254780741

254780741

carboxynorspermidine decarboxylase

GeneID in NCBI database:8209746Locus tag:CLIBASIA_03140
Protein GI in NCBI database:254780741Protein Accession:YP_003065154.1
Gene range:-(529934, 531037)Protein Length:367aa
Gene description:carboxynorspermidine decarboxylase
COG prediction:[E] Diaminopimelate decarboxylase
KEGG prediction:nspC; carboxynorspermidine decarboxylase; K13747 carboxynorspermidine decarboxylase [EC:4.1.1.-]
SEED prediction:Carboxynorspermidine decarboxylase, putative (EC 4.1.1.-)
Pathway involved in KEGG:Arginine and proline metabolism [PATH:las00330]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------
MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYNDYYNNLS
cccccEEEEEHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHccEEEEccHHHHHHHHHHcccccEEEcccccHHHHHHHHHcccEEEEccHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccccccccccHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHHHHHHHHcccEEEEEcccHHHcccEEEEEEEEEEEccccEEEEEcccHHccccHHHHcccccccccccccEEEEEEccccccccEEEccccccccccccEEEEEccccHHHHHccccccccccEEEEEEcccEEEEEEcccHHHHHHHcc
cccccEEEEcHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccEEEEccHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHHHHHHcccEEEEcccHHHEEcccEEEEEEEEEHcccccEEEEEccHcccccHHHccccccccccccccEEEEEEcccccccccccccccccccccccEEEEEcccHHHEEEcccccccccccEEEEcccccEEEEEEccHHHHHHHcc
MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWgmfdtlnqymdgttsSSLYEVMLghekfggethaynvaykdceidavlsNCDTIIFNTVSQLNKFKDKAQKLHKKiglrinpsvsyskfiladpnrpfsrlgeKCKDKIESEIKNVnglmfhnncenksFLCFSAMLKNIEKEFGHFITQIEWislgggihftdkdypvkDFCQRLKEFSEKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLvivdssveahvpdyllyqesatiypntgpytamvcgrsclagdifgefhfekpvkigdrisfedvagyninrknwfnginmptiavkNVDGTIKAIREFSYndyynnls
MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLhkkiglrinpsvsyskfiladpnrpfsrlgEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRknwfnginmPTIAVKNVDGTIKAIRefsyndyynnls
MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIvtntttlnttvlDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYNDYYNNLS
MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYNDYYNNL*
MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYNDYYNNLS
*IKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYNDYYNNLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYNDYYNNLS
MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYNDYYNNLS
MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYNDYYNNLS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target367 carboxynorspermidine decarboxylase [Candidatus Liberiba
315121904367 carboxynorspermidine decarboxylase [Candidatus Liberiba 1 1e-173
148559900365 carboxynorspermidine decarboxylase [Brucella ovis ATCC 1 1e-136
256368792365 carboxynorspermidine decarboxylase [Brucella microti CC 1 1e-136
17987872365 carboxynorspermidine decarboxylase [Brucella melitensis 1 1e-135
62289327365 carboxynorspermidine decarboxylase [Brucella abortus bv 1 1e-135
256112854365 carboxynorspermidine decarboxylase [Brucella melitensis 1 1e-135
306842400365 carboxynorspermidine decarboxylase [Brucella sp. BO2] L 1 1e-135
153007782389 carboxynorspermidine decarboxylase [Ochrobactrum anthro 1 1e-135
239831198365 carboxynorspermidine decarboxylase [Ochrobactrum interm 1 1e-135
23501241365 carboxynorspermidine decarboxylase [Brucella suis 1330] 1 1e-135
>gi|315121904|ref|YP_004062393.1| carboxynorspermidine decarboxylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 367 Back     alignment and organism information
 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 299/367 (81%), Positives = 334/367 (91%)

Query: 1   MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSL 60
           MIKTPYYLIDKQK+LNNL+    I+KNAG+KLLLALKCF+AWG+FD L+QYMDGTTSSSL
Sbjct: 1   MIKTPYYLIDKQKILNNLEIVQRIQKNAGIKLLLALKCFSAWGVFDILSQYMDGTTSSSL 60

Query: 61  YEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGL 120
           YEVMLG +KFGGETHAYNVAYKDCEID VL++CDTIIFN +SQLNKFK+KAQK  K IGL
Sbjct: 61  YEVMLGRKKFGGETHAYNVAYKDCEIDVVLAHCDTIIFNNISQLNKFKEKAQKSKKNIGL 120

Query: 121 RINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLK 180
           RINPS+SYS FILADPNRPFSRLGEK K+KI  EIKN+NGLMFHNNCENKSF CF AML 
Sbjct: 121 RINPSISYSNFILADPNRPFSRLGEKDKNKIADEIKNINGLMFHNNCENKSFPCFDAMLN 180

Query: 181 NIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTN 240
           +IE+EFG+FI Q+EWISLGGGIHFTD  YP++DFC+RLKEFSEKYS+QIYLEPGEAIVTN
Sbjct: 181 HIEQEFGNFIFQVEWISLGGGIHFTDNTYPIEDFCRRLKEFSEKYSIQIYLEPGEAIVTN 240

Query: 241 TTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAG 300
           TTTL TTVLDI++NIKNLVIVDSSVEAH+PD LLY++SA I PN GPYTAMVCGRSCLAG
Sbjct: 241 TTTLETTVLDIAQNIKNLVIVDSSVEAHLPDCLLYKQSAIISPNKGPYTAMVCGRSCLAG 300

Query: 301 DIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYN 360
           DIFG+FHFE P +IGDRISFEDVAGYN+NRKNWFNGINMP I  K++DGT+K IREFSY+
Sbjct: 301 DIFGDFHFETPPQIGDRISFEDVAGYNLNRKNWFNGINMPMIVAKDLDGTLKIIREFSYD 360

