254780719

254780719

zinc uptake ABC transporter, permease protein

GeneID in NCBI database:8209724Locus tag:CLIBASIA_03030
Protein GI in NCBI database:254780719Protein Accession:YP_003065132.1
Gene range:-(547018, 547800)Protein Length:260aa
Gene description:zinc uptake ABC transporter, permease protein
COG prediction:[P] ABC-type Mn2+/Zn2+ transport systems, permease components
KEGG prediction:znuB; zinc uptake ABC transporter, permease protein; K09816 zinc transport system permease protein
SEED prediction:Zinc ABC transporter, inner membrane permease protein ZnuB
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED7 TM-Helix
HMMTOP7 TM-Helix
MEMSAT9 TM-Helix
MEMSAT_SVM7 TM-Helix
PHOBIUS7 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHEEEEccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccEEEEEEEccccHHHHHHHHHHHHHHHHccc
MYNEFFIRALFSGIGIvlstgplgcFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQknealssdaILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYElakaegmqpeKIKLIFIMITSLMISVSIKFIGITLITSllilptvtarrfstspeNMAILATIIGILGIIIGLYgslifdtpsgpsiIITSLFLFILSFFYKK
MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELakaegmqpeKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK
MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFigitlitsllilptvtARRFSTSPENMAilatiigilgiiiglygsliFDTPSGPsiiitslflfilsffYKK
MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK
MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK
MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHoo
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxx
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoo
ooooooooHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHii
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHooo
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK
MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK
MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target260 zinc uptake ABC transporter, permease protein [Candidat
254780540277 ABC transporter, membrane spanning protein (iron t 3e-18
254780539273 ABC transporter, membrane spanning protein (iron) 6e-10
>gi|254780540|ref|YP_003064953.1| ABC transporter, membrane spanning protein (iron transport) [Candidatus Liberibacter asiaticus str. psy62] Length = 277 Back     alignment
 Score = 83.6 bits (205), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 126/247 (51%), Gaps = 7/247 (2%)

Query: 16  IVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQI 75
           +V+    L CFII +  ++ G+ I+HS L G+ LS +  +PL I  F+   + +L    +
Sbjct: 27  VVIPMSVLSCFIILKNQSFAGEAISHSVLPGIVLSHMAGIPLEIGAFIAGMICTLSAGYL 86

Query: 76  QKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIG 135
           ++      D +L ++     ++  +IL      +   +  L GD+L ++ +DI+      
Sbjct: 87  KEKSYFQEDLVLSIVFSGMFAIG-IILILKVHSSLHFSHILLGDMLGISKSDIITTAFFA 145

Query: 136 FLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLI---FIMITSLMISVSIKFIGITL 192
           F++I  L      LL     ++   A  MQ   IKL+   F+++ SL+I +S+K IGI L
Sbjct: 146 FISISFLILKKNDLLLMI--FDPMHAHSMQ-IPIKLLHYNFLIVLSLIIVISLKSIGIIL 202

Query: 193 ITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLF 252
             ++L+LP  TA   S     M +L+ II ++  ++G+Y S   ++ + P+++I     F
Sbjct: 203 PPAVLVLPGATAFLLSKHHTTMILLSVIISVVCTLVGIYISFFINSAAAPTVVILMAIFF 262

Query: 253 ILSFFYK 259
           ++ + Y 
Sbjct: 263 VVVYAYS 269

>gi|254780539|ref|YP_003064952.1| ABC transporter, membrane spanning protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 273 Back     alignment
 Score = 56.2 bits (134), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 109/226 (48%), Gaps = 1/226 (0%)

Query: 21  GPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEA 80
           G L  ++I +  +  G+ I+H+   G+ +     +PL++   +   L + ++++I++   
Sbjct: 29  GLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIPLSVGATISGMLATGIMVKIKETTK 88

Query: 81  LSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIM 140
           L  D  + V+     S A+ +LS +      + +   G+ L+++ +D + +  I F    
Sbjct: 89  LREDVAIAVVYIIFYSFAMFMLS-LSPSAVYVENIFLGNTLSMSRSDTIQVLIITFSVAC 147

Query: 141 ILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILP 200
           I++  WK  +    +   A + G+  + +K++F  + ++ I +  + +GI L+ + +I P
Sbjct: 148 IVYMKWKDFVLLFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITP 207

