254780720

254780720

Ferroxidase

GeneID in NCBI database:8209725Locus tag:CLIBASIA_03035
Protein GI in NCBI database:254780720Protein Accession:YP_003065133.1
Gene range:-(546391, 546885)Protein Length:164aa
Gene description:Ferroxidase
COG prediction:[P] Ferritin-like protein
KEGG prediction:ftn; ferroxidase; K02217 ferritin [EC:1.16.3.1]
SEED prediction:Ferritin-like protein 2
Pathway involved in KEGG:Porphyrin and chlorophyll metabolism [PATH:las00860]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANKS
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHccc
MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTdlgveakfssieapvisandVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRligsgphsrymFDLEIEKIANKS
MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLigsgphsrymfdleiekianks
MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANKS
**NTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLE*EKI****
MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANKS
MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANKS
MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANKS
MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target164 Ferroxidase [Candidatus Liberibacter asiaticus str. psy
315121885165 Ferroxidase [Candidatus Liberibacter solanacearum CLso- 1 2e-57
325292598165 ferritin [Agrobacterium sp. H13-3] Length = 165 1 6e-37
89094892176 ferritin [Oceanospirillum sp. MED92] Length = 176 1 2e-29
149200185180 ferritin [Lentisphaera araneosa HTCC2155] Length = 180 1 6e-29
332666106175 Ferroxidase [Haliscomenobacter hydrossis DSM 1100] Leng 1 3e-28
193215565171 Ferroxidase [Chloroherpeton thalassium ATCC 35110] Leng 1 2e-27
24371739178 ferritin [Shewanella oneidensis MR-1] Length = 178 1 3e-27
333004165165 ferritin [Shigella flexneri K-272] Length = 165 1 6e-27
240949464165 ferritin-like protein 2 [Actinobacillus minor NM305] Le 1 9e-27
300867401179 Ferritin-1 [Oscillatoria sp. PCC 6506] Length = 179 1 9e-27
>gi|315121885|ref|YP_004062374.1| Ferroxidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 165 Back     alignment and organism information
 Score =  225 bits (573), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/160 (67%), Positives = 130/160 (81%)

Query: 5   RDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLG 64
           R  +LNELMN+E+ A Y+Y+QAAAWAAS NLDGCCNF LKHA EE+SHV++IF++L DLG
Sbjct: 6   RYNILNELMNIEFQAHYYYIQAAAWAASRNLDGCCNFFLKHAKEEYSHVMKIFQYLVDLG 65

Query: 65  VEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVK 124
            +A FS +    I+ANDVEG+FSL+YEHE +VT AYD AI  IL EKD+Q F FLQWF  
Sbjct: 66  EKATFSDLLKSDINANDVEGIFSLVYEHEVEVTKAYDKAIANILEEKDNQIFCFLQWFAS 125

Query: 125 EQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANKS 164
           EQ EEMAL RRILDKI+LIGSGPHS Y+FD E+ KIA++S
Sbjct: 126 EQDEEMALCRRILDKIKLIGSGPHSLYLFDQEMAKIASES 165


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325292598|ref|YP_004278462.1| ferritin [Agrobacterium sp. H13-3] Length = 165 Back     alignment and organism information
>gi|89094892|ref|ZP_01167824.1| ferritin [Oceanospirillum sp. MED92] Length = 176 Back     alignment and organism information
>gi|149200185|ref|ZP_01877208.1| ferritin [Lentisphaera araneosa HTCC2155] Length = 180 Back     alignment and organism information
>gi|332666106|ref|YP_004448894.1| Ferroxidase [Haliscomenobacter hydrossis DSM 1100] Length = 175 Back     alignment and organism information
>gi|193215565|ref|YP_001996764.1| Ferroxidase [Chloroherpeton thalassium ATCC 35110] Length = 171 Back     alignment and organism information
>gi|24371739|ref|NP_715781.1| ferritin [Shewanella oneidensis MR-1] Length = 178 Back     alignment and organism information
>gi|333004165|gb|EGK23697.1| ferritin [Shigella flexneri K-272] Length = 165 Back     alignment and organism information
>gi|240949464|ref|ZP_04753804.1| ferritin-like protein 2 [Actinobacillus minor NM305] Length = 165 Back     alignment and organism information
>gi|300867401|ref|ZP_07112056.1| Ferritin-1 [Oscillatoria sp. PCC 6506] Length = 179 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target164 Ferroxidase [Candidatus Liberibacter asiaticus str. psy
COG1528167 COG1528, Ftn, Ferritin-like protein [Inorganic ion tran 9e-32
PRK10304165 PRK10304, PRK10304, ferritin; Provisional 9e-27
pfam00210142 pfam00210, Ferritin, Ferritin-like domain 2e-24
cd00904160 cd00904, Ferritin, Ferritin iron storage proteins 4e-10
PRK15022167 PRK15022, PRK15022, ferritin-like protein; Provisional 3e-09
cd01056161 cd01056, Euk_Ferritin, eukaryotic ferritins 3e-06
cd00657130 cd00657, Ferritin_like, Ferritin-like superfamily of di 6e-05
cd01055156 cd01055, Nonheme_Ferritin, nonheme-containing ferritins 5e-45
>gnl|CDD|31717 COG1528, Ftn, Ferritin-like protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182367 PRK10304, PRK10304, ferritin; Provisional Back     alignment and domain information
>gnl|CDD|143967 pfam00210, Ferritin, Ferritin-like domain Back     alignment and domain information
>gnl|CDD|153098 cd00904, Ferritin, Ferritin iron storage proteins Back     alignment and domain information
>gnl|CDD|184983 PRK15022, PRK15022, ferritin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|153114 cd01056, Euk_Ferritin, eukaryotic ferritins Back     alignment and domain information
>gnl|CDD|153097 cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins Back     alignment and domain information
>gnl|CDD|153113 cd01055, Nonheme_Ferritin, nonheme-containing ferritins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 164 Ferroxidase [Candidatus Liberibacter asiaticus str. psy
PRK10304165 ferritin; Provisional 100.0
cd01055156 Nonheme_Ferritin nonheme-containing ferritins. Nonheme 100.0
COG1528167 Ftn Ferritin-like protein [Inorganic ion transport and 100.0
cd00904160 Ferritin Ferritin iron storage proteins. Ferritins are 100.0
cd01056161 Euk_Ferritin eukaryotic ferritins. Eukaryotic Ferritin 100.0
cd00907153 Bacterioferritin Bacterioferritin, ferritin-like diiron 100.0
KOG2332178 consensus 99.98
PRK10635158 bacterioferritin, iron storage and detoxification prote 99.96
pfam00210142 Ferritin Ferritin-like domain. This family contains fer 99.95
COG2193157 Bfr Bacterioferritin (cytochrome b1) [Inorganic ion tra 99.93
TIGR00754157 bfr bacterioferritin; InterPro: IPR002024 Bacterioferri 99.59
cd01041134 Rubrerythrin Rubrerythrin, ferritin-like diiron-binding 99.2
cd01046123 Rubrerythrin_like rubrerythrin-like, diiron-binding dom 98.89
COG1633176 Uncharacterized conserved protein [Function unknown] 98.74