Query: 361 DYYNNLS 367
           DYY NLS
Sbjct: 361 DYYKNLS 367


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|148559900|ref|YP_001258372.1| carboxynorspermidine decarboxylase [Brucella ovis ATCC 25840] Length = 365 Back     alignment and organism information
>gi|256368792|ref|YP_003106298.1| carboxynorspermidine decarboxylase [Brucella microti CCM 4915] Length = 365 Back     alignment and organism information
>gi|17987872|ref|NP_540506.1| carboxynorspermidine decarboxylase [Brucella melitensis bv. 1 str. 16M] Length = 365 Back     alignment and organism information
>gi|62289327|ref|YP_221120.1| carboxynorspermidine decarboxylase [Brucella abortus bv. 1 str. 9-941] Length = 365 Back     alignment and organism information
>gi|256112854|ref|ZP_05453775.1| carboxynorspermidine decarboxylase [Brucella melitensis bv. 3 str. Ether] Length = 365 Back     alignment and organism information
>gi|306842400|ref|ZP_07475054.1| carboxynorspermidine decarboxylase [Brucella sp. BO2] Length = 365 Back     alignment and organism information
>gi|153007782|ref|YP_001368997.1| carboxynorspermidine decarboxylase [Ochrobactrum anthropi ATCC 49188] Length = 389 Back     alignment and organism information
>gi|239831198|ref|ZP_04679527.1| carboxynorspermidine decarboxylase [Ochrobactrum intermedium LMG 3301] Length = 365 Back     alignment and organism information
>gi|23501241|ref|NP_697368.1| carboxynorspermidine decarboxylase [Brucella suis 1330] Length = 365 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target367 carboxynorspermidine decarboxylase [Candidatus Liberiba
TIGR01047380 TIGR01047, nspC, carboxynorspermidine decarboxylase 1e-108
COG0019394 COG0019, LysA, Diaminopimelate decarboxylase [Amino aci 8e-69
cd06810368 cd06810, PLPDE_III_ODC_DapDC_like, Type III Pyridoxal 5 5e-36
TIGR01048417 TIGR01048, lysA, diaminopimelate decarboxylase 3e-09
KOG0622448 KOG0622, KOG0622, KOG0622, Ornithine decarboxylase [Ami 7e-09
cd06829346 cd06829, PLPDE_III_CANSDC, Type III Pyridoxal 5-phospha 1e-136
cd06828373 cd06828, PLPDE_III_DapDC, Type III Pyridoxal 5-phosphat 2e-14
pfam00278110 pfam00278, Orn_DAP_Arg_deC, Pyridoxal-dependent decarbo 3e-13
cd06841379 cd06841, PLPDE_III_MccE_like, Type III Pyridoxal 5-phos 8e-08
PLN02537410 PLN02537, PLN02537, diaminopimelate decarboxylase 5e-04
cd00622362 cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate 0.001
cd06808211 cd06808, PLPDE_III, Type III Pyridoxal 5-phosphate (PLP 6e-04
>gnl|CDD|162173 TIGR01047, nspC, carboxynorspermidine decarboxylase Back     alignment and domain information
>gnl|CDD|30369 COG0019, LysA, Diaminopimelate decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143485 cd06810, PLPDE_III_ODC_DapDC_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Ornithine and Diaminopimelate Decarboxylases, and Related Enzymes Back     alignment and domain information
>gnl|CDD|162174 TIGR01048, lysA, diaminopimelate decarboxylase Back     alignment and domain information
>gnl|CDD|35841 KOG0622, KOG0622, KOG0622, Ornithine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143502 cd06829, PLPDE_III_CANSDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Carboxynorspermidine Decarboxylase Back     alignment and domain information
>gnl|CDD|143501 cd06828, PLPDE_III_DapDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase Back     alignment and domain information
>gnl|CDD|144023 pfam00278, Orn_DAP_Arg_deC, Pyridoxal-dependent decarboxylase, C-terminal sheet domain Back     alignment and domain information
>gnl|CDD|143508 cd06841, PLPDE_III_MccE_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE Back     alignment and domain information
>gnl|CDD|178152 PLN02537, PLN02537, diaminopimelate decarboxylase Back     alignment and domain information
>gnl|CDD|143482 cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase Back     alignment and domain information
>gnl|CDD|143484 cd06808, PLPDE_III, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 367 carboxynorspermidine decarboxylase [Candidatus Liberiba
TIGR01048431 lysA diaminopimelate decarboxylase; InterPro: IPR002986 100.0
cd06829346 PLPDE_III_CANSDC Type III Pyridoxal 5-phosphate (PLP)-D 100.0
PRK11165412 diaminopimelate decarboxylase; Provisional 100.0
COG0019394 LysA Diaminopimelate decarboxylase [Amino acid transpor 100.0
cd06828373 PLPDE_III_DapDC Type III Pyridoxal 5-phosphate (PLP)-De 100.0
PRK08961865 bifunctional aspartate kinase/diaminopimelate decarboxy 100.0
TIGR03099398 dCO2ase_PEP1 pyridoxal-dependent decarboxylase, exosort 100.0
cd06843377 PLPDE_III_PvsE_like Type III Pyridoxal 5-phosphate (PLP 100.0
cd06810368 PLPDE_III_ODC_DapDC_like Type III Pyridoxal 5-phosphate 100.0
cd06839382 PLPDE_III_Btrk_like Type III Pyridoxal 5-phosphate (PLP 100.0
cd06840368 PLPDE_III_Bif_AspK_DapDC Type III Pyridoxal 5-phosphate 100.0
cd06836379 PLPDE_III_ODC_DapDC_like_1 Type III Pyridoxal 5-phospha 100.0
cd06841379 PLPDE_III_MccE_like Type III Pyridoxal 5-phosphate (PLP 100.0
cd00622362 PLPDE_III_ODC Type III Pyridoxal 5-phosphate (PLP)-Depe 100.0
TIGR01047403 nspC carboxynorspermidine decarboxylase; InterPro: IPR0 100.0
cd06842423 PLPDE_III_Y4yA_like Type III Pyridoxal 5-phosphate (PLP 100.0
cd06830409 PLPDE_III_ADC Type III Pyridoxal 5-phosphate (PLP)-Depe 100.0
cd06831394 PLPDE_III_ODC_like_AZI Type III Pyridoxal 5-phosphate ( 100.0
KOG0622448 consensus 100.0
PRK05354634 arginine decarboxylase; Provisional 100.0
COG1166652 SpeA Arginine decarboxylase (spermidine biosynthesis) [ 100.0
cd06818382 PLPDE_III_cryptic_DSD Type III Pyridoxal 5-phosphate (P 99.74
cd06820353 PLPDE_III_LS_D-TA_like Type III Pyridoxal 5-phosphate ( 99.71
TIGR01273657 speA arginine decarboxylase; InterPro: IPR002985 Pyrido 99.67
cd06812374 PLPDE_III_DSD_D-TA_like_1 Type III Pyridoxal 5-phosphat 99.65
cd06819358 PLPDE_III_LS_D-TA Type III Pyridoxal 5-phosphate (PLP)- 99.65
cd06821361 PLPDE_III_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dep 99.59
cd06817389 PLPDE_III_DSD Type III Pyridoxal 5-phosphate (PLP)-Depe 99.5
cd06813388 PLPDE_III_DSD_D-TA_like_2 Type III Pyridoxal 5-phosphat 99.45
COG3616368 Predicted amino acid aldolase or racemase [Amino acid t 99.24
cd07376345 PLPDE_III_DSD_D-TA_like Type III Pyridoxal 5-phosphate 99.22
pfam02784245 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyrido 100.0
cd06808211 PLPDE_III Type III Pyridoxal 5-phosphate (PLP)-Dependen 100.0
pfam00278110 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-te 99.88
cd06815353 PLPDE_III_AR_like_1 Type III Pyridoxal 5-phosphate (PLP 99.54
PRK03646355 dadX alanine racemase; Reviewed 99.54
cd00430367 PLPDE_III_AR Type III Pyridoxal 5-phosphate (PLP)-Depen 99.5
cd06827354 PLPDE_III_AR_proteobact Type III Pyridoxal 5-phosphate 99.5
PRK00053360 alr alanine racemase; Reviewed 99.47
PRK13340404 alanine racemase; Reviewed 99.36
PRK11930824 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D 99.34
cd06826365 PLPDE_III_AR2 Type III Pyridoxal 5-phosphate (PLP)-Depe 99.34
cd06825368 PLPDE_III_VanT Type III Pyridoxal 5-phosphate (PLP)-Dep 99.23
COG0787360 Alr Alanine racemase [Cell envelope biogenesis, outer m 99.22
cd06811382 PLPDE_III_yhfX_like Type III Pyridoxal 5-phosphate (PLP 99.19
COG3457353 Predicted amino acid racemase [Amino acid transport and 99.03
TIGR00492383 alr alanine racemase; InterPro: IPR000821 Alanine racem 98.7
cd06814379 PLPDE_III_DSD_D-TA_like_3 Type III Pyridoxal 5-phosphat 99.14
pfam01168216 Ala_racemase_N Alanine racemase, N-terminal domain. 99.09
cd06824224 PLPDE_III_Yggs_like Pyridoxal 5-phosphate (PLP)-binding 96.21
cd00635222 PLPDE_III_YBL036c_like Type III Pyridoxal 5-phosphate ( 95.93
>TIGR01048 lysA diaminopimelate decarboxylase; InterPro: IPR002986 Pyridoxal-dependent decarboxylases that act on ornithine-, lysine-, arginine- and related substrates can be classified into different families on the basis of sequence similarity , Back     alignment and domain information
>cd06829 PLPDE_III_CANSDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Carboxynorspermidine Decarboxylase Back     alignment and domain information
>PRK11165 diaminopimelate decarboxylase; Provisional Back     alignment and domain information
>COG0019 LysA Diaminopimelate decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06828 PLPDE_III_DapDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>TIGR03099 dCO2ase_PEP1 pyridoxal-dependent decarboxylase, exosortase system type 1 associated Back     alignment and domain information