Query: 201 TVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPSGPSIII 246
             TA+  S S     + ++++G     +G Y S   D   G  I+I
Sbjct: 208 GATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSPGGIIVI 253

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target260 zinc uptake ABC transporter, permease protein [Candidat
315121884263 zinc uptake ABC transporter, permease protein [Candidat 1 1e-117
241205422271 ABC transporter [Rhizobium leguminosarum bv. trifolii W 1 5e-87
116252918271 high-affinity zinc uptake system membrane protein [Rhiz 1 6e-87
327188698316 zinc uptake ABC transporter, permease protein [Rhizobiu 1 8e-87
209549966271 ABC transporter [Rhizobium leguminosarum bv. trifolii W 1 8e-87
190892433271 zinc ABC transporter permease [Rhizobium etli CIAT 652] 1 1e-86
86358316270 zinc uptake ABC transporter, permease protein [Rhizobiu 1 3e-86
218673631271 zinc uptake ABC transporter, permease protein [Rhizobiu 1 3e-86
325292920272 High-affinity zinc uptake system membrane protein znuB 1 2e-78
15965666275 high-affinity zinc uptake system membrane ABC transport 1 5e-78
>gi|315121884|ref|YP_004062373.1| zinc uptake ABC transporter, permease protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 263 Back     alignment and organism information
 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/256 (81%), Positives = 238/256 (92%)

Query: 1   MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALLGVALSLIFQLPLTIC 60
           +YNEFFIRALF+GIGI+LSTGPLGCFI+WQR+ YFGDTIAHSALLGVA SL+  LPL +C
Sbjct: 2   IYNEFFIRALFAGIGIILSTGPLGCFIVWQRMTYFGDTIAHSALLGVAFSLMLNLPLPLC 61

Query: 61  IFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSFMKWVNTDLTSFLFGDI 120
           IFM+A LTS++LLQIQK+E ++SDAILGVITHSTIS++L++LSFM WVNTDLTSFLFGDI
Sbjct: 62  IFMVAALTSIILLQIQKSEFIASDAILGVITHSTISISLIMLSFMTWVNTDLTSFLFGDI 121

Query: 121 LAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLM 180
           LA+NT DI++IW +G LNI+IL KIWK LLATTVNYELAKAEGMQPEK+KLIF MIT+LM
Sbjct: 122 LAINTNDIIIIWSVGILNIVILIKIWKSLLATTVNYELAKAEGMQPEKVKLIFTMITALM 181

Query: 181 ISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLIFDTPS 240
           IS+SIKFIGITLITSLLILPTVTARRF+TSPENM IL T+IGILG+I+GLYGSLIFDTPS
Sbjct: 182 ISISIKFIGITLITSLLILPTVTARRFATSPENMVILTTVIGILGVILGLYGSLIFDTPS 241