cd01051156 Mn_catalase Manganese catalase, ferritin-like diiron-bi 98.61
COG1592166 Rubrerythrin [Energy production and conversion] 98.41
pfam05067272 Mn_catalase Manganese containing catalase. Catalases ar 97.74
COG3546277 Mn-containing catalase [Inorganic ion transport and met 97.28
cd07910180 MiaE MiaE tRNA-modifying nonheme diiron monooxygenase, 95.32
pfam06175199 MiaE tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE). This family 90.37
cd01052148 DPSL DPS-like protein, ferritin-like diiron-binding dom 99.92
PRK13456184 DNA protection protein DPS; Provisional 99.82
cd00657130 Ferritin_like Ferritin-like superfamily of diiron-conta 99.48
cd07908154 Mn_catalase_like Manganese catalase-like protein, ferri 99.39
COG2406172 Protein distantly related to bacterial ferritins [Gener 99.27
PRK09448164 DNA starvation/stationary phase protection protein Dps; 98.92
pfam02915137 Rubrerythrin Rubrerythrin. This domain has a ferritin-l 98.87
cd01043139 DPS DPS protein, ferritin-like diiron-binding domain. D 98.83
COG0783156 Dps DNA-binding ferritin-like protein (oxidative damage 98.78
cd01045139 Ferritin_like_AB Uncharacterized family of ferritin-lik 98.64
cd01042165 DMQH Demethoxyubiquinone hydroxylase, ferritin-like dii 97.38
cd01044125 Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin-like 96.62
pfam03232171 COQ7 Ubiquinone biosynthesis protein COQ7. Members of t 96.24
pfam04305250 DUF455 Protein of unknown function (DUF455). 95.3
pfam05974159 DUF892 Domain of unknown function (DUF892). This family 94.72
PRK13654 351 magnesium-protoporphyrin IX monomethyl ester cyclase; P 92.26
cd07909147 YciF YciF bacterial stress response protein, ferritin-l 91.34
cd01047323 ACSF Aerobic Cyclase System Fe-containing subunit (ACSF 90.9
CHL00185 349 ycf59 magnesium-protoporphyrin IX monomethyl ester cycl 90.48
pfam09537111 DUF2383 Domain of unknown function (DUF2383). Members o 97.1
COG1633176 Uncharacterized conserved protein [Function unknown] 95.6
cd01050297 Acyl_ACP_Desat Acyl ACP desaturase, ferritin-like diiro 93.7
pfam03405330 FA_desaturase_2 Fatty acid desaturase. 91.43
>PRK10304 ferritin; Provisional Back     alignment and domain information
>cd01055 Nonheme_Ferritin nonheme-containing ferritins Back     alignment and domain information
>COG1528 Ftn Ferritin-like protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00904 Ferritin Ferritin iron storage proteins Back     alignment and domain information
>cd01056 Euk_Ferritin eukaryotic ferritins Back     alignment and domain information
>cd00907 Bacterioferritin Bacterioferritin, ferritin-like diiron-binding domain Back     alignment and domain information
>KOG2332 consensus Back     alignment and domain information
>PRK10635 bacterioferritin, iron storage and detoxification protein; Provisional Back     alignment and domain information
>pfam00210 Ferritin Ferritin-like domain Back     alignment and domain information
>COG2193 Bfr Bacterioferritin (cytochrome b1) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00754 bfr bacterioferritin; InterPro: IPR002024 Bacterioferritin (BFR; also known as cytochrome b1 or cytochrome b557) , of Escherichia coli is an iron-storage protein consisting of 24 identical subunits that pack together to form a highly symmetrical, nearly spherical shell surrounding a central cavity of about 8 nm diameter , Back     alignment and domain information
>cd01041 Rubrerythrin Rubrerythrin, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01046 Rubrerythrin_like rubrerythrin-like, diiron-binding domain Back     alignment and domain information
>COG1633 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01051 Mn_catalase Manganese catalase, ferritin-like diiron-binding domain Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>pfam05067 Mn_catalase Manganese containing catalase Back     alignment and domain information
>COG3546 Mn-containing catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd07910 MiaE MiaE tRNA-modifying nonheme diiron monooxygenase, ferritin-like diiron-binding domain Back     alignment and domain information
>pfam06175 MiaE tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE) Back     alignment and domain information
>cd01052 DPSL DPS-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>PRK13456 DNA protection protein DPS; Provisional Back     alignment and domain information
>cd00657 Ferritin_like Ferritin-like superfamily of diiron-containing four-helix-bundle proteins Back     alignment and domain information
>cd07908 Mn_catalase_like Manganese catalase-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>COG2406 Protein distantly related to bacterial ferritins [General function prediction only] Back     alignment and domain information
>PRK09448 DNA starvation/stationary phase protection protein Dps; Provisional Back     alignment and domain information
>pfam02915 Rubrerythrin Rubrerythrin Back     alignment and domain information
>cd01043 DPS DPS protein, ferritin-like diiron-binding domain Back     alignment and domain information
>COG0783 Dps DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01045 Ferritin_like_AB Uncharacterized family of ferritin-like proteins found in archaea and bacteria Back     alignment and domain information
>cd01042 DMQH Demethoxyubiquinone hydroxylase, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01044 Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin-like diiron-binding domain Back     alignment and domain information
>pfam03232 COQ7 Ubiquinone biosynthesis protein COQ7 Back     alignment and domain information
>pfam04305 DUF455 Protein of unknown function (DUF455) Back     alignment and domain information
>pfam05974 DUF892 Domain of unknown function (DUF892) Back     alignment and domain information
>PRK13654 magnesium-protoporphyrin IX monomethyl ester cyclase; Provisional Back     alignment and domain information
>cd07909 YciF YciF bacterial stress response protein, ferritin-like iron-binding domain Back     alignment and domain information
>cd01047 ACSF Aerobic Cyclase System Fe-containing subunit (ACSF), ferritin-like diiron-binding domain Back     alignment and domain information
>CHL00185 ycf59 magnesium-protoporphyrin IX monomethyl ester cyclase; Provisional Back     alignment and domain information
>pfam09537 DUF2383 Domain of unknown function (DUF2383) Back     alignment and domain information
>COG1633 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01050 Acyl_ACP_Desat Acyl ACP desaturase, ferritin-like diiron-binding domain Back     alignment and domain information