>cd06843 PLPDE_III_PvsE_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme PvsE Back     alignment and domain information
>cd06810 PLPDE_III_ODC_DapDC_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Ornithine and Diaminopimelate Decarboxylases, and Related Enzymes Back     alignment and domain information
>cd06839 PLPDE_III_Btrk_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Btrk Decarboxylase Back     alignment and domain information
>cd06840 PLPDE_III_Bif_AspK_DapDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bifunctional Aspartate Kinase/Diaminopimelate Decarboxylase Back     alignment and domain information
>cd06836 PLPDE_III_ODC_DapDC_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Uncharacterized Proteins with similarity to Ornithine and Diaminopimelate Decarboxylases Back     alignment and domain information
>cd06841 PLPDE_III_MccE_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE Back     alignment and domain information
>cd00622 PLPDE_III_ODC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase Back     alignment and domain information
>TIGR01047 nspC carboxynorspermidine decarboxylase; InterPro: IPR005730 Carboxynorspermidine synthase, mediates the nicotinamide-nucleotide-linked reduction of the Schiff base H2N(CH2)3N = CHCH2CH(NH2)COOH Back     alignment and domain information
>cd06842 PLPDE_III_Y4yA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Y4yA Back     alignment and domain information
>cd06830 PLPDE_III_ADC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Arginine Decarboxylase Back     alignment and domain information
>cd06831 PLPDE_III_ODC_like_AZI Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase-like Antizyme Inhibitor Back     alignment and domain information
>KOG0622 consensus Back     alignment and domain information
>PRK05354 arginine decarboxylase; Provisional Back     alignment and domain information
>COG1166 SpeA Arginine decarboxylase (spermidine biosynthesis) [Amino acid transport and metabolism] Back     alignment and domain information
>cd06818 PLPDE_III_cryptic_DSD Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bacterial Cryptic D-Serine Dehydratase Back     alignment and domain information
>cd06820 PLPDE_III_LS_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Low Specificity D-Threonine Aldolase-like Back     alignment and domain information
>TIGR01273 speA arginine decarboxylase; InterPro: IPR002985 Pyridoxal-dependent decarboxylases that act on ornithine-, lysine-, arginine- and related substrates can be classified into different families on the basis of sequence similarity , Back     alignment and domain information
>cd06812 PLPDE_III_DSD_D-TA_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 1 Back     alignment and domain information
>cd06819 PLPDE_III_LS_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Low Specificity D-Threonine Aldolase Back     alignment and domain information
>cd06821 PLPDE_III_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme D-Threonine Aldolase Back     alignment and domain information
>cd06817 PLPDE_III_DSD Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Eukaryotic D-Serine Dehydratase Back     alignment and domain information
>cd06813 PLPDE_III_DSD_D-TA_like_2 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 2 Back     alignment and domain information
>COG3616 Predicted amino acid aldolase or racemase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07376 PLPDE_III_DSD_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase Back     alignment and domain information
>pfam02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain Back     alignment and domain information
>cd06808 PLPDE_III Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Back     alignment and domain information
>pfam00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain Back     alignment and domain information
>cd06815 PLPDE_III_AR_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase-like 1 Back     alignment and domain information
>PRK03646 dadX alanine racemase; Reviewed Back     alignment and domain information
>cd00430 PLPDE_III_AR Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase Back     alignment and domain information
>cd06827 PLPDE_III_AR_proteobact Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Proteobacterial Alanine Racemases Back     alignment and domain information
>PRK00053 alr alanine racemase; Reviewed Back     alignment and domain information
>PRK13340 alanine racemase; Reviewed Back     alignment and domain information
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>cd06826 PLPDE_III_AR2 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme, Alanine Racemase 2 Back     alignment and domain information
>cd06825 PLPDE_III_VanT Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, VanT and similar proteins Back     alignment and domain information
>COG0787 Alr Alanine racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06811 PLPDE_III_yhfX_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme yhfX Back     alignment and domain information
>COG3457 Predicted amino acid racemase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00492 alr alanine racemase; InterPro: IPR000821 Alanine racemase catalyses the pyridoxal-dependent conversion of L-alanine into D-alanine, a key component of bacterial peptidoglycan Back     alignment and domain information
>cd06814 PLPDE_III_DSD_D-TA_like_3 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 3 Back     alignment and domain information
>pfam01168 Ala_racemase_N Alanine racemase, N-terminal domain Back     alignment and domain information
>cd06824 PLPDE_III_Yggs_like Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Yggs-like proteins Back     alignment and domain information
>cd00635 PLPDE_III_YBL036c_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, YBL036c-like proteins Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target367 carboxynorspermidine decarboxylase [Candidatus Liberiba
3mt1_A365 Crystal Structure Of Putative Carboxynorspermidine 1e-67
2p3e_A420 Crystal Structure Of Aq1208 From Aquifex Aeolicus L 5e-62
3n29_A418 Crystal Structure Of Carboxynorspermidine Decarboxy 7e-62
2yxx_A386 Crystal Structure Analysis Of Diaminopimelate Decar 1e-59
3n2b_A441 1.8 Angstrom Resolution Crystal Structure Of Diamin 1e-58
1twi_A434 Crystal Structure Of Diaminopimelate Decarboxylase 2e-57
1tuf_A434 Crystal Structure Of Diaminopimelate Decarboxylase 9e-56
2qgh_A396 Crystal Structure Of Diaminopimelate Decarboxylase 2e-55
3c5q_A425 Crystal Structure Of Diaminopimelate Decarboxylase 2e-55
1hkv_B447 Mycobacterium Diaminopimelate Dicarboxylase (Lysa) 3e-50
1hkw_A453 Mycobacterium Diaminopimelate Dicarboxylase (Lysa) 4e-49
1knw_A425 Crystal Structure Of Diaminopimelate Decarboxylase 1e-48
2o0t_A467 The Three Dimensional Structure Of Diaminopimelate 2e-48
2j66_A428 Structural Characterisation Of Btrk Decarboxylase F 3e-42
2oo0_A471 A Structural Insight Into The Inhibition Of Human A 2e-40
2on3_A461 A Structural Insight Into The Inhibition Of Human A 2e-40
1d7k_A421 Crystal Structure Of Human Ornithine Decarboxylase 2e-38
1njj_A425 Crystal Structure Determination Of T. Brucei Ornith 3e-38
1qu4_A425 Crystal Structure Of Trypanosoma Brucei Ornithine D 3e-38
1szr_C425 A Dimer Interface Mutant Of Ornithine Decarboxylase 4e-38
7odc_A424 Crystal Structure Ornithine Decarboxylase From Mous 2e-36
2tod_A425 Ornithine Decarboxylase From Trypanosoma Brucei K69 3e-36
2plj_A419 Crystal Structure Of LysineORNITHINE DECARBOXYLASE 8e-35
2nva_A372 The X-Ray Crystal Structure Of The Paramecium Bursa 2e-29
2nv9_A372 The X-Ray Crystal Structure Of The Paramecium Bursa 7e-29
3btn_A448 Crystal Structure Of Antizyme Inhibitor, An Ornithi 9e-29
3nzq_A 666 Crystal Structure Of Biosynthetic Arginine Decarbox 4e-08
3nzp_A 619 Crystal Structure Of The Biosynthetic Arginine Deca 1e-05
3n2o_A 648 X-Ray Crystal Structure Of Arginine Decarboxylase C 8e-04
>gi|299856844|pdb|3MT1|A Chain A, Crystal Structure Of Putative Carboxynorspermidine Decarboxylase Protein From Sinorhizobium Meliloti Length = 365 Back     alignment and structure
 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 209/366 (57%), Positives = 262/366 (71%), Gaps = 2/366 (0%)