Query: 241 GPSIIITSLFLFILSF 256
           GPSIIITSL  FILSF
Sbjct: 242 GPSIIITSLIFFILSF 257


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241205422|ref|YP_002976518.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 271 Back     alignment and organism information
>gi|116252918|ref|YP_768756.1| high-affinity zinc uptake system membrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 271 Back     alignment and organism information
>gi|327188698|gb|EGE55898.1| zinc uptake ABC transporter, permease protein [Rhizobium etli CNPAF512] Length = 316 Back     alignment and organism information
>gi|209549966|ref|YP_002281883.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 271 Back     alignment and organism information
>gi|190892433|ref|YP_001978975.1| zinc ABC transporter permease [Rhizobium etli CIAT 652] Length = 271 Back     alignment and organism information
>gi|86358316|ref|YP_470208.1| zinc uptake ABC transporter, permease protein [Rhizobium etli CFN 42] Length = 270 Back     alignment and organism information
>gi|218673631|ref|ZP_03523300.1| zinc uptake ABC transporter, permease protein [Rhizobium etli GR56] Length = 271 Back     alignment and organism information
>gi|325292920|ref|YP_004278784.1| High-affinity zinc uptake system membrane protein znuB [Agrobacterium sp. H13-3] Length = 272 Back     alignment and organism information
>gi|15965666|ref|NP_386019.1| high-affinity zinc uptake system membrane ABC transporter protein [Sinorhizobium meliloti 1021] Length = 275 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target260 zinc uptake ABC transporter, permease protein [Candidat
PRK09543261 PRK09543, znuB, high-affinity zinc transporter membrane 5e-53
COG1108274 COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, pe 1e-38
TIGR03770270 TIGR03770, anch_rpt_perm, anchored repeat-type ABC tran 3e-24
cd06550261 cd06550, TM_ABC_iron-siderophores_like, Transmembrane s 1e-22
pfam00950258 pfam00950, ABC-3, ABC 3 transport family 1e-43
>gnl|CDD|181938 PRK09543, znuB, high-affinity zinc transporter membrane component; Reviewed Back     alignment and domain information
>gnl|CDD|31305 COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163482 TIGR03770, anch_rpt_perm, anchored repeat-type ABC transporter, permease subunit Back     alignment and domain information
>gnl|CDD|119348 cd06550, TM_ABC_iron-siderophores_like, Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+ Back     alignment and domain information
>gnl|CDD|109985 pfam00950, ABC-3, ABC 3 transport family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 260 zinc uptake ABC transporter, permease protein [Candidat
PRK09543261 znuB high-affinity zinc transporter membrane component; 100.0
COG1108274 ZnuB ABC-type Mn2+/Zn2+ transport systems, permease com 100.0
pfam00950258 ABC-3 ABC 3 transport family. 100.0
cd06550261 TM_ABC_iron-siderophores_like Transmembrane subunit (TM 100.0
PRK10577666 iron-hydroxamate transporter permease subunit; Provisio 99.95
PRK09535366 btuC corrinoid ABC transporter permease; Reviewed 99.94
PRK09777318 fecD iron-dicitrate transporter subunit FecD; Reviewed 99.94
PRK10577 666 iron-hydroxamate transporter permease subunit; Provisio 99.94
PRK10440330 iron-enterobactin transporter permease; Provisional 99.94
PRK11228323 fecC iron-dicitrate transporter permease subunit; Provi 99.94
pfam01032312 FecCD FecCD transport family. This is a sub-family of b 99.93
PRK10441335 iron-enterobactin transporter membrane protein; Provisi 99.93
PRK03784330 vtamin B12-transporter permease; Provisional 99.93
COG0609334 FepD ABC-type Fe3+-siderophore transport system, permea 99.9
COG4606321 CeuB ABC-type enterochelin transport system, permease c 99.55
COG4139326 BtuC ABC-type cobalamin transport system, permease comp 99.0
COG4120293 ABC-type uncharacterized transport system, permease com 93.12
COG4779346 FepG ABC-type enterobactin transport system, permease c 99.44
COG4605316 CeuC ABC-type enterochelin transport system, permease c 99.11
COG4177314 LivM ABC-type branched-chain amino acid transport syste 92.75
PRK09699325 D-allose transporter subunit; Provisional 97.15
cd06581268 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escheri 97.03
cd06580234 TM_PBP1_transp_TpRbsC_like Transmembrane subunit (TM) o 95.71
pfam02653267 BPD_transp_2 Branched-chain amino acid transport system 96.94
PRK09512321 rbsC ribose ABC transporter permease protein; Reviewed 96.02
COG1079304 Uncharacterized ABC-type transport system, permease com 90.75
TIGR03408313 urea_trans_UrtC urea ABC transporter, permease protein 96.81
cd06574266 TM_PBP1_branched-chain-AA_like Transmembrane subunit (T 96.79
cd06579263 TM_PBP1_transp_AraH_like Transmembrane subunit (TM) of 96.49
cd06582272 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escheri 96.35
PRK11618317 inner membrane ABC transporter permease protein YjfF; P 95.78
TIGR03622283 urea_t_UrtB_arc urea ABC transporter, permease protein 95.0
TIGR03409291 urea_trans_UrtB urea ABC transporter, permease protein 93.19
COG4214394 XylH ABC-type xylose transport system, permease compone 91.36
PRK11285327 araH L-arabinose transporter permease protein; Provisio 96.7
