254780732

254780732

hypothetical protein CLIBASIA_03095

GeneID in NCBI database:8209737Locus tag:CLIBASIA_03095
Protein GI in NCBI database:254780732Protein Accession:YP_003065145.1
Gene range:+(536329, 536505)Protein Length:58aa
Gene description:hypothetical protein
COG prediction:[U] Flp pilus assembly protein, pilin Flp
KEGG prediction:hypothetical protein; K02651 pilus assembly protein Flp/PilA
SEED prediction:Flp pilus assembly protein, pilin Flp
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------
MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS
cHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccc
MKMHIVKnflqdesgATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS
MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVfadissklnpks
MKMHIVKNFLQDESGATAIEYGllasliavaiiasvttlGGKLTAVFADISSKLNPKS
****I*KNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKL****
MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS
MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKL****
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS
MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS
MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target58 hypothetical protein CLIBASIA_03095 [Candidatus Liberib
25478073356 hypothetical protein CLIBASIA_03100 [Candidatus Li 3e-20
25478073462 Flp/Fap pilin component [Candidatus Liberibacter a 8e-19
254780730120 hypothetical protein CLIBASIA_03085 [Candidatus Li 5e-15
25478073660 hypothetical protein CLIBASIA_03115 [Candidatus Li 2e-05
>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Back     alignment
 Score = 87.8 bits (216), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADIS 51
          MKM+IVK+FL+DESGATAIEYGLLASLIAVAIIASVTTLGGKL+ VF DI 
Sbjct: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIE 51

>gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Back     alignment
 Score = 83.2 bits (204), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 42/50 (84%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADI 50
          MKMHIVKNFLQDESGATAIEYGLL SLIAV II SVTTLGGKL   F  I
Sbjct: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50

>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Back     alignment
 Score = 70.5 bits (171), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 47/55 (85%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLN 55
          MKM+I+K  L++ SGATAIEYGLLASL++VAII++V+TLG ++  V+  IS++L+
Sbjct: 1  MKMNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELD 55

>gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Back     alignment
 Score = 38.9 bits (89), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 42/57 (73%), Gaps = 1/57 (1%)

Query: 3  MHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKL-NPKS 58
          ++ +   L+DESGA AIEYG+L +LIAVAIIA+VT LGG L   F + ++++ N KS
Sbjct: 2  INCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISNVKS 58

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target58 hypothetical protein CLIBASIA_03095 [Candidatus Liberib
25478073356 hypothetical protein CLIBASIA_03100 [Candidatus Liberib 1 4e-16
25478073462 Flp/Fap pilin component [Candidatus Liberibacter asiati 1 1e-14
31512189764 hypothetical protein CKC_00735 [Candidatus Liberibacter 1 5e-13
254780730120 hypothetical protein CLIBASIA_03085 [Candidatus Liberib 1 7e-11
22208446560 component of type IV pilus [Agrobacterium radiobacter K 1 1e-09
22208446660 component of type IV pilus [Agrobacterium radiobacter K 1 3e-09
16152490969 Flp/Fap pilin component [Burkholderia multivorans ATCC 1 3e-09
8385935469 hypothetical protein OA2633_13155 [Oceanicaulis alexand 1 4e-09
25429321159 Flp/Fap pilin component [Hirschia baltica ATCC 49814] L 1 2e-08
8635586191 component of type IV pilus, pilin subunit protein [Rhiz 1 2e-08
>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Back     alignment and organism information
 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADIS 51
          MKM+IVK+FL+DESGATAIEYGLLASLIAVAIIASVTTLGGKL+ VF DI 
Sbjct: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIE 51


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Back     alignment and organism information
>gi|315121897|ref|YP_004062386.1| hypothetical protein CKC_00735 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64 Back     alignment and organism information
>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Back     alignment and organism information
>gi|222084465|ref|YP_002542994.1| component of type IV pilus [Agrobacterium radiobacter K84] Length = 60 Back     alignment and organism information
>gi|222084466|ref|YP_002542995.1| component of type IV pilus [Agrobacterium radiobacter K84] Length = 60 Back     alignment and organism information
>gi|161524909|ref|YP_001579921.1| Flp/Fap pilin component [Burkholderia multivorans ATCC 17616] Length = 69 Back     alignment and organism information
>gi|83859354|ref|ZP_00952875.1| hypothetical protein OA2633_13155 [Oceanicaulis alexandrii HTCC2633] Length = 69 Back     alignment and organism information
>gi|254293211|ref|YP_003059234.1| Flp/Fap pilin component [Hirschia baltica ATCC 49814] Length = 59 Back     alignment and organism information
>gi|86355861|ref|YP_467753.1| component of type IV pilus, pilin subunit protein [Rhizobium etli CFN 42] Length = 91 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target58 hypothetical protein CLIBASIA_03095 [Candidatus Liberib
COG384758 COG3847, Flp, Flp pilus assembly protein, pilin Flp [In 7e-09
pfam0496447 pfam04964, Flp_Fap, Flp/Fap pilin component 4e-09
>gnl|CDD|33638 COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|113726 pfam04964, Flp_Fap, Flp/Fap pilin component Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 58 hypothetical protein CLIBASIA_03095 [Candidatus Liberib
COG384758 Flp Flp pilus assembly protein, pilin Flp [Intracellula 99.8
pfam0496447 Flp_Fap Flp/Fap pilin component. 99.75
COG4961 185 TadG Flp pilus assembly protein TadG [Intracellular tra 97.28
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam04964 Flp_Fap Flp/Fap pilin component Back     alignment and domain information
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00