Query: 2   IKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLY 61
           I+TPYYLIDK KL  N +   ++R+ +G K LLALKCFA W +FD    Y DGTTSSSL+
Sbjct: 2   IETPYYLIDKAKLTRNXERIAHVREKSGAKALLALKCFATWSVFDLXRDYXDGTTSSSLF 61

Query: 62  EVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLR 121
           EV LG E+FG ETHAY+VAY D EID V+S+ D IIFN++SQL +F DKA       GLR
Sbjct: 62  EVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFNSISQLERFADKA--AGIARGLR 119

Query: 122 INPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKN 181
           +NP VS S F LADP RPFSRLGE    K+E     +NG   HNNCENK F  F   L  
Sbjct: 120 LNPQVSSSSFDLADPARPFSRLGEWDVPKVERVXDRINGFXIHNNCENKDFGLFDRXLGE 179

Query: 182 IEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNT 241
           IE+ FG  I +++W+SLGGGIHFT  DYPV  F  RL+ FS++Y VQIYLEPGEA +T +
Sbjct: 180 IEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKS 239

Query: 242 TTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGD 301
           TTL  TVLD   N KNL IVDSS+EAH  D L+Y+E+A + PN G ++  +CG+SCLAGD
Sbjct: 240 TTLEVTVLDTLYNGKNLAIVDSSIEAHXLDLLIYRETAKVLPNEGSHSYXICGKSCLAGD 299

Query: 302 IFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYND 361
           +FGEF F + +K+GDRISF+D AGY   +KNWFNG+  P IA++ +DG+++ +REF+Y D
Sbjct: 300 VFGEFRFAEELKVGDRISFQDAAGYTXVKKNWFNGVKXPAIAIRELDGSVRTVREFTYAD 359