COG1172316 AraH Ribose/xylose/arabinose/galactoside ABC-type trans 96.32
PRK09478336 mglC beta-methylgalactoside transporter inner membrane 95.54
PRK11301416 livM leucine/isoleucine/valine transporter permease sub 95.01
PRK10740308 branched-chain amino acid transporter permease subunit 94.78
COG0559297 LivH Branched-chain amino acid ABC-type transport syste 93.06
>PRK09543 znuB high-affinity zinc transporter membrane component; Reviewed Back     alignment and domain information
>COG1108 ZnuB ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam00950 ABC-3 ABC 3 transport family Back     alignment and domain information
>cd06550 TM_ABC_iron-siderophores_like Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+ Back     alignment and domain information
>PRK10577 iron-hydroxamate transporter permease subunit; Provisional Back     alignment and domain information
>PRK09535 btuC corrinoid ABC transporter permease; Reviewed Back     alignment and domain information
>PRK09777 fecD iron-dicitrate transporter subunit FecD; Reviewed Back     alignment and domain information
>PRK10577 iron-hydroxamate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10440 iron-enterobactin transporter permease; Provisional Back     alignment and domain information
>PRK11228 fecC iron-dicitrate transporter permease subunit; Provisional Back     alignment and domain information
>pfam01032 FecCD FecCD transport family Back     alignment and domain information
>PRK10441 iron-enterobactin transporter membrane protein; Provisional Back     alignment and domain information
>PRK03784 vtamin B12-transporter permease; Provisional Back     alignment and domain information
>COG0609 FepD ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4606 CeuB ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4139 BtuC ABC-type cobalamin transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>COG4120 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4779 FepG ABC-type enterobactin transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4605 CeuC ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4177 LivM ABC-type branched-chain amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09699 D-allose transporter subunit; Provisional Back     alignment and domain information
>cd06581 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escherichia coli LivM and related proteins Back     alignment and domain information
>cd06580 TM_PBP1_transp_TpRbsC_like Transmembrane subunit (TM) of Treponema pallidum (Tp) RbsC-1, RbsC-2 and related proteins Back     alignment and domain information
>pfam02653 BPD_transp_2 Branched-chain amino acid transport system / permease component Back     alignment and domain information
>PRK09512 rbsC ribose ABC transporter permease protein; Reviewed Back     alignment and domain information
>COG1079 Uncharacterized ABC-type transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR03408 urea_trans_UrtC urea ABC transporter, permease protein UrtC Back     alignment and domain information
>cd06574 TM_PBP1_branched-chain-AA_like Transmembrane subunit (TM) of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which are involved in the uptake of branched-chain amino acids (AAs), as well as TMs of transporters involved in the uptake of monosaccharides including ribose, galactose, and arabinose Back     alignment and domain information
>cd06579 TM_PBP1_transp_AraH_like Transmembrane subunit (TM) of Escherichia coli AraH and related proteins Back     alignment and domain information
>cd06582 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escherichia coli LivH and related proteins Back     alignment and domain information
>PRK11618 inner membrane ABC transporter permease protein YjfF; Provisional Back     alignment and domain information
>TIGR03622 urea_t_UrtB_arc urea ABC transporter, permease protein UrtB Back     alignment and domain information
>TIGR03409 urea_trans_UrtB urea ABC transporter, permease protein UrtB Back     alignment and domain information
>COG4214 XylH ABC-type xylose transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11285 araH L-arabinose transporter permease protein; Provisional Back     alignment and domain information
>COG1172 AraH Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09478 mglC beta-methylgalactoside transporter inner membrane component; Provisional Back     alignment and domain information
>PRK11301 livM leucine/isoleucine/valine transporter permease subunit; Provisional Back     alignment and domain information
>PRK10740 branched-chain amino acid transporter permease subunit LivH; Reviewed Back     alignment and domain information
>COG0559 LivH Branched-chain amino acid ABC-type transport system, permease components [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target260 zinc uptake ABC transporter, permease protein [Candidat
2nq2_A337 Hypothetical ABC transporter permease protein HI1471; p 99.91
2qi9_A326 Vitamin B12 import system permease protein BTUC; inner 99.9
>2nq2_A Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
Probab=99.91  E-value=6.2e-22  Score=136.72  Aligned_cols=249  Identities=14%  Similarity=0.176  Sum_probs=180.0

