254780733

254780733

hypothetical protein CLIBASIA_03100

GeneID in NCBI database:8209738Locus tag:CLIBASIA_03100
Protein GI in NCBI database:254780733Protein Accession:YP_003065146.1
Gene range:+(536048, 536218)Protein Length:56aa
Gene description:hypothetical protein
COG prediction:[U] Flp pilus assembly protein, pilin Flp
KEGG prediction:hypothetical protein; K02651 pilus assembly protein Flp/PilA
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50------
MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGIKA
cHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccc
MKMNIVKDflkdesgaTAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGIKA
MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEdiekgika
MKMNIVKDFLKDESGATAIEYGllasliavaiiasvttlGGKLSKVFEDIEKGIKA
***NIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGI**
MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGIKA
*KMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGIK*
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGIKA
MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGIKA
MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGIKA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target56 hypothetical protein CLIBASIA_03100 [Candidatus Liberib
25478073258 hypothetical protein CLIBASIA_03095 [Candidatus Li 3e-20
25478073462 Flp/Fap pilin component [Candidatus Liberibacter a 2e-19
254780730120 hypothetical protein CLIBASIA_03085 [Candidatus Li 9e-15
25478073660 hypothetical protein CLIBASIA_03115 [Candidatus Li 4e-06
>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Back     alignment
 Score = 87.8 bits (216), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%)

Query: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIE 51
          MKM+IVK+FL+DESGATAIEYGLLASLIAVAIIASVTTLGGKL+ VF DI 
Sbjct: 1  MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADIS 51

>gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Back     alignment
 Score = 85.1 bits (209), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/54 (79%), Positives = 47/54 (87%)

Query: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGI 54
          MKM+IVK+FL+DESGATAIEYGLL SLIAV II SVTTLGGKL K FE I+K I
Sbjct: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54

>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Back     alignment
 Score = 69.7 bits (169), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 43/50 (86%)

Query: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDI 50
          MKMNI+K  LK+ SGATAIEYGLLASL++VAII++V+TLG ++  V++ I
Sbjct: 1  MKMNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTI 50

>gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Back     alignment
 Score = 41.2 bits (95), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%)

Query: 4  NIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFED 49
          N +   LKDESGA AIEYG+L +LIAVAIIA+VT LGG L   FE+
Sbjct: 3  NCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFEE 48

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target56 hypothetical protein CLIBASIA_03100 [Candidatus Liberib
25478073258 hypothetical protein CLIBASIA_03095 [Candidatus Liberib 1 4e-16
25478073462 Flp/Fap pilin component [Candidatus Liberibacter asiati 1 3e-15
31512189764 hypothetical protein CKC_00735 [Candidatus Liberibacter 1 3e-11
254780730120 hypothetical protein CLIBASIA_03085 [Candidatus Liberib 1 1e-10
8385935469 hypothetical protein OA2633_13155 [Oceanicaulis alexand 1 7e-10
16152490969 Flp/Fap pilin component [Burkholderia multivorans ATCC 1 2e-09
29615648662 Flp/Fap pilin component [Burkholderia sp. Ch1-1] Length 1 2e-08
22119777772 Flp/Fap pilin component [Burkholderia multivorans CGD2M 1 2e-08
9042386560 Flp/Fap pilin component [Rhodopseudomonas palustris Bis 1 2e-08
3993673754 Flp/Fap pilin protein [Rhodopseudomonas palustris CGA00 1 2e-08
>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Back     alignment and organism information
 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%)

Query: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIE 51
          MKM+IVK+FL+DESGATAIEYGLLASLIAVAIIASVTTLGGKL+ VF DI 
Sbjct: 1  MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADIS 51


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Back     alignment and organism information
>gi|315121897|ref|YP_004062386.1| hypothetical protein CKC_00735 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64 Back     alignment and organism information
>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Back     alignment and organism information
>gi|83859354|ref|ZP_00952875.1| hypothetical protein OA2633_13155 [Oceanicaulis alexandrii HTCC2633] Length = 69 Back     alignment and organism information
>gi|161524909|ref|YP_001579921.1| Flp/Fap pilin component [Burkholderia multivorans ATCC 17616] Length = 69 Back     alignment and organism information
>gi|296156486|ref|ZP_06839324.1| Flp/Fap pilin component [Burkholderia sp. Ch1-1] Length = 62 Back     alignment and organism information
>gi|221197777|ref|ZP_03570823.1| Flp/Fap pilin component [Burkholderia multivorans CGD2M] Length = 72 Back     alignment and organism information
>gi|90423865|ref|YP_532235.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18] Length = 60 Back     alignment and organism information
>gi|39936737|ref|NP_949013.1| Flp/Fap pilin protein [Rhodopseudomonas palustris CGA009] Length = 54 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target56 hypothetical protein CLIBASIA_03100 [Candidatus Liberib
COG384758 COG3847, Flp, Flp pilus assembly protein, pilin Flp [In 6e-08
pfam0496447 pfam04964, Flp_Fap, Flp/Fap pilin component 6e-09
>gnl|CDD|33638 COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|113726 pfam04964, Flp_Fap, Flp/Fap pilin component Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 56 hypothetical protein CLIBASIA_03100 [Candidatus Liberib
COG384758 Flp Flp pilus assembly protein, pilin Flp [Intracellula 99.75
pfam0496447 Flp_Fap Flp/Fap pilin component. 99.71
COG4961 185 TadG Flp pilus assembly protein TadG [Intracellular tra 97.16
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam04964 Flp_Fap Flp/Fap pilin component Back     alignment and domain information
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00