>pfam03405 FA_desaturase_2 Fatty acid desaturase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target164 Ferroxidase [Candidatus Liberibacter asiaticus str. psy
2x17_0173 The X-Ray Structure Of Ferritin From Pyrococcus Fur 5e-42
2jd6_0174 Crystal Structure Of The As Isolated Ferritin From 8e-42
3kx9_A173 Engineering A Closed Form Of The Archaeoglobus Fulg 9e-41
1s3q_A173 Crystal Structures Of A Novel Open Pore Ferritin Fr 1e-39
1vlg_A176 Crystal Structure Of Ferritin (Tm1128) From Thermot 7e-39
3qz3_A184 The Crystal Structure Of Ferritin From Vibrio Chole 8e-39
1z4a_A164 Ferritin From T. Maritima Length = 164 1e-38
1krq_A167 Crystal Structure Analysis Of Campylobacter Jejuni 2e-37
3ajo_A182 Crystal Structure Of Wild-Type Human Ferritin H Cha 3e-35
3egm_A181 Structural Basis Of Iron Transport Gating In Helico 5e-35
3ajq_A182 Crystal Structure Of Human H Ferritin E140q Mutant 5e-35
2cei_A183 Recombinant Human H Ferritin, K86q Mutant, Soaked W 6e-35
3ajp_A182 Crystal Structure Of Human H Ferritin E140a Mutant 9e-35
2clu_A183 Recombinant Human H Ferritin, K86q And E107d Mutant 9e-35
1eum_A165 Crystal Structure Of The E.Coli Ferritin Ecftna Len 2e-34
3bve_B181 Structural Basis For The Iron Uptake Mechanism Of H 2e-34
3erz_A183 Directing Noble Metal Ion Chemistry Within A Design 5e-34
2chi_A183 Recombinant Human H Ferritin, K86q And E27d Mutant 6e-34
2cn7_A183 Recombinant Human H Ferritin, K86q, E27d And E107d 9e-34
1r03_A182 Crystal Structure Of A Human Mitochondrial Ferritin 1e-33
2z6m_A176 Crystal Structure Of Human Ferritin H8 As Biotempla 2e-33
3es3_A183 Directing Noble Metal Ion Chemistry Within A Design 2e-33
1bg7_A176 Localized Unfolding At The Junction Of Three Ferrit 4e-32
1mfr_A176 Crystal Structure Of M Ferritin Length = 176 6e-32
3ka8_A176 Frog M-Ferritin, Eqh Mutant, With Cobalt Length = 1 9e-32
3ka6_A176 Frog M-Ferritin, Eed Mutant, With Cobalt Length = 1 3e-31
3ka9_A176 Frog M-Ferritin, Eeh Mutant, With Cobalt Length = 1 4e-31
1rci_A173 Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt 3e-29
1rcd_A173 Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt 1e-28
3a68_A212 Crystal Structure Of Plant Ferritin Reveals A Novel 2e-28
3a9q_A212 Crystal Structure Analysis Of E173a Variant Of The 1e-27
1rcc_A173 Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt 2e-27
3hx2_A192 Crystal Structure Of Human Ferritin Phe167serfsx26 5e-26
3kxu_A191 Crystal Structure Of Human Ferritin Ftl498instc Pat 7e-26
2ffx_J173 Structure Of Human Ferritin L. Chain Length = 173 1e-25
2fg4_A174 Structure Of Human Ferritin L Chain Length = 174 2e-25
3af9_X174 Crystal Structure Of Pd(Allyl)APO-C48afr Length = 1 4e-25
3qd8_A181 Crystal Structure Of Mycobacterium Tuberculosis Bfr 5e-25
2gyd_A170 Complex Of Equine Apoferritin With The H-Diaziflura 5e-25
3np2_X174 Crystal Structure Of Pd(Allyl)APO-E45cC48A-Rhlfr Le 6e-25
2zg8_X174 Crystal Structure Of Pd(Allyl)APO-H49afr Length = 1 7e-25
2g4h_A174 Anomalous Substructure Of Apoferritin Length = 174 7e-25
2za7_A171 Recombinant Horse L-Chain Apoferritin N-Terminal De 8e-25
2za8_A167 Recombinant Horse L-Chain Apoferritin N-Terminal De 8e-25
1ies_A174 Tetragonal Crystal Structure Of Native Horse Spleen 9e-25
2za6_A175 Recombinant Horse L-Chain Apoferritin Length = 175 1e-24
2zg9_X174 Crystal Structure Of Pd(Allyl)APO-H114afr Length = 1e-24
2v2n_A174 Mutant R59m Recombinant Horse Spleen Apoferritin Co 1e-24
1h96_A182 Recombinant Mouse L-Chain Ferritin Length = 182 1e-24
2zur_X174 Crystal Structure Of Rh(Nbd)APO-Fr Length = 174 1e-24
2v2l_A174 Mutant (E53,56,57,60q) Recombinant Horse Spleen Apo 2e-24
2v2p_A174 Mutant (E53,56,57,60q And R59m) Recombinant Horse S 3e-24
3af8_X174 Crystal Structure Of Pd(Ally)APO-C126afr Length = 1 3e-24
3np0_X174 Crystal Structure Of Pd(Allyl)APO-E45cH49AR52H-Rhlf 4e-24
3noz_X174 Crystal Structure Of Pd(Allyl)APO-E45cR52H-Rhlfr Le 4e-24
3e6r_A168 Crystal Structure Of Apo-Ferritin From Pseudo-Nitzs 1e-23
3bkn_A161 The Structure Of Mycobacterial Bacterioferritin Len 5e-21
3fvb_A182 Crystal Structure Of Ferritin (Bacterioferritin) Fr 6e-20
2wtl_A173 Crystal Structure Of Bfra From M. Tuberculosis Leng 7e-20
1bcf_A158 The Structure Of A Unique, Two-Fold Symmetric, Haem 9e-20
1z6o_M191 Crystal Structure Of Trichoplusia Ni Secreted Ferri 1e-19
2fkz_A155 Reduced (All Ferrous) Form Of The Azotobacter Vinel 2e-19
3e2c_A158 Escherichia Coli Bacterioferritin Mutant E128rE135R 2e-19
1sof_A156 Crystal Structure Of The Azotobacter Vinelandii Bac 3e-19
3e1q_A158 Crystal Structure Of W133f Variant E. Coli Bacterio 3e-19
1jgc_A161 The 2.6 A Structure Resolution Of Rhodobacter Capsu 7e-19
3ghq_A158 Crystal Structure Of E. Coli W35f Bfr Mutant Length 8e-19
3is7_A158 Structure Of Mineralized Bfrb From Pseudomonas Aeru 1e-18
3gvy_A161 Crystal Structure Of Bacterioferritin From R.Sphaer 2e-17
1nf4_A179 X-Ray Structure Of The Desulfovibrio Desulfuricans 1e-15
2clb_A188 The Structure Of The Dps-Like Protein From Sulfolob 2e-06
1z6o_A212 Crystal Structure Of Trichoplusia Ni Secreted Ferri 3e-05
2qqy_A149 Crystal Structure Of Ferritin Like, Diiron-Carboxyl 4e-05
2vzb_A170 A Dodecameric Thioferritin In The Bacterial Domain, 0.002
>gi|294979352|pdb|2X17|0 Chain 0, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus Loaded With Ag(I) Length = 173 Back     alignment and structure
 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 47/163 (28%), Positives = 75/163 (46%)

Query: 1   MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHL 60
           ++    + LN+ +N E  + Y Y   AA+     L+G  N++   A EE  H +R + ++
Sbjct: 2   LSERMLKALNDQLNRELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYI 61

Query: 61  TDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQ 120
            D     +   I  P          F   YEHE  ++ +  +       EKD+ T  FL+
Sbjct: 62  YDRNGRVELDEIPKPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLE 121

Query: 121 WFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANK 163
           WF+ EQ EE A  ++ILDK++     P   +M D E+   A K
Sbjct: 122 WFINEQVEEEASVKKILDKLKFAKDSPQILFMLDKELSARAPK 164


gi|134104776|pdb|2JD6|0 Chain 0, Crystal Structure Of The As Isolated Ferritin From The Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus Length = 174 Back     alignment and structure
gi|315113354|pdb|3KX9|A Chain A, Engineering A Closed Form Of The Archaeoglobus Fulgidus Ferritin By Site Directed Mutagenesis Length = 173 Back     alignment and structure
>gi|66360080|pdb|1S3Q|A Chain A, Crystal Structures Of A Novel Open Pore Ferritin From The Hyperthermophilic Archaeon Archaeoglobus Fulgidus Length = 173 Back     alignment and structure