Q ss_pred             HHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHCCHH---HHHHHHHHHHHHHHHHHHC-CCCCC
Q ss_conf             999999999987889999----998799964358999999999999950036---6799999999999986310-35765
Q gi|254780719|r   10 LFSGIGIVLSTGPLGCFI----IWQRIAYFGDTIAHSALLGVALSLIFQLPL---TICIFMIATLTSLVLLQIQ-KNEAL   81 (260)
Q Consensus        10 ll~~~~~~~~~~~lG~~v----v~rr~s~~~~alsH~a~~Gial~~~l~~~~---~~ga~~~~~l~al~i~~l~-~~~~~   81 (260)
                      .+++++.+...+.-|...    -.+=.+----+++..+-.|++++++++.+.   ......++.........+. ++++.
T Consensus        66 ~l~a~l~Ga~LavaG~llQ~~~rNpLA~P~iLGissGA~lg~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  145 (337)
T 2nq2_A           66 ILTALCVGAGLALSGVVLQGIFRNPLVNPHIIGVTSGSAFGGTLAIFFGFSLYGLFTSTILFGFGTLALVFLFSFKFNQR  145 (337)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTCTTCCTTTTSHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHTC----
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999999999998657999990665489999999999999840022578999999999999999999964778


Q ss_pred             H--HHHHHHHHHHHHHHHHHHHHHH-CCC--CHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             0--4569999999999999999962-132--0013334433324422876705899998999999984245665412888
Q gi|254780719|r   82 S--SDAILGVITHSTISLALVILSF-MKW--VNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNY  156 (260)
Q Consensus        82 ~--~da~igi~~s~~~alg~llls~-~~~--~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~  156 (260)
                      +  +-..+|+..+..++....+..+ ..+  ...+...|++||....+|+|++.......+.....+...|++.....||
T Consensus       146 ~~~~liL~gi~~~~~~~a~~~~~~~l~~~~~~~~~~~~W~~Gs~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~~l~lG~  225 (337)
T 2nq2_A          146 SLLMLILIGMILSGLFSALVSLLQYISDTEEKLPSIVFWLMGSFATSNWEKLLFFFVPFLLCSSILLSLSWRLNLLSLDE  225 (337)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHSSCTTTHHHHHHHHTTCCSTTCCHHHHHHHHHHHHHHHHHHHHTTTGGGGGGSCH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHCCCCHHCCCH
T ss_conf             72177876799999999999999997224889999999850143568843213311211478888888630056210793


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-
Q ss_conf             9999808981067769999999999999999889999999999999999741998999999999999999999999999-
Q gi|254780719|r  157 ELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI-  235 (260)
Q Consensus       157 ~~A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~~-  235 (260)
                      |.|++.|+|+++.+...+.+.++.++.++..+|.+.+.+ ++.|+.+.+...+++|+.++.|.+.|..-......++.. 
T Consensus       226 ~~A~sLGv~v~~~r~~~l~l~~llta~~vs~~G~I~FvG-Li~Phiar~l~g~~~~~~l~~s~l~Ga~lll~aD~i~r~l  304 (337)
T 2nq2_A          226 KEAKALGVKMAPLRWLVIFLSGSLVACQVAISGSIGWVG-LIIPHLSRMLVGANHQSLLPCTMLVGATYMLLVDNVARSL  304 (337)
T ss_dssp             HHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSST-THHHHHHHHHHCSCHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEHH-HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             889878997999999999999999999996377630387-4099999998188853399999999999999999998665


Q ss_pred             --HCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             --5588089999999999999987239
Q gi|254780719|r  236 --FDTPSGPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       236 --~~lp~g~~Iv~~~~~~f~~~~~~~k  260 (260)
                        +++|.|..+.++.+..|+ .+++||
T Consensus       305 ~p~elPvG~vtaliG~p~fl-~ll~r~  330 (337)
T 2nq2_A          305 SDAEIPISILTALIGAPLFG-VLVYKL  330 (337)
T ss_dssp             CSSCCCHHHHHHHHHHHHHH-HHHHCC
T ss_pred             CCCCEEHHHHHHHHHHHHHH-HHHHHH
T ss_conf             67773199999999999999-999985



>2qi9_A Vitamin B12 import system permease protein BTUC; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target260 zinc uptake ABC transporter, permease protein [Candidat
d1l7va_324 ABC transporter involved in vitamin B12 uptake, BtuC {E 99.89
>d1l7va_ f.22.1.1 (A:) ABC transporter involved in vitamin B12 uptake, BtuC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: ABC transporter involved in vitamin B12 uptake, BtuC
superfamily: ABC transporter involved in vitamin B12 uptake, BtuC
family: ABC transporter involved in vitamin B12 uptake, BtuC
domain: ABC transporter involved in vitamin B12 uptake, BtuC
species: Escherichia coli [TaxId: 562]
Probab=99.89  E-value=2.4e-21  Score=132.24  Aligned_cols=247  Identities=13%  Similarity=0.112  Sum_probs=176.1

