254780740

254780740

peptidase S16 lon domain protein

GeneID in NCBI database:8209745Locus tag:CLIBASIA_03135
Protein GI in NCBI database:254780740Protein Accession:YP_003065153.1
Gene range:+(531385, 532050)Protein Length:221aa
Gene description:peptidase S16 lon domain protein
COG prediction:[R] Uncharacterized protein, similar to the N-terminal domain of Lon protease
KEGG prediction:peptidase S16 lon domain protein; K07157
SEED prediction:Uncharacterized protein, similar to the N-terminal domain of Lon protease
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Proteasome bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ
ccccHHHHccccccccEEEEEEccccEEccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEccccccccccccEEcccEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccc
cccccccccccccccccccccccccEEEccccEEccccccHHHHHHHHHHHccccEEEEEEcccccccccccccHccccHHHHHHHHHccccccEEEEEEEcEEEEEEEEEcccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccc
mkigntiyknredlpcllpifpllgmlllpgsrfsfsVFERRYIAMFDSVLAGDRLiglvqpaisgflansdnglsqigcigritsfvetddghyIMTVIGVCRFRLLEEAYQLnswrcfyiapfisdlagndndgvDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSlamlspfsEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ
mkigntiyknredlpCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ
MKIGNTIYKNREDLPCllpifpllgmlllpGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ
**************PCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAI******S**GLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFI**********VDRVALLEVFRNYLTVN***********ASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIV*************
MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ
*****TIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLARA*********
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ
MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ
MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target221 peptidase S16 lon domain protein [Candidatus Liberibact
315121903221 peptidase S16 lon domain protein [Candidatus Liberibact 1 1e-103
227823705226 ATP-dependent protease La (LON) domain protein [Sinorhi 1 2e-65
209551345223 peptidase S16 [Rhizobium leguminosarum bv. trifolii WSM 1 2e-64
241206782223 peptidase S16 lon domain protein [Rhizobium leguminosar 1 4e-64
190893826228 ATP-dependent protease La protein [Rhizobium etli CIAT 1 4e-64
218461968228 ATP-dependent protease La protein [Rhizobium etli Kim 5 1 5e-64
86359558228 ATP-dependent protease LA 2 protein [Rhizobium etli CFN 1 6e-64
327190159289 thioredoxin protein [Rhizobium etli CNPAF512] Length = 1 6e-64
15966938226 hypothetical protein SMc03802 [Sinorhizobium meliloti 1 1 8e-64
116254296228 ATP-dependent protease [Rhizobium leguminosarum bv. vic 1 1e-63
>gi|315121903|ref|YP_004062392.1| peptidase S16 lon domain protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 221 Back     alignment and organism information
 Score =  377 bits (967), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/221 (85%), Positives = 204/221 (92%)

Query: 1   MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLV 60
           MKIGN IYKN EDLPCL+PIFPLLGMLLLPGSRFSFSVFERRY+AMFDSVLA DRLIGLV
Sbjct: 1   MKIGNAIYKNNEDLPCLMPIFPLLGMLLLPGSRFSFSVFERRYVAMFDSVLASDRLIGLV 60

Query: 61  QPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCF 120
           QPA+SGF  NSD  LSQIGCIGRITSFVETDDGHYI+TV GVCRFRLLEE+YQLNSWRCF
Sbjct: 61  QPALSGFSTNSDKCLSQIGCIGRITSFVETDDGHYIITVTGVCRFRLLEESYQLNSWRCF 120

Query: 121 YIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPF 180
           YIAPF+SDL  NDNDG+DR+ALLEVFRNYL  NNLDADWE+IE ASNE+LVNSLA+LSPF
Sbjct: 121 YIAPFVSDLVSNDNDGIDRIALLEVFRNYLRANNLDADWENIEGASNEVLVNSLALLSPF 180

Query: 181 SEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ 221
           SEEEKQALLEAPDF+AR QTLIAIMKIVLA  Y+H +NRLQ
Sbjct: 181 SEEEKQALLEAPDFKARTQTLIAIMKIVLAADYSHYKNRLQ 221


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823705|ref|YP_002827678.1| ATP-dependent protease La (LON) domain protein [Sinorhizobium fredii NGR234] Length = 226 Back     alignment and organism information
>gi|209551345|ref|YP_002283262.1| peptidase S16 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 223 Back     alignment and organism information
>gi|241206782|ref|YP_002977878.1| peptidase S16 lon domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 223 Back     alignment and organism information
>gi|190893826|ref|YP_001980368.1| ATP-dependent protease La protein [Rhizobium etli CIAT 652] Length = 228 Back     alignment and organism information
>gi|218461968|ref|ZP_03502059.1| ATP-dependent protease La protein [Rhizobium etli Kim 5] Length = 228 Back     alignment and organism information
>gi|86359558|ref|YP_471450.1| ATP-dependent protease LA 2 protein [Rhizobium etli CFN 42] Length = 228 Back     alignment and organism information
>gi|327190159|gb|EGE57264.1| thioredoxin protein [Rhizobium etli CNPAF512] Length = 289 Back     alignment and organism information
>gi|15966938|ref|NP_387291.1| hypothetical protein SMc03802 [Sinorhizobium meliloti 1021] Length = 226 Back     alignment and organism information
>gi|116254296|ref|YP_770134.1| ATP-dependent protease [Rhizobium leguminosarum bv. viciae 3841] Length = 228 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target221 peptidase S16 lon domain protein [Candidatus Liberibact
pfam02190193 pfam02190, LON, ATP-dependent protease La (LON) domain 2e-25
COG0466 782 COG0466, Lon, ATP-dependent Lon protease, bacterial typ 1e-10
KOG4159398 KOG4159, KOG4159, KOG4159, Predicted E3 ubiquitin ligas 3e-04
COG2802221 COG2802, COG2802, Uncharacterized protein, similar to t 9e-42
>gnl|CDD|145377 pfam02190, LON, ATP-dependent protease La (LON) domain Back     alignment and domain information
>gnl|CDD|30814 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|39361 KOG4159, KOG4159, KOG4159, Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32634 COG2802, COG2802, Uncharacterized protein, similar to the N-terminal domain of Lon protease [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 221 peptidase S16 lon domain protein [Candidatus Liberibact
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 100.0
COG2802221 Uncharacterized protein, similar to the N-terminal doma 100.0
pfam02190193 LON ATP-dependent protease La (LON) domain. 100.0
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 100.0
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 99.96
KOG2004 906 consensus 99.58
smart0046492 LON Found in ATP-dependent protease La (LON). N-termina 98.74
KOG1400371 consensus 96.67
KOG4159398 consensus 99.49
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG2802 Uncharacterized protein, similar to the N-terminal domain of Lon protease [General function prediction only] Back     alignment and domain information
>pfam02190 LON ATP-dependent protease La (LON) domain Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>KOG2004 consensus Back     alignment and domain information
>smart00464 LON Found in ATP-dependent protease La (LON) Back     alignment and domain information
>KOG1400 consensus Back     alignment and domain information
>KOG4159 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target221 peptidase S16 lon domain protein [Candidatus Liberibact
3ljc_A252 Crystal Structure Of Lon N-Terminal Domain Length = 2e-26
3m65_A209 Crystal Structure Of Bacillus Subtilis Lon N-Termin 3e-23
2ane_A125 Crystal Structure Of N-Terminal Domain Of E.Coli Lo 9e-11
1zbo_A210 X-Ray Crystal Structure Of Protein Bpp1347 From Bor 9e-07
>gi|301015836|pdb|3LJC|A Chain A, Crystal Structure Of Lon N-Terminal Domain Length = 252 Back     alignment and structure
 Score =  123 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/210 (18%), Positives = 72/210 (34%), Gaps = 6/210 (2%)

Query: 17  LLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLS 76
            +P+ PL  +++ P       V   + I   ++    D+ I LV    +       N L 
Sbjct: 17  EIPVLPLRDVVVYPHXVIPLFVGREKSIRCLEAAXDHDKKIXLVAQKEASTDEPGVNDLF 76

Query: 77  QIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDG 136
            +G +  I   ++  DG   + V G+ R R+   +     +         S         
Sbjct: 77  TVGTVASILQXLKLPDGTVKVLVEGLQRARISALSDNGEHF-SAKAEYLESPTIDEREQE 135

Query: 137 VDRVALLEVFRNYLTVNNLDADW---ESIEEASNEILVNSLAMLSPFSEEEKQALLEAPD 193
           V     +  F  Y+ +N                   L +++A   P    +KQ++LE  D
Sbjct: 136 VLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPARLADTIAAHXPLKLADKQSVLEXSD 195

Query: 194 FRARAQTLIAIMKIV--LARAYTHCENRLQ 221
              R + L A  +    L +      NR++
Sbjct: 196 VNERLEYLXAXXESEIDLLQVEKRIRNRVK 225


>gi|299856775|pdb|3M65|A Chain A, Crystal Structure Of Bacillus Subtilis Lon N-Terminal Domain Length = 209 Back     alignment and structure
>gi|82407830|pdb|2ANE|A Chain A, Crystal Structure Of N-Terminal Domain Of E.Coli Lon Protease Length = 125 Back     alignment and structure
>gi|66361415|pdb|1ZBO|A Chain A, X-Ray Crystal Structure Of Protein Bpp1347 From Bordetella Parapertussis. Northeast Structural Genomics Consortium Target Bor27. Length = 210 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target221 peptidase S16 lon domain protein [Candidatus Liberibact
3m65_A209 ATP-dependent protease LA 1; coiled-coil, ATP-binding, 6e-29
3ljc_A252 ATP-dependent protease LA; LON N-domain, allosteric enz 1e-23
1zbo_A210 Hypothetical protein BPP1347; alpha-beta protein, struc 2e-18
2ane_A125 ATP-dependent protease LA; LONN119, LON protease, hydro 8e-12
>3m65_A ATP-dependent protease LA 1; coiled-coil, ATP-binding, cytoplasm, hydrolase, nucleotide-B protease, serine protease, stress response; 2.60A {Bacillus subtilis} Length = 209 Back     alignment and structure
 Score =  122 bits (307), Expect = 6e-29
 Identities = 33/198 (16%), Positives = 76/198 (38%), Gaps = 4/198 (2%)

Query: 12  EDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANS 71
           E+L   +P+ PL G+L+ P       V   + +   +  +  D +I L            
Sbjct: 3   EELKRSIPLLPLRGLLVYPTMVLHLDVGRDKSVQALEQAMMHDHMIFLATQQDISIDEPG 62

Query: 72  DNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAG 131
           ++ +  +G   +I   ++  +G   + V G+ R  +++     +            D   
Sbjct: 63  EDEIFTVGTYTKIKQMLKLPNGTIRVLVEGLKRAHIVKYNEHEDYTSVDIQLIHEDDSKD 122

Query: 132 NDNDGVDRVALLEVFRNYLTVNN---LDADWESIEEASNEILVNSLAMLSPFSEEEKQAL 188
            +++ + R  LL+ F  Y+ ++     +      +      + + +A   P   ++KQ +
Sbjct: 123 TEDEALMR-TLLDHFDQYIKISKKISAETYAAVTDIEEPGRMADIVASHLPLKLKDKQDI 181

Query: 189 LEAPDFRARAQTLIAIMK 206
           LE  D + R   +I  + 
Sbjct: 182 LETADVKDRLNKVIDFIN 199


>3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} Length = 252 Back     alignment and structure
>1zbo_A Hypothetical protein BPP1347; alpha-beta protein, structural genomics, PSI, protein structure initiative; 2.60A {Bordetella parapertussis 12822} SCOP: b.122.1.10 Length = 210 Back     alignment and structure
>2ane_A ATP-dependent protease LA; LONN119, LON protease, hydrolase; 2.03A {Escherichia coli} SCOP: b.122.1.10 Length = 125 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target221 peptidase S16 lon domain protein [Candidatus Liberibact
3m65_A209 ATP-dependent protease LA 1; coiled-coil, ATP-binding, 100.0
3ljc_A252 ATP-dependent protease LA; LON N-domain, allosteric enz 100.0
1zbo_A210 Hypothetical protein BPP1347; alpha-beta protein, struc 100.0
2ane_A125 ATP-dependent protease LA; LONN119, LON protease, hydro 99.94
>3m65_A ATP-dependent protease LA 1; coiled-coil, ATP-binding, cytoplasm, hydrolase, nucleotide-B protease, serine protease, stress response; 2.60A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=5.4e-41  Score=275.81  Aligned_cols=199  Identities=17%  Similarity=0.303  Sum_probs=170.8