>gi|52696195|pdb|1VLG|A Chain A, Crystal Structure Of Ferritin (Tm1128) From Thermotoga Maritima At 2.00 A Resolution Length = 176 Back     alignment and structure
>gi|326634599|pdb|3QZ3|A Chain A, The Crystal Structure Of Ferritin From Vibrio Cholerae O1 Biovar El Tor Str. N16961 Length = 184 Back     alignment and structure
>gi|118137235|pdb|1Z4A|A Chain A, Ferritin From T. Maritima Length = 164 Back     alignment and structure
gi|18655488|pdb|1KRQ|A Chain A, Crystal Structure Analysis Of Campylobacter Jejuni Ferritin Length = 167 Back     alignment and structure
>gi|304445745|pdb|3AJO|A Chain A, Crystal Structure Of Wild-Type Human Ferritin H Chain Length = 182 Back     alignment and structure
>gi|254839251|pdb|3EGM|A Chain A, Structural Basis Of Iron Transport Gating In Helicobacter Pylori Ferritin Length = 181 Back     alignment and structure
>gi|304445747|pdb|3AJQ|A Chain A, Crystal Structure Of Human H Ferritin E140q Mutant Length = 182 Back     alignment and structure
>gi|122919696|pdb|2CEI|A Chain A, Recombinant Human H Ferritin, K86q Mutant, Soaked With Zn Length = 183 Back     alignment and structure
>gi|304445746|pdb|3AJP|A Chain A, Crystal Structure Of Human H Ferritin E140a Mutant Length = 182 Back     alignment and structure
>gi|122919708|pdb|2CLU|A Chain A, Recombinant Human H Ferritin, K86q And E107d Mutant Length = 183 Back     alignment and structure
gi|13786801|pdb|1EUM|A Chain A, Crystal Structure Of The E.Coli Ferritin Ecftna Length = 165 Back     alignment and structure
>gi|209870575|pdb|3ERZ|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed Ferritin Protein. Mercury Ions On The Three-Fold Channel Length = 183 Back     alignment and structure
>gi|122919702|pdb|2CHI|A Chain A, Recombinant Human H Ferritin, K86q And E27d Mutant Length = 183 Back     alignment and structure
>gi|122919718|pdb|2CN7|A Chain A, Recombinant Human H Ferritin, K86q, E27d And E107d Mutant Length = 183 Back     alignment and structure
>gi|50513352|pdb|1R03|A Chain A, Crystal Structure Of A Human Mitochondrial Ferritin Length = 182 Back     alignment and structure
>gi|194368605|pdb|2Z6M|A Chain A, Crystal Structure Of Human Ferritin H8 As Biotemplate For Noble Metal Nanoparticle Synthesis Length = 176 Back     alignment and structure
>gi|209870587|pdb|3ES3|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed Ferritin Protein. The Complex With Gold Ions. Ferritin H8- H9x Mutant Length = 183 Back     alignment and structure
>gi|157830291|pdb|1BG7|A Chain A, Localized Unfolding At The Junction Of Three Ferritin Subunits. A Mechanism For Iron Release? Length = 176 Back     alignment and structure
gi|5542288|pdb|1MFR|A Chain A, Crystal Structure Of M Ferritin Length = 176 Back     alignment and structure
>gi|308198495|pdb|3KA8|A Chain A, Frog M-Ferritin, Eqh Mutant, With Cobalt Length = 176 Back     alignment and structure
>gi|308198494|pdb|3KA6|A Chain A, Frog M-Ferritin, Eed Mutant, With Cobalt Length = 176 Back     alignment and structure
>gi|308198496|pdb|3KA9|A Chain A, Frog M-Ferritin, Eeh Mutant, With Cobalt Length = 176 Back     alignment and structure
>gi|157833654|pdb|1RCI|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 Back     alignment and structure
gi|157833649|pdb|1RCD|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 Back     alignment and structure
>gi|270346417|pdb|3A68|A Chain A, Crystal Structure Of Plant Ferritin Reveals A Novel Metal Binding Site That Functions As A Transit Site For Metal Transfer In Ferritin Length = 212 Back     alignment and structure
>gi|270346457|pdb|3A9Q|A Chain A, Crystal Structure Analysis Of E173a Variant Of The Soybean Ferritin Sfer4 Length = 212 Back     alignment and structure
>gi|157833648|pdb|1RCC|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 Back     alignment and structure
>gi|256032703|pdb|3HX2|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of The Biological Unit That Are Present In The Crystallographic Asymmetric Unit. The Entire Structure Contains Six Copies Of The Biological Unit In The Crystallographic Asymmetric Unit And Is Described In Remark 400 Length = 192 Back     alignment and structure
>gi|288563134|pdb|3KXU|A Chain A, Crystal Structure Of Human Ferritin Ftl498instc Pathogenic M Length = 191 Back     alignment and structure
>gi|112490564|pdb|2FFX|J Chain J, Structure Of Human Ferritin L. Chain Length = 173 Back     alignment and structure
>gi|110591399|pdb|2FG4|A Chain A, Structure Of Human Ferritin L Chain Length = 174 Back     alignment and structure
>gi|302566023|pdb|3AF9|X Chain X, Crystal Structure Of Pd(Allyl)APO-C48afr Length = 174 Back     alignment and structure
gi|330689568|pdb|3QD8|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Bfrb Length = 181 Back     alignment and structure
>gi|110590458|pdb|2GYD|A Chain A, Complex Of Equine Apoferritin With The H-Diaziflurane Photolabeling Reagent Length = 170 Back     alignment and structure
>gi|315364496|pdb|3NP2|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cC48A-Rhlfr Length = 174 Back     alignment and structure
>gi|197305024|pdb|2ZG8|X Chain X, Crystal Structure Of Pd(Allyl)APO-H49afr Length = 174 Back     alignment and structure
>gi|134104324|pdb|2G4H|A Chain A, Anomalous Substructure Of Apoferritin Length = 174 Back     alignment and structure
>gi|166007295|pdb|2ZA7|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal Deletion Mutant (Residues 1-4) Length = 171 Back     alignment and structure
>gi|166007296|pdb|2ZA8|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal Deletion Mutant (Residues 1-8) Length = 167 Back     alignment and structure
>gi|1942614|pdb|1IES|A Chain A, Tetragonal Crystal Structure Of Native Horse Spleen Ferritin Length = 174 Back     alignment and structure
>gi|166007294|pdb|2ZA6|A Chain A, Recombinant Horse L-Chain Apoferritin Length = 175 Back     alignment and structure
>gi|197305025|pdb|2ZG9|X Chain X, Crystal Structure Of Pd(Allyl)APO-H114afr Length = 174 Back     alignment and structure
>gi|192988224|pdb|2V2N|A Chain A, Mutant R59m Recombinant Horse Spleen Apoferritin Cocrystallized With Haemin In Acidic Conditions Length = 174 Back     alignment and structure
>gi|13787175|pdb|1H96|A Chain A, Recombinant Mouse L-Chain Ferritin Length = 182 Back     alignment and structure
>gi|238828095|pdb|2ZUR|X Chain X, Crystal Structure Of Rh(Nbd)APO-Fr Length = 174 Back     alignment and structure
>gi|192988220|pdb|2V2L|A Chain A, Mutant (E53,56,57,60q) Recombinant Horse Spleen Apoferritin Cocrystallized With Haemin In Acidic Conditions Length = 174 Back     alignment and structure