Query: 362 YYNNLS 367
           Y  +LS
Sbjct: 360 YEQSLS 365


gi|146386677|pdb|2P3E|A Chain A, Crystal Structure Of Aq1208 From Aquifex Aeolicus Length = 420 Back     alignment and structure
>gi|297787804|pdb|3N29|A Chain A, Crystal Structure Of Carboxynorspermidine Decarboxylase Comp Norspermidine From Campylobacter Jejuni Length = 418 Back     alignment and structure
>gi|159795662|pdb|2YXX|A Chain A, Crystal Structure Analysis Of Diaminopimelate Decarboxylate (Lysa) Length = 386 Back     alignment and structure
>gi|297787806|pdb|3N2B|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Diaminopimelate Decarboxylase (Lysa) From Vibrio Cholerae. Length = 441 Back     alignment and structure
>gi|51247766|pdb|1TWI|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase From M. Jannaschii In Co-Complex With L-Lysine Length = 434 Back     alignment and structure
>gi|51247744|pdb|1TUF|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase From M. Jannaschi Length = 434 Back     alignment and structure
>gi|313507304|pdb|3C5Q|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase (I148l Mutant) From Helicobacter Pylori Complexed With L-Lysine Length = 425 Back     alignment and structure
>gi|29726282|pdb|1HKW|A Chain A, Mycobacterium Diaminopimelate Dicarboxylase (Lysa) Length = 453 Back     alignment and structure
>gi|39654106|pdb|1KNW|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase Length = 425 Back     alignment and structure
>gi|134105016|pdb|2O0T|A Chain A, The Three Dimensional Structure Of Diaminopimelate Decarboxylase From Mycobacterium Tuberculosis Reveals A Tetrameric Enzyme Organisation Length = 467 Back     alignment and structure
>gi|116668430|pdb|2J66|A Chain A, Structural Characterisation Of Btrk Decarboxylase From Butirosin Biosynthesis Length = 428 Back     alignment and structure
>gi|152149219|pdb|2OO0|A Chain A, A Structural Insight Into The Inhibition Of Human And Leishmania Donovani Ornithine Decarboxylases By 3-Aminooxy- 1-Aminopropane Length = 471 Back     alignment and structure
gi|152149217|pdb|2ON3|A Chain A, A Structural Insight Into The Inhibition Of Human And Leishmania Donovani Ornithine Decarboxylases By 3-Aminooxy- 1-Aminopropane Length = 461 Back     alignment and structure
>gi|11514289|pdb|1D7K|A Chain A, Crystal Structure Of Human Ornithine Decarboxylase At 2.1 Angstroms Resolution Length = 421 Back     alignment and structure
>gi|34810213|pdb|1NJJ|A Chain A, Crystal Structure Determination Of T. Brucei Ornithine Decarboxylase Bound To D-Ornithine And To G418 Length = 425 Back     alignment and structure
>gi|6573538|pdb|1QU4|A Chain A, Crystal Structure Of Trypanosoma Brucei Ornithine Decarboxylase Length = 425 Back     alignment and structure
>gi|56553801|pdb|1SZR|C Chain C, A Dimer Interface Mutant Of Ornithine Decarboxylase Reveals Structure Of Gem Diamine Intermediate Length = 425 Back     alignment and structure
>gi|6435612|pdb|7ODC|A Chain A, Crystal Structure Ornithine Decarboxylase From Mouse, Truncated 37 Residues From The C-Terminus, To 1.6 Angstrom Resolution Length = 424 Back     alignment and structure
>gi|6573548|pdb|2TOD|A Chain A, Ornithine Decarboxylase From Trypanosoma Brucei K69a Mutant In Complex With Alpha-Difluoromethylornithine Length = 425 Back     alignment and structure
>gi|152149342|pdb|2PLJ|A Chain A, Crystal Structure Of LysineORNITHINE DECARBOXYLASE Complexed With Putrescine From Vibrio Vulnificus Length = 419 Back     alignment and structure
gi|145579908|pdb|2NVA|A Chain A, The X-Ray Crystal Structure Of The Paramecium Bursaria Chlorella Virus Arginine Decarboxylase Bound To Agmatine Length = 372 Back     alignment and structure
>gi|145579900|pdb|2NV9|A Chain A, The X-Ray Crystal Structure Of The Paramecium Bursaria Chlorella Virus Arginine Decarboxylase Length = 372 Back     alignment and structure
gi|183448303|pdb|3BTN|A Chain A, Crystal Structure Of Antizyme Inhibitor, An Ornithine Decarboxylase Homologous Protein Length = 448 Back     alignment and structure
>gi|305677838|pdb|3NZQ|A Chain A, Crystal Structure Of Biosynthetic Arginine Decarboxylase Adc (Spea) From Escherichia Coli, Northeast Structural Genomics Consortium Target Er600 Length = 666 Back     alignment and structure
>gi|305677836|pdb|3NZP|A Chain A, Crystal Structure Of The Biosynthetic Arginine Decarboxylase Spea From Campylobacter Jejuni, Northeast Structural Genomics Consortium Target Br53 Length = 619 Back     alignment and structure
>gi|297787810|pdb|3N2O|A Chain A, X-Ray Crystal Structure Of Arginine Decarboxylase Complexed Arginine From Vibrio Vulnificus Length = 648 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target367 carboxynorspermidine decarboxylase [Candidatus Liberiba
3n29_A418 Carboxynorspermidine decarboxylase; lyase; HET: PLP; 1. 8e-78
3mt1_A365 Putative carboxynorspermidine decarboxylase prote; PSI2 8e-74
3n2b_A441 Diaminopimelate decarboxylase; LYSA, lyase, structural 3e-37
2yxx_A386 Diaminopimelate decarboxylase; TM1517, TIM beta/alpha b 3e-33
1f3t_A425 ODC, ornithine decarboxylase; beta-alpha-barrel, modifi 1e-32
2qgh_A425 Diaminopimelate decarboxylase; lyase; HET: PLP LYS; 2.3 2e-27
2p3e_A420 Diaminopimelate decarboxylase; southeast collaboratory 8e-26
1knw_A425 Diaminopimelate decarboxylase; pyridoxal-phosphate, dec 5e-25
2o0t_A467 Diaminopimelate decarboxylase; PLP binding enzyme, lysi 2e-23
1twi_A434 Diaminopimelate decarboxylase; antibiotic resistance, l 9e-22
2oo0_A471 ODC, ornithine decarboxylase; beta-alpha barrel, sheet, 5e-20
3btn_A448 Antizyme inhibitor 1; TIM-like A/B barrel domain and A 3e-18
7odc_A424 Protein (ornithine decarboxylase); pyridoxal-5'-phospha 2e-17
2plj_A419 Lysine/ornithine decarboxylase; type IV decarboxylase, 1e-16
2j66_A428 BTRK, decarboxylase; butirosin, AHBA biosynthesis, lyas 3e-16
2nva_A372 Arginine decarboxylase, A207R protein; PLP, TIM barrel, 7e-13
3nzq_A 666 ADC, biosynthetic arginine decarboxylase; alpha-beta pr 1e-07
3nzp_A 619 Arginine decarboxylase; alpha-beta protein, structural 9e-06
3n2o_A 648 ADC, biosynthetic arginine decarboxylase; lyase; HET: P 1e-05
>3n29_A Carboxynorspermidine decarboxylase; lyase; HET: PLP; 1.90A {Campylobacter jejuni subsp} Length = 418 Back     alignment and structure
 Score =  285 bits (731), Expect = 8e-78
 Identities = 139/378 (36%), Positives = 211/378 (55%), Gaps = 18/378 (4%)