Q ss_pred             HHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHCCH------HHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999999998788999----999879996435899999999999995003------66799999999999986310357
Q gi|254780719|r   10 LFSGIGIVLSTGPLGCF----IIWQRIAYFGDTIAHSALLGVALSLIFQLP------LTICIFMIATLTSLVLLQIQKNE   79 (260)
Q Consensus        10 ll~~~~~~~~~~~lG~~----vv~rr~s~~~~alsH~a~~Gial~~~l~~~------~~~ga~~~~~l~al~i~~l~~~~   79 (260)
                      .+++.+.|...+.-|..    ...+=.+----+++..+-.|++++.+++.+      ....++..+...........|+.
T Consensus        60 ~l~a~l~Ga~La~sG~~lQ~~~rNpLA~P~ilGissGA~l~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  139 (324)
T d1l7va_          60 TLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLCAIAGALIITLILLRFARRH  139 (324)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTCTTCCTTTTTHHHHHHHHHHHHHHTSCTTCCHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999817988783678754288999999997233225788999999999999999999986146


Q ss_pred             CCHH-HHHHHHHHHHHHHHHH-HHHHHC-CCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             6504-5699999999999999-999621-320013334433324422876705899998999999984245665412888
Q gi|254780719|r   80 ALSS-DAILGVITHSTISLAL-VILSFM-KWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNY  156 (260)
Q Consensus        80 ~~~~-da~igi~~s~~~alg~-llls~~-~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD~  156 (260)
                      ..+. -...|+..+..++... .+.... ++...+...|+.|+....+|+|++.......+. .......|++...+.||
T Consensus       140 ~~~~~liL~Gi~i~~~~~a~~~~l~~~~~~~~~~~~~~w~~Gs~~~~~~~~~~~~~~~~~~~-~~~~~~~~~L~~L~lgd  218 (324)
T d1l7va_         140 LSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQSWLMLALIPVL-LWICCQSRPMNMLALGE  218 (324)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHTCCCTTCCGGGHHHHHHHHHHH-HHHHHCHHHHHHHHHCH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH-HHHHHHHHHHHHHHCCH
T ss_conf             88136778899999999999999999547999999999976500445320357788751899-99999984466553036


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-
Q ss_conf             9999808981067769999999999999999889999999999999999741998999999999999999999999999-
Q gi|254780719|r  157 ELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSLI-  235 (260)
Q Consensus       157 ~~A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~~-  235 (260)
                      |.|++.|+|+++++...+.+.++.++.++..+|.+.+.+ ++.|+.+.+...+++|+.++.|.++|.........++.. 
T Consensus       219 ~~A~sLGv~v~~~r~~~l~~~~ll~a~~va~~G~I~FvG-Li~PhiaR~l~g~~~~~~lp~s~l~Ga~lll~aD~l~r~i  297 (324)
T d1l7va_         219 ISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIG-LVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLA  297 (324)
T ss_dssp             HHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSSS-SHHHHHHHHTTCCSHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             888706866677779999999999999997236445558-7579999986077751799999999999999999999760


Q ss_pred             ---HCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             ---558808999999999999998723
Q gi|254780719|r  236 ---FDTPSGPSIIITSLFLFILSFFYK  259 (260)
Q Consensus       236 ---~~lp~g~~Iv~~~~~~f~~~~~~~  259 (260)
                         .|+|.|-.+.++.+. |++.++.|
T Consensus       298 ~~p~eiPvGvitaliG~P-~fi~Ll~r  323 (324)
T d1l7va_         298 LAAAELPIGVVTATLGAP-VFIWLLLK  323 (324)
T ss_dssp             CSSSCCCHHHHHHHHHHH-HHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHH-HHHHHHHH
T ss_conf             466563299999999999-99999983