>gi|192988228|pdb|2V2P|A Chain A, Mutant (E53,56,57,60q And R59m) Recombinant Horse Spleen Apoferritin Cocrystallized With Haemin In Acidic Conditions Length = 174 Back     alignment and structure
>gi|302566022|pdb|3AF8|X Chain X, Crystal Structure Of Pd(Ally)APO-C126afr Length = 174 Back     alignment and structure
>gi|315364495|pdb|3NP0|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cH49AR52H-Rhlfr Length = 174 Back     alignment and structure
>gi|315364494|pdb|3NOZ|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cR52H-Rhlfr Length = 174 Back     alignment and structure
>gi|215261242|pdb|3E6R|A Chain A, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia Multiseries Length = 168 Back     alignment and structure
gi|166007341|pdb|3BKN|A Chain A, The Structure Of Mycobacterial Bacterioferritin Length = 161 Back     alignment and structure
>gi|222447132|pdb|3FVB|A Chain A, Crystal Structure Of Ferritin (Bacterioferritin) From Brucella Melitensis Length = 182 Back     alignment and structure
>gi|281306930|pdb|2WTL|A Chain A, Crystal Structure Of Bfra From M. Tuberculosis Length = 173 Back     alignment and structure
gi|809204|pdb|1BCF|A Chain A, The Structure Of A Unique, Two-Fold Symmetric, Haem-Binding Site Length = 158 Back     alignment and structure
>gi|67463961|pdb|1Z6O|M Chain M, Crystal Structure Of Trichoplusia Ni Secreted Ferritin Length = 191 Back     alignment and structure
>gi|93279572|pdb|2FKZ|A Chain A, Reduced (All Ferrous) Form Of The Azotobacter Vinelandii Bacterioferritin Length = 155 Back     alignment and structure
>gi|237640507|pdb|3E2C|A Chain A, Escherichia Coli Bacterioferritin Mutant E128rE135R Length = 158 Back     alignment and structure
gi|62737970|pdb|1SOF|A Chain A, Crystal Structure Of The Azotobacter Vinelandii Bacterioferritin At 2.6 A Resolution Length = 156 Back     alignment and structure
>gi|256032462|pdb|3E1Q|A Chain A, Crystal Structure Of W133f Variant E. Coli Bacterioferritn With Iron. Length = 158 Back     alignment and structure
gi|18158622|pdb|1JGC|A Chain A, The 2.6 A Structure Resolution Of Rhodobacter Capsulatus Bacterioferritin With Metal-Free Dinuclear Site And Heme Iron In A Crystallographic Special Position Length = 161 Back     alignment and structure
>gi|260656275|pdb|3GHQ|A Chain A, Crystal Structure Of E. Coli W35f Bfr Mutant Length = 158 Back     alignment and structure
gi|285803288|pdb|3IS7|A Chain A, Structure Of Mineralized Bfrb From Pseudomonas Aeruginosa To 2.1a Resolution Length = 158 Back     alignment and structure
gi|281500765|pdb|3GVY|A Chain A, Crystal Structure Of Bacterioferritin From R.Sphaeroides Length = 161 Back     alignment and structure
gi|29726616|pdb|1NF4|A Chain A, X-Ray Structure Of The Desulfovibrio Desulfuricans Bacterioferritin: The Diiron Site In Different States (Reduced Structure) Length = 179 Back     alignment and structure
>gi|112490179|pdb|2CLB|A Chain A, The Structure Of The Dps-Like Protein From Sulfolobus Solfataricus Reveals A Bacterioferritin-Like Di-Metal Binding Site Within A Dps-Like Dodecameric Assembly Length = 188 Back     alignment and structure
>gi|67463949|pdb|1Z6O|A Chain A, Crystal Structure Of Trichoplusia Ni Secreted Ferritin Length = 212 Back     alignment and structure
>gi|157836256|pdb|2QQY|A Chain A, Crystal Structure Of Ferritin Like, Diiron-Carboxylate Proteins From Bacillus Anthracis Str. Ames Length = 149 Back     alignment and structure
gi|268612087|pdb|2VZB|A Chain A, A Dodecameric Thioferritin In The Bacterial Domain, Characterization Of The Bacterioferritin-Related Protein From Bacteroides Fragilis Length = 170 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target164 Ferroxidase [Candidatus Liberibacter asiaticus str. psy
3bvf_A181 Ferritin; iron storage, cytoplasm, metal-binding, oxido 3e-32
2jd6_0174 Ferritin homolog, ferritin; metal transport, iron, pore 4e-29
1eum_A165 Ferritin 1; ECFTNA, metal binding protein; 2.05A {Esche 3e-28
3e6s_A168 Ferritin; iron storage, ferroxidase, oxidoreductase; 1. 8e-28
1krq_A167 Ferritin; H-chain like four-helix bundle, metal binding 9e-28
1vlg_A176 Ferritin; TM1128, structural genomics, JCSG, protein st 2e-26
1s3q_A173 Ferritin; ferroxidase, four helix bundle, iron storage, 6e-26
3a68_A212 Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iro 1e-25
3ka8_A176 Ferritin, middle subunit; iron storage, DIIRON, iron, m 2e-21
3kxu_A191 Ferritin; iron storage protein, disorder, iron, metal b 9e-20
3fvb_A182 Bacterioferritin; niaid, ssgcid, decode, structural gen 9e-20
1nfv_A179 Bacterioferritin; 24 subunits in the active molecule, D 2e-18
1z6o_A212 Ferritin light chain; metal binding protein, iron stora 1e-17
2wtl_A173 Bacterioferritin, BFR; metal binding protein, bacteriof 2e-17
1z6o_M191 Ferritin heavy chain; metal binding protein, iron stora 2e-17
1jgc_A161 Bacterioferritin, BFR; iron storage protein, metal bind 2e-17
2cih_A183 Ferritin heavy chain; apoferritin, ferroxidase, DI-iron 3e-17
3gvy_A161 Bacterioferritin; iron storage, DI-iron, ferroxidase ac 2e-16
2fkz_A155 Bacterioferritin; ferroxidase, DIIRON site, iron transp 3e-16
1rcd_A173 L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP 4e-16
2v2p_A174 Ferritin light chain; metal transport, iron, haemin, ap 1e-15
1bg7_A176 Ferritin; iron storage; 1.85A {Rana catesbeiana} SCOP: 2e-15
3e2c_A158 Bacterioferritin; DIIRON site, iron storage, metal-bind 8e-14
1j30_A144 144AA long hypothetical rubrerythrin; sulerythrin, sulf 2e-13
2qqy_A149 Sigma B operon; dodecameric alpha-helical, ferritin fol 3e-13
2vzb_A170 Putative bacterioferritin-related protein; DPS, DPSL, i 2e-10
2oh3_A167 Rubrerythrin, COG1633: uncharacterized conserved protei 4e-10
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIRON, f 6e-10
2clb_A188 DPS-like protein; DI-iron carboxylate, hypothetical pro 9e-09
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, elect 2e-08
1nnq_A171 Rubrerythrin; structural genomics, PSI, protein structu 1e-04
>2jd6_0 Ferritin homolog, ferritin; metal transport, iron, pores, archaeon, entry channels, thermostability, hyperthermophIle, ferroxidase center; 2.75A {Pyrococcus furiosus} PDB: 2jd7_0 2jd8_0 Length = 174 Back     alignment and structure
>1eum_A Ferritin 1; ECFTNA, metal binding protein; 2.05A {Escherichia coli} SCOP: a.25.1.1 Length = 165 Back     alignment and structure
>3e6s_A Ferritin; iron storage, ferroxidase, oxidoreductase; 1.95A {Pseudo-nitzschia multiseries} PDB: 3e6r_A Length = 168 Back     alignment and structure
>1krq_A Ferritin; H-chain like four-helix bundle, metal binding protein; 2.70A {Campylobacter jejuni} SCOP: a.25.1.1 Length = 167 Back     alignment and structure
>1vlg_A Ferritin; TM1128, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 2.00A {Thermotoga maritima MSB8} SCOP: a.25.1.1 PDB: 1z4a_A* Length = 176 Back     alignment and structure
>1s3q_A Ferritin; ferroxidase, four helix bundle, iron storage, metal binding protein; 2.10A {Archaeoglobus fulgidus} SCOP: a.25.1.1 PDB: 1sq3_A Length = 173 Back     alignment and structure
>3a68_A Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iron storage, CAGE-like protein, plant, iron, metal-binding, oxidoreductase, plastid; 1.80A {Glycine max} PDB: 3a9q_A Length = 212 Back     alignment and structure
>3ka8_A Ferritin, middle subunit; iron storage, DIIRON, iron, metal-binding, oxidoreductase; 1.35A {Rana catesbeiana} PDB: 3ka9_A 3ka3_A 1mfr_A 3ka4_A 3ka6_A 1bg7_A Length = 176 Back     alignment and structure
>3kxu_A Ferritin; iron storage protein, disorder, iron, metal binding protein; 1.85A {Homo sapiens} PDB: 3hx2_A 3hx5_A 3hx7_A Length = 191 Back     alignment and structure
>3fvb_A Bacterioferritin; niaid, ssgcid, decode, structural genomics, seattle structural genomics center for infectious disease; HET: HEM; 1.81A {Brucella melitensis biovar ABORTUS2308} Length = 182 Back     alignment and structure
>1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON centre, HAEM Fe-coproporphyrin III cofactor; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* Length = 179 Back     alignment and structure
>1z6o_A Ferritin light chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Length = 212 Back     alignment and structure
>2wtl_A Bacterioferritin, BFR; metal binding protein, bacterioferritin A, heme, iron, biliverdin, iron storage, metal-binding; HET: UNL; 2.59A {Mycobacterium tuberculosis} PDB: 3bkn_A* Length = 173 Back     alignment and structure
>1z6o_M Ferritin heavy chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Length = 191 Back     alignment and structure
>1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1 Length = 161 Back     alignment and structure
>2cih_A Ferritin heavy chain; apoferritin, ferroxidase, DI-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation; 1.5A {Homo sapiens} PDB: 2chi_A 2cei_A 1fha_A 2fha_A 2cn7_A 2iu2_A 2clu_A 2cn6_A 3erz_A 3es3_A 2z6m_A 1r03_A Length = 183 Back     alignment and structure
>3gvy_A Bacterioferritin; iron storage, DI-iron, ferroxidase activity, heme, metal binding protein; HET: HEM; 2.80A {Rhodobacter sphaeroides 2} Length = 161 Back     alignment and structure
>2fkz_A Bacterioferritin; ferroxidase, DIIRON site, iron transport, metal binding protein; HET: HEM; 2.00A {Azotobacter vinelandii} SCOP: a.25.1.1 PDB: 2fl0_A* 1sof_A* Length = 155 Back     alignment and structure
>1rcd_A L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1rcg_A 1rci_A 1rcc_A 1rce_A Length = 173 Back     alignment and structure
>2v2p_A Ferritin light chain; metal transport, iron, haemin, apoferritin, iron storage, metal-binding; 1.15A {Equus caballus} PDB: 2v2r_A 2v2m_A 2v2l_A 2v2s_A 2v2o_A 2v2n_A 2za6_A 2v2j_A 2v2i_A 2z5p_A 1dat_A 2g4h_A 1aew_A 2zg9_X 2zg8_X 3fi6_A 2w0o_A 1hrs_A* 1ier_A 1ies_A ... Length = 174 Back     alignment and structure
>1bg7_A Ferritin; iron storage; 1.85A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1mfr_A Length = 176 Back     alignment and structure
>3e2c_A Bacterioferritin; DIIRON site, iron storage, metal-binding, heme, iron, oxidoreductase; HET: HEM; 1.80A {Escherichia coli} PDB: 2vxi_A* 1bfr_A* 1bcf_A* 2htn_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* Length = 158 Back     alignment and structure
>1j30_A 144AA long hypothetical rubrerythrin; sulerythrin, sulfolobus tokodaii strain 7, four-helix bundle, domain swapping; 1.70A {Sulfolobus tokodaii str} SCOP: a.25.1.1 Length = 144 Back     alignment and structure
>2qqy_A Sigma B operon; dodecameric alpha-helical, ferritin fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Bacillus anthracis str} Length = 149 Back     alignment and structure
>2vzb_A Putative bacterioferritin-related protein; DPS, DPSL, iron, oxidative stress, metal transport; 2.30A {Bacteroides fragilis} Length = 170 Back     alignment and structure
>2oh3_A Rubrerythrin, COG1633: uncharacterized conserved protein; ZP_00055496.1, structural genomics; HET: MSE PGE; 2.00A {Magnetospirillum magnetotacticum ms-1} SCOP: a.25.1.8 Length = 167 Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubredoxin-like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Length = 191 Back     alignment and structure
>2clb_A DPS-like protein; DI-iron carboxylate, hypothetical protein, bacterioferritin, hydrogen peroxide, metal binding protein, archaea; 2.4A {Sulfolobus solfataricus} Length = 188 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIRON center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Length = 202 Back     alignment and structure
>1nnq_A Rubrerythrin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.35A {Pyrococcus furiosus} SCOP: a.25.1.1 g.41.5.1 PDB: 2hr5_A Length = 171 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target164 Ferroxidase [Candidatus Liberibacter asiaticus str. psy
2jd6_0174 Ferritin homolog, ferritin; metal transport, iron, pore 100.0
1eum_A165 Ferritin 1; ECFTNA, metal binding protein; 2.05A {Esche 100.0
1krq_A167 Ferritin; H-chain like four-helix bundle, metal binding 100.0
1s3q_A173 Ferritin; ferroxidase, four helix bundle, iron storage, 100.0
1vlg_A176 Ferritin; TM1128, structural genomics, JCSG, protein st 100.0
3bvf_A181 Ferritin; iron storage, cytoplasm, metal-binding, oxido 100.0
3a68_A212 Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iro 100.0
2cih_A183 Ferritin heavy chain; apoferritin, ferroxidase, DI-iron 100.0
3e6s_A168 Ferritin; iron storage, ferroxidase, oxidoreductase; 1. 100.0
3kxu_A191 Ferritin; iron storage protein, disorder, iron, metal b 100.0
3ka8_A176 Ferritin, middle subunit; iron storage, DIIRON, iron, m 100.0
2v2p_A174 Ferritin light chain; metal transport, iron, haemin, ap 100.0
1rcd_A173 L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP 100.0
1z6o_A212 Ferritin light chain; metal binding protein, iron stora 100.0
1z6o_M191 Ferritin heavy chain; metal binding protein, iron stora 100.0
3fvb_A182 Bacterioferritin; niaid, ssgcid, decode, structural gen 100.0
1jgc_A161 Bacterioferritin, BFR; iron storage protein, metal bind 100.0
2fkz_A155 Bacterioferritin; ferroxidase, DIIRON site, iron transp 100.0
2wtl_A173 Bacterioferritin, BFR; metal binding protein, bacteriof 100.0
3gvy_A161 Bacterioferritin; iron storage, DI-iron, ferroxida acti 99.97
3e2c_A158 Bacterioferritin; DIIRON site, iron storage, metal-bind 99.97
1nfv_A179 Bacterioferritin; 24 subunits in the active molecule, D 99.96
2qqy_A149 Sigma B operon; dodecameric alpha-helical, ferritin fol 99.95
1j30_A144 144AA long hypothetical rubrerythrin; sulerythrin, sulf 99.92
2vzb_A170 Putative bacterioferritin-related protein; DPS, DPSL, i 99.92
2clb_A188 DPS-like protein; DI-iron carboxylate, hypothetical pro 99.9
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIRON, f 99.81
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, elect 99.8
2oh3_A167 Rubrerythrin, COG1633: uncharacterized conserved protei 99.54
1nnq_A171 Rubrerythrin; structural genomics, PSI, protein structu 99.48
2fzf_A175 Hypothetical protein; structural genomics, southeast co 99.19
1vjx_A157 Putative ferritin-like DIIRON-carboxylate protein TM152 99.1
1o9i_A266 Pseudocatalase; oxidoreductase, hexamer, dimanganese ca 98.72
2v8t_A302 Manganese-containing pseudocatalase; manganese catalase 98.44
2ib0_A170 Conserved hypothetical alanine rich protein; 4-helix bu 98.24
3hiu_A166 Uncharacterized protein; APC40011, XCC3681, xanthomonas 93.55
3ogh_B171 Protein YCIE; iron-binding, MCSG, four-helix-bundle, st 93.38
2gs4_A166 Protein YCIF; stress proteins, rubrerythrin, metal bind 92.38
2itb_A206 TRNA-(MS(2)IO(6)A)-hydroxylase, putative; putative ATTH 91.93
1o9r_A162 Agrobacterium tumefaciens DPS; iron-binding protein, DN 99.58
1tjo_A182 Iron-rich DPSA-homolog protein; ferritin, low-iron, met 99.51
2vxx_A192 Starvation induced DNA binding protein; stress response 99.49
1ji5_A142 DLP-1; dodecamer, four-helix bundle, metal transport; 2 99.4
2d5k_A156 DPS, DPS family protein; four helix bundle, metal bindi 99.37
2chp_A153 MRGA, metalloregulation DNA-binding stress protein; DNA 99.36
1ji4_A144 Neutrophil-activating protein A; dodecamer, four-helix 99.36
2fjc_A156 Antigen TPF1; mini ferritin, iron binding protein, meta 99.35
2c41_A158 DPS family DNA-binding stress response protein; iron-bi 99.35
2cf7_A165 DPR; peroxide resistance, DPS-family, ferritin-like, fe 99.35
2c2u_A207 DPS, DNA-binding stress response protein; DNA-binding p 99.35
1jig_A146 DLP-2; dodecamer, four-helix bundle, metal transport; 1 99.34
3iq1_A159 DPS family protein; csgid, SAD, niaid, metal transport, 99.34
1n1q_A149 DPS protein; four-helix bundle, unknown function; 2.20A 99.33
2yw6_A183 DNA protection during starvation protein; DNA-binding p 99.32
2wlu_A175 DPS-like peroxide resistance protein; DNA-binding, oxid 99.28
2xgw_A199 Peroxide resistance protein; metal binding protein; 2.1 99.26
2bk6_A156 Non-heme iron-containing ferritin; DPS (DNA binding pro 99.15
3kwo_A152 Putative bacterioferritin; alpha-helix, bacterial ferri 99.05
2c2j_A211 DNA-binding stress response protein; DNA-binding protei 99.03
2z90_A161 Starvation-inducible DNA-binding protein or FINE tangle 99.01
1dps_A167 DPS, PEXB; DNA-binding protein, ferritin, iron sequestr 98.92
2pyb_A151 NAPA, neutrophil activating protein; ferritin, DPS, fou 98.65
1zuj_A179 Hypothetical protein llacc01001955; oxidative stress, D 98.51
1zs3_A182 Lactococcus lactis Mg1363 DPSA; oxidative stress, DNA b 98.51
3hl1_A 317 Ferritin like protein; NP_419375.1, structural genomics 96.87
1zpy_A95 Hypothetical protein NE0167; structural genomics, MCSG, 95.9
2e0z_A 345 Virus-like particle; bacteriophage, HK97; 3.60A {Pyroco 95.86
2qqy_A149 Sigma B operon; dodecameric alpha-helical, ferritin fol 94.79
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIRON, f 94.68
1nnq_A171 Rubrerythrin; structural genomics, PSI, protein structu 93.64
2fkz_A155 Bacterioferritin; ferroxidase, DIIRON site, iron transp 93.12
2uw1_A338 Desaturase, plastid delta4 multifunctional acyl-ACYL ca 95.24
1za0_A275 Possible acyl-[acyl-carrier protein] desaturase DESA2 ( 94.98
2oh3_A167 Rubrerythrin, COG1633: uncharacterized conserved protei 95.09
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, elect 94.35
2fzf_A175 Hypothetical protein; structural genomics, southeast co 93.9
3e2c_A158 Bacterioferritin; DIIRON site, iron storage, metal-bind 93.24
>2jd6_0 Ferritin homolog, ferritin; metal transport, iron, pores, archaeon, entry channels, thermostability, hyperthermophIle, ferroxidase center; 2.75A {Pyrococcus furiosus} PDB: 2jd7_0 2jd8_0 2x17_0 Back     alignment and structure
Probab=100.00  E-value=0  Score=313.87  Aligned_cols=163  Identities=29%  Similarity=0.449  Sum_probs=160.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCC
Q ss_conf             99899999999999999999999999999815994789999999999999999999999995399714378225720488
Q gi|254780720|r    1 MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISAN   80 (164)
Q Consensus         1 ~s~~~~~~Ln~qi~~El~as~~Yl~~a~~~~~~~~~g~a~~f~~~a~EE~~HA~~l~~yi~~rgg~~~~~~i~~p~~~~~   80 (164)
                      ||++|+++||+|||.||+||++|++||+||+++|+|||++||+.+|.|||+||++|++||++|||.|+++++++|+.+|.
T Consensus         2 ~s~~v~~~LN~qi~~El~as~~Yl~ma~~~~~~~l~g~a~~f~~~a~EE~~HA~~l~~yi~~rgg~~~~~~i~~p~~~~~   81 (174)
T 2jd6_0            2 LSERMLKALNDQLNRELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEIPKPPKEWE   81 (174)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCCCCBCCCCCCCS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCCCC
T ss_conf             86899999999999999999999999999863685889999999979999869999999997699700388788876668


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             98999999999999999999999999997099889999999999999999999999999995288751699999999965
Q gi|254780720|r   81 DVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKI  160 (164)
Q Consensus        81 ~~~e~~~~al~~E~~vt~~~~~l~~~A~~~~D~~t~~fl~~fl~EQ~eee~~~~~ll~~l~~~g~~~~glyl~D~~l~~~  160 (164)
                      ++.++|+.++++|+.|++.|++++++|++++|++|.+||+|||+||+++++++++++++++++|++|.|+|+||++|++.
T Consensus        82 ~~~e~l~~al~~E~~v~~~~~~l~~~A~~~~D~~t~~fle~fl~eQ~eee~~~~~~l~~l~~~g~~~~~ly~~D~~L~~~  161 (174)
T 2jd6_0           82 SPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLEWFINEQVEEEASVKKILDKLKFAKDSPQILFMLDKELSAR  161 (174)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHTTC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
T ss_conf             89999999999999999999999999988799448999999999999999999999999987078840799999998734


Q ss_pred             HCC
Q ss_conf             318
Q gi|254780720|r  161 ANK  163 (164)
Q Consensus       161 ~~~  163 (164)
                      +..
T Consensus       162 ~~~  164 (174)
T 2jd6_0          162 APK  164 (174)
T ss_dssp             CCS
T ss_pred             CCC
T ss_conf             679



>1eum_A Ferritin 1; ECFTNA, metal binding protein; 2.05A {Escherichia coli} SCOP: a.25.1.1 Back     alignment and structure
>1krq_A Ferritin; H-chain like four-helix bundle, metal binding protein; 2.70A {Campylobacter jejuni} SCOP: a.25.1.1 Back     alignment and structure
>1s3q_A Ferritin; ferroxidase, four helix bundle, iron storage, metal binding protein; 2.10A {Archaeoglobus fulgidus} SCOP: a.25.1.1 PDB: 1sq3_A Back     alignment and structure
>1vlg_A Ferritin; TM1128, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 2.00A {Thermotoga maritima MSB8} SCOP: a.25.1.1 PDB: 1z4a_A* Back     alignment and structure
>3a68_A Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iron storage, CAGE-like protein, plant, iron, metal-binding, oxidoreductase, plastid; 1.80A {Glycine max} PDB: 3a9q_A Back     alignment and structure
>2cih_A Ferritin heavy chain; apoferritin, ferroxidase, DI-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation; 1.5A {Homo sapiens} PDB: 2chi_A 2cei_A 1fha_A 2fha_A 2cn7_A 2iu2_A 2clu_A 2cn6_A 3ajo_A 3ajq_A 3ajp_A 3erz_A 3es3_A 2z6m_A 1r03_A Back     alignment and structure
>3e6s_A Ferritin; iron storage, ferroxidase, oxidoreductase; 1.95A {Pseudo-nitzschia multiseries} PDB: 3e6r_A Back     alignment and structure
>3kxu_A Ferritin; iron storage protein, disorder, iron, metal binding protein; 1.85A {Homo sapiens} PDB: 3hx2_A 3hx5_A 3hx7_A Back     alignment and structure
>3ka8_A Ferritin, middle subunit; iron storage, DIIRON, iron, metal-binding, oxidoreductase; 1.35A {Rana catesbeiana} PDB: 3ka9_A 3ka3_A 1mfr_A 3ka4_A 3ka6_A 1bg7_A Back     alignment and structure
>2v2p_A Ferritin light chain; metal transport, iron, haemin, apoferritin, iron storage, metal-binding; 1.15A {Equus caballus} PDB: 2v2r_A 2v2m_A 2v2l_A 2v2s_A 2v2o_A 2v2n_A 2za6_A 2v2j_A 2v2i_A 2z5p_A 1dat_A 2g4h_A 1aew_A 3h7g_A 2zg9_X 2zg8_X 3fi6_A 2w0o_A 1hrs_A* 1ier_A ... Back     alignment and structure
>1rcd_A L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1rcg_A 1rci_A 1rcc_A 1rce_A Back     alignment and structure
>1z6o_A Ferritin light chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Back     alignment and structure
>1z6o_M Ferritin heavy chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Back     alignment and structure
>3fvb_A Bacterioferritin; niaid, ssgcid, decode, structural genomics, seattle structural genomics center for infectious disease; HET: HEM; 1.81A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1 Back     alignment and structure
>2fkz_A Bacterioferritin; ferroxidase, DIIRON site, iron transport, metal binding protein; HET: HEM; 2.00A {Azotobacter vinelandii} SCOP: a.25.1.1 PDB: 2fl0_A* 1sof_A* 3isf_A* 3is8_A* 3ise_A* 3is7_A* Back     alignment and structure
>2wtl_A Bacterioferritin, BFR; metal binding protein, bacterioferritin A, heme, iron, biliverdin, iron storage, metal-binding; HET: UNL; 2.59A {Mycobacterium tuberculosis} PDB: 3bkn_A* Back     alignment and structure
>3gvy_A Bacterioferritin; iron storage, DI-iron, ferroxida activity, heme, metal binding protein; HET: HEM; 2.80A {Rhodobacter sphaeroides} Back     alignment and structure
>3e2c_A Bacterioferritin; DIIRON site, iron storage, metal-binding, heme, iron, oxidoreductase; HET: HEM; 1.80A {Escherichia coli} PDB: 2vxi_A* 1bfr_A* 1bcf_A* 2htn_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* Back     alignment and structure
>1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON centre, HAEM Fe-coproporphyrin III cofactor; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* Back     alignment and structure
>2qqy_A Sigma B operon; dodecameric alpha-helical, ferritin fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Bacillus anthracis str} Back     alignment and structure
>1j30_A 144AA long hypothetical rubrerythrin; sulerythrin, sulfolobus tokodaii strain 7, four-helix bundle, domain swapping; 1.70A {Sulfolobus tokodaii str} SCOP: a.25.1.1 Back     alignment and structure
>2vzb_A Putative bacterioferritin-related protein; DPS, DPSL, iron, oxidative stress, metal transport; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2clb_A DPS-like protein; DI-iron carboxylate, hypothetical protein, bacterioferritin, hydrogen peroxide, metal binding protein, archaea; 2.4A {Sulfolobus solfataricus} Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubredoxin-like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIRON center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2oh3_A Rubrerythrin, COG1633: uncharacterized conserved protein; ZP_00055496.1, structural genomics; HET: MSE PGE; 2.00A {Magnetospirillum magnetotacticum ms-1} SCOP: a.25.1.8 Back     alignment and structure
>1nnq_A Rubrerythrin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.35A {Pyrococcus furiosus} SCOP: a.25.1.1 g.41.5.1 PDB: 2hr5_A Back     alignment and structure
>2fzf_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.70A {Pyrococcus furiosus} SCOP: a.25.1.1 Back     alignment and structure
>1vjx_A Putative ferritin-like DIIRON-carboxylate protein TM1526; structural genomics, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.25.1.1 Back     alignment and structure
>1o9i_A Pseudocatalase; oxidoreductase, hexamer, dimanganese catalase, metalloenzyme, preoxidase; HET: MES; 1.33A {Lactobacillus plantarum} SCOP: a.25.1.3 PDB: 1jkv_A 1jku_A Back     alignment and structure
>2v8t_A Manganese-containing pseudocatalase; manganese catalase, oxidoreductase; 0.98A {Thermus thermophilus} PDB: 2v8u_A 2cwl_A Back     alignment and structure
>2ib0_A Conserved hypothetical alanine rich protein; 4-helix bundle, structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: a.25.1.9 Back     alignment and structure
>3hiu_A Uncharacterized protein; APC40011, XCC3681, xanthomonas campestris PV. campestris STR. ATCC 33913, structural genomics, PSI-2; HET: MSE; 1.85A {Xanthomonas campestris PV} Back     alignment and structure
>3ogh_B Protein YCIE; iron-binding, MCSG, four-helix-bundle, structural genomics, protein structure initiative; HET: MSE; 1.65A {Escherichia coli O6} Back     alignment and structure
>2gs4_A Protein YCIF; stress proteins, rubrerythrin, metal binding protein; 2.00A {Escherichia coli} SCOP: a.25.1.4 Back     alignment and structure
>2itb_A TRNA-(MS(2)IO(6)A)-hydroxylase, putative; putative ATTH, structural genomics, joint center for structu genomics, JCSG; 2.05A {Pseudomonas putida KT2440} SCOP: a.25.1.7 Back     alignment and structure