Query: 2   IKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLY 61
           I+TP Y++++ KL  N +    + + +G K+LLALK FA  G    + +Y+ G T S L+
Sbjct: 42  IQTPAYILEEDKLRKNCELLASVGEKSGAKVLLALKGFAFSGAMKIVGEYLKGCTCSGLW 101

Query: 62  EVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLR 121
           E     E    E H Y+ A+K+ EI  + S    I+FN+++Q +KF+ K QK    +GLR
Sbjct: 102 EAKFAKEYMDKEIHTYSPAFKEDEIGEIASLSHHIVFNSLAQFHKFQSKTQK--NSLGLR 159

Query: 122 INPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMFHNNCENKSFLCFSAMLKN 181
            N   S +   L +P   +SRLG + KD    ++  + GL FH  CE  +     A+LK 
Sbjct: 160 CNVEFSLAPKELYNPCGRYSRLGIRAKDFENVDLNAIEGLHFHALCEESAD-ALEAVLKV 218

Query: 182 IEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVTNT 241
            E++FG +I Q++W++ GGG H T K Y V+      K FS+KY VQ+YLEPGEA+   T
Sbjct: 219 FEEKFGKWIGQMKWVNFGGGHHITKKGYDVEKLIALCKNFSDKYGVQVYLEPGEAVGWQT 278

Query: 242 TTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIY---------------PNTG 286
             L  +V+DI EN K + I+D+S EAH+PD ++   ++ +                    
Sbjct: 279 GNLVASVVDIIENEKQIAILDTSSEAHMPDTIIMPYTSEVLNARILATRENEKISDLKEN 338

Query: 287 PYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMPTIAVKN 346
            +  ++ G +CLAGD+ GE+ F+K +KIGD+I F D   Y I +   FNGI +P + + +
Sbjct: 339 EFAYLLTGNTCLAGDVMGEYAFDKKLKIGDKIVFLDQIHYTIVKNTTFNGIRLPNLMLLD 398

Query: 347 VDGTIKAIREFSYNDYYN 364
               ++ IREFSY DY  
Sbjct: 399 HKNELQMIREFSYKDYSL 416


>3mt1_A Putative carboxynorspermidine decarboxylase prote; PSI2, MCSG, structural genomics; 2.50A {Sinorhizobium meliloti} Length = 365 Back     alignment and structure
>3n2b_A Diaminopimelate decarboxylase; LYSA, lyase, structural genom center for structural genomics of infectious diseases, CSGI; 1.80A {Vibrio cholerae} Length = 441 Back     alignment and structure
>2yxx_A Diaminopimelate decarboxylase; TM1517, TIM beta/alpha barrel fold, lyase, structural genomics, NPPSFA; HET: PLP; 1.70A {Thermotoga maritima MSB8} Length = 386 Back     alignment and structure
>1f3t_A ODC, ornithine decarboxylase; beta-alpha-barrel, modified greek KEY beta-sheet, lyase; HET: PLP; 2.00A {Trypanosoma brucei} SCOP: b.49.2.3 c.1.6.1 PDB: 1qu4_A* 1szr_C* 2tod_A* 1njj_A* Length = 425 Back     alignment and structure
>2qgh_A Diaminopimelate decarboxylase; lyase; HET: PLP LYS; 2.30A {Helicobacter pylori} PDB: 3c5q_A* Length = 425 Back     alignment and structure
>2p3e_A Diaminopimelate decarboxylase; southeast collaboratory for structural genomics, riken spring-8 center, riken genomic sciences center; 1.99A {Aquifex aeolicus VF5} Length = 420 Back     alignment and structure
>1knw_A Diaminopimelate decarboxylase; pyridoxal-phosphate, decarboxylation, lysine, TIM-barrel, lyase; HET: PLP MES; 2.10A {Escherichia coli} SCOP: b.49.2.3 c.1.6.1 PDB: 1ko0_A* Length = 425 Back     alignment and structure
>2o0t_A Diaminopimelate decarboxylase; PLP binding enzyme, lysine biosynthesis, structural genomics, TB structural genomics consortium; HET: LLP; 2.33A {Mycobacterium tuberculosis H37RV} PDB: 1hkv_A* 1hkw_A Length = 467 Back     alignment and structure
>1twi_A Diaminopimelate decarboxylase; antibiotic resistance, lysine biosynthesis, structural genomics, NYSGXRC, PSI; HET: LYS PLP; 2.00A {Methanocaldococcus jannaschii} SCOP: b.49.2.3 c.1.6.1 PDB: 1tuf_A* Length = 434 Back     alignment and structure
>2oo0_A ODC, ornithine decarboxylase; beta-alpha barrel, sheet, lyase; HET: PLP; 1.90A {Homo sapiens} Length = 471 Back     alignment and structure
>3btn_A Antizyme inhibitor 1; TIM-like A/B barrel domain and A sheet domain, structural genomics, israel structural proteomics center, ISPC; 2.05A {Mus musculus} Length = 448 Back     alignment and structure
>7odc_A Protein (ornithine decarboxylase); pyridoxal-5'-phosphate, PLP, group IV decarboxylase, polyamines, parasitical, chemotherapy target, putrescine; HET: PLP; 1.60A {Mus musculus} SCOP: b.49.2.3 c.1.6.1 PDB: 2on3_A 1d7k_A* Length = 424 Back     alignment and structure
>2plj_A Lysine/ornithine decarboxylase; type IV decarboxylase, beta/alpha barrel, beta barrel, lyase; HET: P3T; 1.70A {Vibrio vulnificus CMCP6} PDB: 2plk_A* Length = 419 Back     alignment and structure
>2j66_A BTRK, decarboxylase; butirosin, AHBA biosynthesis, lyase; HET: PLP; 1.65A {Bacillus circulans} Length = 428 Back     alignment and structure
>2nva_A Arginine decarboxylase, A207R protein; PLP, TIM barrel, eukaryotic ODC- like, lyase; HET: PL2; 1.80A {Paramecium bursaria chlorella virus 1} PDB: 2nv9_A* Length = 372 Back     alignment and structure
>3nzq_A ADC, biosynthetic arginine decarboxylase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.10A {Escherichia coli} Length = 666 Back     alignment and structure
>3nzp_A Arginine decarboxylase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: PLP; 3.00A {Campylobacter jejuni subsp} Length = 619 Back     alignment and structure
>3n2o_A ADC, biosynthetic arginine decarboxylase; lyase; HET: PLP; 2.30A {Vibrio vulnificus} Length = 648 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target367 carboxynorspermidine decarboxylase [Candidatus Liberiba
3mt1_A365 Putative carboxynorspermidine decarboxylase prote; PSI2 100.0
3n29_A418 Carboxynorspermidine decarboxylase; lyase; HET: PLP; 1. 100.0
3n2b_A441 Diaminopimelate decarboxylase; LYSA, lyase, structural 100.0
2p3e_A420 Diaminopimelate decarboxylase; southeast collaboratory 100.0
2qgh_A425 Diaminopimelate decarboxylase; lyase; HET: PLP LYS; 2.3 100.0
2yxx_A386 Diaminopimelate decarboxylase; TM1517, TIM beta/alpha b 100.0
1twi_A434 Diaminopimelate decarboxylase; antibiotic resistance, l 100.0
2j66_A428 BTRK, decarboxylase; butirosin, AHBA biosynthesis, lyas 100.0
2o0t_A467 Diaminopimelate decarboxylase; PLP binding enzyme, lysi 100.0
1knw_A425 Diaminopimelate decarboxylase; pyridoxal-phosphate, dec 100.0
2oo0_A471 ODC, ornithine decarboxylase; beta-alpha barrel, sheet, 100.0
7odc_A424 Protein (ornithine decarboxylase); pyridoxal-5'-phospha 100.0
1f3t_A425 ODC, ornithine decarboxylase; beta-alpha-barrel, modifi 100.0
3btn_A448 Antizyme inhibitor 1; TIM-like A/B barrel domain and A 100.0
2plj_A419 Lysine/ornithine decarboxylase; type IV decarboxylase, 100.0
2nva_A372 Arginine decarboxylase, A207R protein; PLP, TIM barrel, 100.0
3nzp_A619 Arginine decarboxylase; alpha-beta protein, structural 100.0
3nzq_A666 ADC, biosynthetic arginine decarboxylase; alpha-beta pr 100.0
3n2o_A648 ADC, biosynthetic arginine decarboxylase; lyase; HET: P 100.0
3gwq_A426 D-serine deaminase; YP_556991.1, structural genomics, j 99.85
3llx_A376 Predicted amino acid aldolase or racemase; structural g 99.74
1bd0_A388 Alanine racemase; isomerase, pyridoxal phosphate, alani 99.43
2vd8_A391 Alanine racemase; pyridoxal 5'-phosphate, peptidoglycan 99.37
1vfs_A386 Alanine racemase; TIM-barrel, greek-KEY motief, isomera 99.59
1rcq_A357 Catabolic alanine racemase DADX; alpha-beta barrel, bet 99.43
3e5p_A371 Alanine racemase; ALR, PLP, SCP, isomerase, pyridoxal p 99.42
3kw3_A376 Alanine racemase; niaid, ssgcid, seattle structural gen 99.41
3co8_A380 Alanine racemase; protein structure initiative II, PSI- 99.39
2rjg_A379 Alanine racemase; alpha/beta barrel, cell shape, cell W 99.38
3oo2_A385 Alanine racemase 1; infectious diseases, center for str 99.36
1xfc_A384 Alanine racemase; alpha-beta barrel, beta-structure for 99.32
3hur_A395 Alanine racemase; structural genomics, isomerase, pyrid 99.31
2dy3_A361 Alanine racemase; alpha/beta barrel, isomerase; HET: PL 99.06
1w8g_A234 YGGS, hypothetical UPF0001 protein YGGS; structural gen 95.32
3cpg_A282 Uncharacterized protein; unknown protein, TIM barrel, m 95.24
1vc3_B96 L-aspartate-alpha-decarboxylase heavy chain; tetramer, 90.35
>3mt1_A Putative carboxynorspermidine decarboxylase prote; PSI2, MCSG, structural genomics; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
Probab=100.00  E-value=0  Score=650.68  Aligned_cols=364  Identities=57%  Similarity=0.986  Sum_probs=338.8

Q ss_pred             CCCCCEEEEEHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHCCEEEEECHHHHHHHHC-CCCCCCEEECC
Q ss_conf             98885689779999999999999853369869995410599999999985187489807999989873-68801088537
Q gi|254780741|r    1 MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMFDTLNQYMDGTTSSSLYEVMLGHE-KFGGETHAYNV   79 (367)
Q Consensus         1 ~i~TP~yv~d~~~i~~n~~~~~~~~~~~~~~i~yA~KaN~~~~il~~l~~~g~g~dv~S~~E~~la~~-g~~~~~i~~~~   79 (367)
                      ||+|||||||++.|++|+++++.+++.++++++||+||||++.|++++++.|+|+||+|.+|+++|++ |+++.+|++ +
T Consensus         1 ~l~TP~yv~d~~~i~~~~~~~~~~~~~~~~~i~YAvKaN~~~~vl~~l~~~g~g~dvaS~~El~~a~~~g~~~~~i~~-~   79 (365)
T 3mt1_A            1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKETHAYS-V   79 (365)
T ss_dssp             -CCSSEEEEEHHHHHHHHHHHHHHHHHHCCEEEEETTTCCCGGGHHHHTTTSCEEEESSHHHHHHHHHHTCSEEEEEE-S
T ss_pred             CCCCCEEEEEHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHCCCEEEECCHHHHHHHHHHCCCCCCEEE-C
T ss_conf             999987997799999999999986512697899998316889999999980984996689999999965899661772-3


Q ss_pred             CCCHHHHHHHHCCCCEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCE
Q ss_conf             77803478861388689856720599999986123456148996357744310124557864357427888874314960
Q gi|254780741|r   80 AYKDCEIDAVLSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVN  159 (367)
Q Consensus        80 ~~~~~el~~a~~~~~~i~iDs~~El~~i~~~a~~~~~~I~lRinP~~~~~~~~~~~~~~~~skfG~~~~~~~~~~~~~i~  159 (367)
                      ++++++++.+++.+..|++||++||+++.+.++  +.+|+|||||+++..+++.++++.+.||||+...+..+....++.
T Consensus        80 ~~~~~~~~~~~~~g~~i~vDs~~El~~i~~~~~--~~~v~lRinp~~~~~~~~~~~~~~~~s~~g~~~~~~~~~~~~~l~  157 (365)
T 3mt1_A           80 AYGDNEIDEVVSHADKIIFNSISQLERFADKAA--GIARGLRLNPQVSSSSFDLADPARPFSRLGEWDVPKVERVMDRIN  157 (365)
T ss_dssp             CCCTTTHHHHHHHCSEEEESSHHHHHHHGGGGT--TSEEEEEECCC----------------CCSBCCHHHHHTTGGGCS
T ss_pred             CCCCCHHHHHHHCCCEEEEECHHHHHHHHHHHC--CCCEEEEECCCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             567409999997399899938889999998720--665689972466754423421678755431769999999873176


Q ss_pred             EEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEHHHHCCC
Q ss_conf             66530565666147899999999989865088750875337766644556807899999987542165045300220145
Q gi|254780741|r  160 GLMFHNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFSEKYSVQIYLEPGEAIVT  239 (367)
Q Consensus       160 Gih~H~gs~~~~~~~~~~~l~~~~~~~~~~~~~l~~idiGGG~~~~~~~~~~~~~~~~i~~~~~~~~~~l~iEPGR~lv~  239 (367)
                      |+|||+|||+.+.+.|.+++..+.+.+.+++.++++|||||||++++++.+++.+++.+++..+++++++++|||||||+
T Consensus       158 g~h~H~gs~~~~~~~~~~~i~~~~~~~~~~~~~~~~idiGGGf~~~~~~~~~~~~~~~i~~~~~~~~~~l~~EPGR~lva  237 (365)
T 3mt1_A          158 GFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASIT  237 (365)
T ss_dssp             EEEECCC--CCSHHHHHHHHHHHHHHHHHHHTTSSEEECCSCCCTTSTTCCHHHHHHHHHHHHHHHTCEEEECCSHHHHT
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEECCCCCEEHH
T ss_conf             47987587887578999999999999898689847898078767765102358999999999743145311477523400


Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCEEEECCCCCCCCCCCEEE
Q ss_conf             74188878878630443334333356565664001345530002478645998623336664552135667788798999
Q gi|254780741|r  240 NTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATIYPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRIS  319 (367)
Q Consensus       240 ~ag~lv~~V~~~K~~~~~~v~vd~g~~~~~~~~~~~~~~~~~~~~~~~~~~~v~G~~C~~~D~l~~~~~~~~l~~GD~l~  319 (367)
                      +||+++++|+++|+++++|+++|+|+++++++.+.+...+.+.++++.++|.|+||||+++|+|+++..+|++++||+|+
T Consensus       238 ~ag~lv~~V~~~k~~~~~~~~vd~g~~~~~~~~~~~~~~~~~~~~~~~~~~~v~G~~C~~~D~l~~~~~lp~l~~GD~l~  317 (365)
T 3mt1_A          238 KSTTLEVTVLDTLYNGKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRIS  317 (365)
T ss_dssp             TSEEEEEEEEEEEESSSEEEEESCCHHHHCHHHHHTTCCCCCSSCCSSEEEEEECSSCCSSCEEEEEEESSCCCTTCEEE
T ss_pred             CCEEEEEEEEEEEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEECCCCCCCCCCCCCEEE
T ss_conf             65699999999998985799825754456654334455212357777415633379888776881246578999999999


Q ss_pred             EECCCCHHHHHCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHCC
Q ss_conf             968870223243476899887799996799099997389899987429
Q gi|254780741|r  320 FEDVAGYNINRKNWFNGINMPTIAVKNVDGTIKAIREFSYNDYYNNLS  367 (367)
Q Consensus       320 i~~~GAY~~~~~~~Fn~~~~P~~v~~~~~g~~~~~r~e~~~d~~~~~~  367 (367)
                      |.|+|||+++|+++||++|+|++|++++||+++++||||||||++|||
T Consensus       318 ~~~~GAY~~~~~s~Fn~~~~P~~v~~~~dg~~~~irr~~~~d~~~~~~  365 (365)
T 3mt1_A          318 FQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS  365 (365)
T ss_dssp             ESSCCTTSTTSCCCGGGCCCCEEEEECTTSCEEEEECCCHHHHHHHHC
T ss_pred             EECCCHHHHHHHCCCCCCCCCCEEEEECCCCEEEEECCCHHHHHHHCC
T ss_conf             918844446661557899998799996799299995397899886557



>3n29_A Carboxynorspermidine decarboxylase; lyase; HET: PLP; 1.90A {Campylobacter jejuni subsp} Back     alignment and structure
>3n2b_A Diaminopimelate decarboxylase; LYSA, lyase, structural genom center for structural genomics of infectious diseases, CSGI; 1.80A {Vibrio cholerae} Back     alignment and structure
>2p3e_A Diaminopimelate decarboxylase; southeast collaboratory for structural genomics, riken spring-8 center, riken genomic sciences center; 1.99A {Aquifex aeolicus VF5} Back     alignment and structure
>2qgh_A Diaminopimelate decarboxylase; lyase; HET: PLP LYS; 2.30A {Helicobacter pylori} PDB: 3c5q_A* Back     alignment and structure
>2yxx_A Diaminopimelate decarboxylase; TM1517, TIM beta/alpha barrel fold, lyase, structural genomics, NPPSFA; HET: PLP; 1.70A {Thermotoga maritima MSB8} Back     alignment and structure
>1twi_A Diaminopimelate decarboxylase; antibiotic resistance, lysine biosynthesis, structural genomics, NYSGXRC, PSI; HET: LYS PLP; 2.00A {Methanocaldococcus jannaschii} SCOP: b.49.2.3 c.1.6.1 PDB: 1tuf_A* Back     alignment and structure
>2j66_A BTRK, decarboxylase; butirosin, AHBA biosynthesis, lyase; HET: PLP; 1.65A {Bacillus circulans} Back     alignment and structure
>2o0t_A Diaminopimelate decarboxylase; PLP binding enzyme, lysine biosynthesis, structural genomics, TB structural genomics consortium; HET: LLP; 2.33A {Mycobacterium tuberculosis H37RV} PDB: 1hkv_A* 1hkw_A Back     alignment and structure
>1knw_A Diaminopimelate decarboxylase; pyridoxal-phosphate, decarboxylation, lysine, TIM-barrel, lyase; HET: PLP MES; 2.10A {Escherichia coli} SCOP: b.49.2.3 c.1.6.1 PDB: 1ko0_A* Back     alignment and structure