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target260 zinc uptake ABC transporter, permease protein [Candidat
2qi9_A_326 Vitamin B12 import system permease protein BTUC; i 99.92
2nq2_A_94-261168 Hypothetical ABC transporter permease protein HI14 99.74
2nq2_A_1-93_262-307139 Hypothetical ABC transporter permease protein HI14 93.45
>2qi9_A (A:) Vitamin B12 import system permease protein BTUC; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_A* Back     alignment and structure
Probab=99.92  E-value=1.6e-23  Score=146.20  Aligned_cols=252  Identities=11%  Similarity=0.046  Sum_probs=196.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHCC-----HHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9999999999998788999999879996435----89999999999999500-----36679999999999998631035
Q gi|254780719|r    8 RALFSGIGIVLSTGPLGCFIIWQRIAYFGDT----IAHSALLGVALSLIFQL-----PLTICIFMIATLTSLVLLQIQKN   78 (260)
Q Consensus         8 ~all~~~~~~~~~~~lG~~vv~rr~s~~~~a----lsH~a~~Gial~~~l~~-----~~~~ga~~~~~l~al~i~~l~~~   78 (260)
                      +-.+++.+.|...+.-|...-..-+-.++|.    ++..+..|++++.++..     .....++..+...........++
T Consensus        58 PR~l~a~l~G~~LavsG~~~Q~~~rNpLa~P~ilGi~sga~l~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  137 (326)
T 2qi9_A           58 PRTLAVLLVGAALAISGAVXQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLSAIAGALIITLILLRFAR  137 (326)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTTCSSCCGGGGTHHHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999369876742454025899999999982454027899999999999999999998762


Q ss_pred             CCCHHHHHH--HHHHHHHH-HHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             765045699--99999999-999999962132001333443332442287670589999899999998424566541288
Q gi|254780719|r   79 EALSSDAIL--GVITHSTI-SLALVILSFMKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVN  155 (260)
Q Consensus        79 ~~~~~da~i--gi~~s~~~-alg~llls~~~~~~~~l~~~LfG~il~v~~~dv~~~~~~~~~~~~~l~~~~r~l~~~~fD  155 (260)
                      ++.+.+..+  |+..+..+ +....+....++...+...++.|+....+|+|++.......+........+|++....+|
T Consensus       138 ~~~~~~~lil~gi~~~~~~~a~~~~l~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~l~lg  217 (326)
T 2qi9_A          138 RHLSTSRLLLAGVALGIISSALXTWAIYFSTSVDLRQLXYWXXGGFGGVDWRQSWLXLALIPVLLWISSQSRPXNXLALG  217 (326)
T ss_dssp             TCCCHHHHHHHHHHHHHHHHHHHHHHHHTCCTTHHHHHHHHHTCCCTTCCGGGHHHHTTTHHHHHHHTTCHHHHHHHHTC
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             13564056789999999999999999998407999999998764025467423256787506899999987676654410


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH-
Q ss_conf             8999980898106776999999999999999988999999999999999974199899999999999999999999999-
Q gi|254780719|r  156 YELAKAEGMQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIGILGIIIGLYGSL-  234 (260)
Q Consensus       156 ~~~A~~~Gi~v~~~~~l~~~l~al~v~~~v~~vG~llv~allv~Paa~A~~l~~~~~~~~~~s~~~g~~~~~~G~~lS~-  234 (260)
                      ||.|++.|+|+++++...+.+.++.++.++..+|.+.+.+ ++.|+.+.+...++.++.++.+.+.|......+..++. 
T Consensus       218 ~~~A~slGv~v~~~~~~~lil~~~lta~~vs~vG~I~FvG-Li~p~iar~l~~~~~~~~l~~s~l~Ga~lll~~d~l~r~  296 (326)
T 2qi9_A          218 EISARQLGLPLWFWRNVLVAATGWXVGVSVALAGAIGFIG-LVIPHILRLSGLTDHRVLLPGCALAGASALLLADIVARL  296 (326)
T ss_dssp             HHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSST-THHHHHHHTTTCCSHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             6677706877667668999999999999997035888989-868999998627765469999999999999999999966


Q ss_pred             ---HHCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             ---95588089999999999999987239
Q gi|254780719|r  235 ---IFDTPSGPSIIITSLFLFILSFFYKK  260 (260)
Q Consensus       235 ---~~~lp~g~~Iv~~~~~~f~~~~~~~k  260 (260)
                         ..++|.|..+.++.+..|+.....+|
T Consensus       297 ~~~~~eiPvg~~~~liG~p~fi~ll~k~~  325 (326)
T 2qi9_A          297 ALAAAELPIGVVTATLGAPVFIWLLLKAG  325 (326)
T ss_dssp             SSTTCCCCHHHHHHHHHHHHHHHHHSCC-
T ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             05666631999999999999999762047



>2nq2_A (A:94-261) Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2nq2_A (A:1-93,A:262-307) Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure