornithine cyclodeaminase; Validated 97.5
PRK13303265 L-aspartate dehydrogenase; Provisional 97.43
PRK00048265 dihydrodipicolinate reductase; Provisional 96.65
pfam06408471 consensus 96.64
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 96.6
PRK04207338 glyceraldehyde-3-phosphate dehydrogenase; Provisional 94.68
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 94.26
TIGR01724341 hmd_rel coenzyme F420-dependent N(5),N(10)-methenyltetr 94.2
PRK08374316 homoserine dehydrogenase; Provisional 93.6
KOG3124267 consensus 93.14
PRK08300298 acetaldehyde dehydrogenase; Validated 92.99
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 92.8
PRK11036256 putative metallothionein SmtA; Provisional 92.46
PRK06444197 prephenate dehydrogenase; Provisional 92.37
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 91.26
COG1810224 Uncharacterized protein conserved in archaea [Function 90.79
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohy 99.85
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 99.67
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 99.65
TIGR00873 480 gnd 6-phosphogluconate dehydrogenase, decarboxylating; 96.8
TIGR00872341 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylati 99.48
PRK08324676 short chain dehydrogenase; Validated 95.43
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 99.17
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 99.05
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 99.03
PRK08229341 2-dehydropantoate 2-reductase; Provisional 98.81
PRK05708305 2-dehydropantoate 2-reductase; Provisional 98.76
PRK06249313 2-dehydropantoate 2-reductase; Provisional 98.68
PRK12921306 2-dehydropantoate 2-reductase; Provisional 98.66
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 98.58
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 98.55
PRK06436303 glycerate dehydrogenase; Provisional 98.52
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 98.51
PRK12480330 D-lactate dehydrogenase; Provisional 98.51
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 98.47
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 98.42
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 98.4
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 98.39
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 98.38
PRK08605332 D-lactate dehydrogenase; Validated 98.36
PRK13243333 glyoxylate reductase; Reviewed 98.35
PRK06932314 glycerate dehydrogenase; Provisional 98.33
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 98.32
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 98.27
KOG0069336 consensus 98.25
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 98.24
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 98.19
PRK06487317 glycerate dehydrogenase; Provisional 98.17
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 98.08
pfam07991165 IlvN Acetohydroxy acid isomeroreductase, catalytic doma 98.02
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 98.0
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid transport 97.78
PRK06823315 ornithine cyclodeaminase; Validated 97.75
PRK10669558 putative cation:proton antiport protein; Provisional 97.73
PRK11579346 putative oxidoreductase; Provisional 97.68
pfam02423312 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin 97.62
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 97.62
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.56
KOG2741351 consensus 97.56
PRK08618325 ornithine cyclodeaminase; Validated 97.54
PRK06141313 ornithine cyclodeaminase; Validated 97.54
PRK06407302 ornithine cyclodeaminase; Provisional 97.49
PRK08291330 ornithine cyclodeaminase; Validated 97.47
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin homol 97.46
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 97.43
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 97.4
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 97.39
PRK03562615 glutathione-regulated potassium-efflux system protein K 97.35
PRK03659602 glutathione-regulated potassium-efflux system protein K 97.34
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.28
PRK07589346 ornithine cyclodeaminase; Validated 97.24
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 97.23
COG4091438 Predicted homoserine dehydrogenase [Amino acid transpor 97.23
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 97.22
PRK08643256 acetoin reductase; Validated 97.19
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.17
PRK05225489 ketol-acid reductoisomerase; Validated 97.16
pfam00899134 ThiF ThiF family. This family contains a repeated domai 97.16
PRK06199379 ornithine cyclodeaminase; Validated 97.12
PRK06046326 alanine dehydrogenase; Validated 97.12
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 97.11
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.08
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 97.08
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 97.07
PRK08328230 hypothetical protein; Provisional 97.05
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.05
PRK07454241 short chain dehydrogenase; Provisional 97.04
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 96.98
PTZ00082322 L-lactate dehydrogenase; Provisional 96.98
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 96.96
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.95
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 96.95
KOG0068406 consensus 96.94
TIGR01087476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 96.89
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 96.85
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.84
PRK10206345 putative dehydrogenase; Provisional 96.8
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.76
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 96.71
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 96.71
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 96.7
PTZ00117313 malate dehydrogenase; Provisional 96.68
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 96.64
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 96.64
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 96.63
PRK08862227 short chain dehydrogenase; Provisional 96.62
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APP 96.62
PRK09134256 short chain dehydrogenase; Provisional 96.62
PRK07831261 short chain dehydrogenase; Provisional 96.61
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 96.6
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 96.6
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 96.58
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 96.58
PRK06223312 malate dehydrogenase; Reviewed 96.57
PTZ00325313 malate dehydrogenase; Provisional 96.56
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.56
KOG2711372 consensus 96.55
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.55
PRK07576260 short chain dehydrogenase; Provisional 96.53
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 96.51
TIGR01327535 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR0 96.5
PRK06181263 short chain dehydrogenase; Provisional 96.48
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.48
PRK07775275 short chain dehydrogenase; Provisional 96.44
PRK08277278 D-mannonate oxidoreductase; Provisional 96.42
PRK07024256 short chain dehydrogenase; Provisional 96.42
PRK05678289 succinyl-CoA synthetase subunit alpha; Validated 96.42
PRK07097265 gluconate 5-dehydrogenase; Provisional 96.4
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 96.39
PRK06180277 short chain dehydrogenase; Provisional 96.39
PRK07677254 short chain dehydrogenase; Provisional 96.39
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.36
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 96.33
PRK07774250 short chain dehydrogenase; Provisional 96.33
PRK06346251 consensus 96.32
PRK06124259 gluconate 5-dehydrogenase; Provisional 96.31
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 96.29
PRK06949258 short chain dehydrogenase; Provisional 96.28
PRK07890258 short chain dehydrogenase; Provisional 96.28
PRK06482276 short chain dehydrogenase; Provisional 96.28
PRK08085254 gluconate 5-dehydrogenase; Provisional 96.28
PRK12939250 short chain dehydrogenase; Provisional 96.25
PRK05866290 short chain dehydrogenase; Provisional 96.24
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 96.23
PRK07832272 short chain dehydrogenase; Provisional 96.21
KOG2012 1013 consensus 96.21
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.21
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 96.2
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 96.2
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 96.16
PRK05650270 short chain dehydrogenase; Provisional 96.15
PRK08251248 short chain dehydrogenase; Provisional 96.14
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 96.1
COG0579429 Predicted dehydrogenase [General function prediction on 96.09
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.08
PRK05717255 oxidoreductase; Validated 96.08
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 96.07
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 96.06
PRK08265261 short chain dehydrogenase; Provisional 96.03
PRK07479252 consensus 96.01
PRK06172253 short chain dehydrogenase; Provisional 96.01
PRK05867253 short chain dehydrogenase; Provisional 96.01
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 96.0
PRK09242258 tropinone reductase; Provisional 95.98
PRK07062265 short chain dehydrogenase; Provisional 95.97
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.97
PRK08263275 short chain dehydrogenase; Provisional 95.97
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 95.97
PRK06139324 short chain dehydrogenase; Provisional 95.95
PRK07109338 short chain dehydrogenase; Provisional 95.94
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 95.94
PRK08213259 gluconate 5-dehydrogenase; Provisional 95.93
PRK12743253 acetoin dehydrogenase; Provisional 95.93
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.91
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.91
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 95.9
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 95.88
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 95.88
PRK06720169 hypothetical protein; Provisional 95.87
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 95.87
PRK06914280 short chain dehydrogenase; Provisional 95.86
PRK06182273 short chain dehydrogenase; Validated 95.85
PRK06194301 hypothetical protein; Provisional 95.84
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 95.81
PRK07523251 gluconate 5-dehydrogenase; Provisional 95.79
PRK07814263 short chain dehydrogenase; Provisional 95.79
PRK09186255 flagellin modification protein A; Provisional 95.78
CHL00194319 ycf39 Ycf39; Provisional 95.76
PRK07326235 short chain dehydrogenase; Provisional 95.76
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.76
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 95.75
PRK07478254 short chain dehydrogenase; Provisional 95.75
PRK07035252 short chain dehydrogenase; Provisional 95.73
PRK06138252 short chain dehydrogenase; Provisional 95.72
PRK12829264 short chain dehydrogenase; Provisional 95.7
PRK12828239 short chain dehydrogenase; Provisional 95.69
PRK05600370 thiamine biosynthesis protein ThiF; Validated 95.68
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 95.68
PRK05855582 short chain dehydrogenase; Validated 95.65
PRK07776252 consensus 95.65
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 95.63
PRK08340259 glucose-1-dehydrogenase; Provisional 95.62
PRK06123249 short chain dehydrogenase; Provisional 95.62
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.61
PRK07067256 sorbitol dehydrogenase; Provisional 95.61
TIGR02371327 ala_DH_arch alanine dehydrogenase; InterPro: IPR012742 95.6
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.55
PRK06198268 short chain dehydrogenase; Provisional 95.54
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.52
PRK07825273 short chain dehydrogenase; Provisional 95.5
PRK06947252 glucose-1-dehydrogenase; Provisional 95.45
PRK12935247 acetoacetyl-CoA reductase; Provisional 95.43
pfam03447116 NAD_binding_3 Homoserine dehydrogenase, NAD binding dom 95.41
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transport and 95.41
PRK06500249 short chain dehydrogenase; Provisional 95.4
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 95.39
PRK06940277 short chain dehydrogenase; Provisional 95.38
PRK05693274 short chain dehydrogenase; Provisional 95.35
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 95.33
PRK12938246 acetyacetyl-CoA reductase; Provisional 95.33
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 95.32
PRK08267258 short chain dehydrogenase; Provisional 95.32
PRK07063259 short chain dehydrogenase; Provisional 95.27
PRK05875277 short chain dehydrogenase; Provisional 95.21
PRK07806248 short chain dehydrogenase; Provisional 95.2
PRK05872296 short chain dehydrogenase; Provisional 95.19
PRK05876275 short chain dehydrogenase; Provisional 95.18
PRK06179270 short chain dehydrogenase; Provisional 95.16
PRK08226263 short chain dehydrogenase; Provisional 95.16
PRK06227256 consensus 95.15
PRK06841255 short chain dehydrogenase; Provisional 95.15
PRK12824245 acetoacetyl-CoA reductase; Provisional 95.14
PRK09730247 hypothetical protein; Provisional 95.14
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 95.11
PRK07411390 hypothetical protein; Validated 95.1
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.05
PRK08339263 short chain dehydrogenase; Provisional 95.02
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in molybdo 95.0
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.93
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of amino a 94.89
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 94.86
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 94.85
PRK08945245 short chain dehydrogenase; Provisional 94.84
PRK07074256 short chain dehydrogenase; Provisional 94.68
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Validated 94.67
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 94.66
PRK06484530 short chain dehydrogenase; Validated 94.66
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 94.66
PRK06114262 short chain dehydrogenase; Provisional 94.65
PRK12827251 short chain dehydrogenase; Provisional 94.63
PRK05993277 short chain dehydrogenase; Provisional 94.52
PRK06057255 short chain dehydrogenase; Provisional 94.48
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy 94.41
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 94.29
PRK09135249 pteridine reductase; Provisional 94.29
PRK06483236 short chain dehydrogenase; Provisional 94.27
PRK12937245 short chain dehydrogenase; Provisional 94.24
PRK08936261 glucose-1-dehydrogenase; Provisional 94.15
TIGR02415258 23BDH acetoin reductases; InterPro: IPR014007 One membe 94.08
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 94.05
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Meth 93.99
PRK08589272 short chain dehydrogenase; Validated 93.94
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF; InterPro: 93.92
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 93.75
) and pyridine nucleotide transhydrogenase () have been shown to share regions of similarity . Alanine dehydrogenase catalyzes the NAD-dependent reversible reductive amination of pyruvate into alanine. Pyridine nucleotide transhydrogenase catalyzes the reduction of NADP^+ to NADPH with the concomitant oxidation of NADH to NAD^+. This enzyme is located in the plasma membrane of prokaryotes and in the inner membrane of the mitochondria of eukaryotes. The transhydrogenation between NADH and NADP is coupled with the translocation of a proton across the membrane. In prokaryotes the enzyme is composed of two different subunits, an alpha chain (gene pntA) and a beta chain (gene pntB), while in eukaryotes it is a single chain protein. The sequence of alanine dehydrogenase from several bacterial species are related with those of the alpha subunit of bacterial pyridine nucleotide transhydrogenase and of the N-terminal half of the eukaryotic enzyme. The two most conserved regions correspond respectively to the N-terminal extremity of these proteins and to a central glycine-rich region which is part of the NAD(H)-binding site.; GO: 0000286 alanine dehydrogenase activity, 0006118 electron transport." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00518">TIGR00518372 alaDH alanine dehydrogenase; InterPro: IPR008141 Alanin 93.72
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 93.56
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 93.52
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 93.5
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 93.48
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 93.44
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 93.3
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 93.28
PRK12744257 short chain dehydrogenase; Provisional 93.27
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 93.25
pfam0372099 UDPG_MGDP_dh_C UDP-glucose/GDP-mannose dehydrogenase fa 93.22
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 93.22
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 93.1
PRK05086312 malate dehydrogenase; Provisional 93.03
TIGR00465344 ilvC ketol-acid reductoisomerase; InterPro: IPR013023 A 92.98
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 92.98
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 92.97
PRK09072262 short chain dehydrogenase; Provisional 92.9
PRK08017256 short chain dehydrogenase; Provisional 92.76
PRK06701289 short chain dehydrogenase; Provisional 92.72
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 92.67
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 92.66
PRK07069251 short chain dehydrogenase; Validated 92.6
PRK05442325 malate dehydrogenase; Provisional 92.59
TIGR02992326 ectoine_eutC ectoine utilization protein EutC; InterPro 92.53
KOG3007333 consensus 92.47
pfam04016229 DUF364 Domain of unknown function (DUF364). Archaeal do 92.46
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 92.44
PRK06196316 oxidoreductase; Provisional 92.4
PRK08628258 short chain dehydrogenase; Provisional 92.38
PRK07856254 short chain dehydrogenase; Provisional 91.74
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 91.69
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.66
PRK08303305 short chain dehydrogenase; Provisional 91.37
PRK08278273 short chain dehydrogenase; Provisional 91.37
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 91.24
PRK06813341 homoserine dehydrogenase; Validated 91.14
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 91.11
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 90.95
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 90.81
PRK05854314 short chain dehydrogenase; Provisional 90.8
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 90.75
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 90.74
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.68
PRK05599246 hypothetical protein; Provisional 90.61
PRK01368450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.57
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 90.48
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 90.37
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 99.12
PRK08223287 hypothetical protein; Validated 96.48
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 95.83
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 91.86
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 98.57
PTZ00142 474 6-phosphogluconate dehydrogenase; Provisional 98.53
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate tran 96.05
KOG2653 487 consensus 92.7
pfam00393290 6PGD 6-phosphogluconate dehydrogenase, C-terminal domai 98.35
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 98.21
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.93
PRK13940414 glutamyl-tRNA reductase; Provisional 97.64
PRK09496455 trkA potassium transporter peripheral membrane componen 97.45
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 97.17
pfam0262996 CoA_binding CoA binding domain. This domain has a Rossm 96.93
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 96.48
COG2344211 AT-rich DNA-binding protein [General function predictio 96.25
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 94.38
COG2910211 Putative NADH-flavin reductase [General function predic 94.27
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 92.38
TIGR01809291 Shik-DH-AROM shikimate-5-dehydrogenase; InterPro: IPR01 92.32
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 92.18
pfam00389313 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenas 97.29
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 96.96
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.91
PRK12550272 shikimate 5-dehydrogenase; Reviewed 94.53
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshikimat 96.59
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 96.43
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.38
PRK07201 663 short chain dehydrogenase; Provisional 95.91
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.5
pfam00107131 ADH_zinc_N Zinc-binding dehydrogenase. 95.18
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 94.59
PRK06101241 short chain dehydrogenase; Provisional 94.34
PRK07041240 short chain dehydrogenase; Provisional 93.87
KOG1200256 consensus 93.72
PRK07060245 short chain dehydrogenase; Provisional 93.44
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 93.31
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 93.21
PRK09880343 L-idonate 5-dehydrogenase; Provisional 93.19
PRK06125259 short chain dehydrogenase; Provisional 93.03
PRK08177225 short chain dehydrogenase; Provisional 92.6
KOG1201300 consensus 92.59
PRK05884223 short chain dehydrogenase; Provisional 91.31
PRK09496455 trkA potassium transporter peripheral membrane componen 96.23
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 96.2
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 96.05
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 95.71
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 95.09
PRK12746254 short chain dehydrogenase; Provisional 95.04
PRK07102243 short chain dehydrogenase; Provisional 94.94
KOG0023360 consensus 94.87
PRK07707239 consensus 94.77
PRK07236386 hypothetical protein; Provisional 94.59
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 94.11
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 93.82
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 93.81
KOG1399448 consensus 93.67
PRK11259377 solA N-methyltryptophan oxidase; Provisional 93.62
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 93.61
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 93.45
PRK09126392 hypothetical protein; Provisional 93.11
PRK06847375 hypothetical protein; Provisional 92.63
PRK11728400 hypothetical protein; Provisional 92.55
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 92.25
PRK13984604 putative oxidoreductase; Provisional 92.22
PRK06475400 salicylate hydroxylase; Provisional 92.17
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 91.83
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 91.81
PRK08013400 hypothetical protein; Provisional 91.67
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 91.65
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 91.65
PRK12831464 putative oxidoreductase; Provisional 91.61
PRK05868372 hypothetical protein; Validated 91.44
PRK06185409 hypothetical protein; Provisional 91.33
PRK11749460 putative oxidoreductase; Provisional 91.13
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 91.11
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 90.96
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 90.94
PRK12814652 putative NADPH-dependent glutamate synthase small subun 90.94
PRK098531032 putative selenate reductase subunit YgfK; Provisional 90.9
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 90.86
PRK08163396 salicylate hydroxylase; Provisional 90.81
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 90.76
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 90.76
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 90.7
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 90.57
COG0074293 SucD Succinyl-CoA synthetase, alpha subunit [Energy pro 96.19
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 94.11
PRK09466810 metL bifunctional aspartate kinase II/homoserine dehydr 96.01
PRK09436817 thrA bifunctional aspartokinase I/homeserine dehydrogen 94.88
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 95.95
PRK06484530 short chain dehydrogenase; Validated 94.66
PRK00676338 hemA glutamyl-tRNA reductase; Validated 94.74
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 94.2
pfam03059277 NAS Nicotianamine synthase protein. Nicotianamine synth 93.49
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 92.01
PRK13771332 putative alcohol dehydrogenase; Provisional 91.95
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating; InterPro: IPR006113 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>KOG2653 consensus Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating); InterPro: IPR004849 This family resembles a larger family of bacterial and eukaryotic 6-phosphogluconate dehydrogenases (Gnd) but differs from it by a deep split in a UPGMA similarity clustering tree and the lack of a central region of about 140 residues Back     alignment and domain information
>pfam00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase; InterPro: IPR006398 These sequences represent 2-hydroxy-3-oxopropionate reductase (1 Back     alignment and domain information
>KOG0409 consensus Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain; InterPro: IPR014089 This group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which they have been characterised , , Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IPR011548 3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07660 consensus Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09117 consensus Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information