Q ss_pred             HHCCCCCCEEECCCCEECCCCCCCEEECCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHEEEEEEEECCCCCC
Q ss_conf             67843155333087357888512343183899999999997099326620123433446643521100132421013466
Q gi|254780740|r   12 EDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETD   91 (221)
Q Consensus        12 ~~lp~~lPi~PL~~~VlFP~~~~pL~Ife~ry~~~i~~~l~~~~~igiv~~~~~~~~~~~~~~l~~vGt~a~I~~~~~~~   91 (221)
                      +++|++||+|||+|+|+|||+.+|||||||||++|+++|+++++.||++++++...+.+..+++|+|||+|+|+++.++|
T Consensus         3 ~~~p~~lPv~pL~~~VlfPg~~~pL~I~e~r~~~~i~~a~~~~~~i~~~~~~~~~~~~~~~~~~~~vG~l~~I~~~~~~~   82 (209)
T 3m65_A            3 EELKRSIPLLPLRGLLVYPTMVLHLDVGRDKSVQALEQAMMHDHMIFLATQQDISIDEPGEDEIFTVGTYTKIKQMLKLP   82 (209)
T ss_dssp             -CEEEEEEEEEESSCCCCTTCEEEEEECSHHHHHHHHHHTTTTSEEEEEEBSSTTCSSCCGGGBCSEEEEEEEEEEEECT
T ss_pred             CCCCCCEEEEECCCCCCCCCCCEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCHHEEEEEEEEEEEEECC
T ss_conf             65777667998689312899656578488899999999984099524552022235688632012144278887887449


Q ss_pred             CCCEEEEEEEEEEEEECCCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCH-H-HHHH-HHCCHH
Q ss_conf             662489875421111010002454068999952222254102456788865788998865103201-3-5777-630535
Q gi|254780740|r   92 DGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDA-D-WESI-EEASNE  168 (221)
Q Consensus        92 dG~~~i~v~G~~R~kI~~~~~~~~py~~a~v~~~~~d~~~~~~~~~~~~~l~~~~~~~~~~~~~~~-~-~~~i-~~~~~~  168 (221)
                      ||++.|+++|.+||++.+ ....+||..|.++...++....++..+....+.+.++++........ + ...+ +..+++
T Consensus        83 dg~~~i~~~G~~R~~i~~-~~~~~~~~~a~v~~~~~~~~~~~~~~al~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (209)
T 3m65_A           83 NGTIRVLVEGLKRAHIVK-YNEHEDYTSVDIQLIHEDDSKDTEDEALMRTLLDHFDQYIKISKKISAETYAAVTDIEEPG  161 (209)
T ss_dssp             TSCEEEEEEEEEEEEEEE-EEECSSSEEEEEEECCCC--CCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCHH
T ss_pred             CCCEEEEEEEEEEEEECC-CCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCHH
T ss_conf             995899999997565203-3444445414798722556674777889999999999999863110177787777417889


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             7999999867999899999853689899999999999999999
Q gi|254780740|r  169 ILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLAR  211 (221)
Q Consensus       169 ~l~d~iA~~l~~~~~eKQ~lLE~~~~~~Rl~~l~~~Le~el~~  211 (221)
                      .++|++|++++++.++||+|||+.|+.+|+++++++|+.|+.-
T Consensus       162 ~lad~~a~~l~~~~~ekQ~lLe~~d~~~Rl~~~l~~L~~e~~~  204 (209)
T 3m65_A          162 RMADIVASHLPLKLKDKQDILETADVKDRLNKVIDFINNEKEV  204 (209)
T ss_dssp             HHHHHHHHHSCCCHHHHHHHHTCCSHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999808999999999984899999999999999999999



>3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} Back     alignment and structure
>1zbo_A Hypothetical protein BPP1347; alpha-beta protein, structural genomics, PSI, protein structure initiative; 2.60A {Bordetella parapertussis 12822} SCOP: b.122.1.10 Back     alignment and structure
>2ane_A ATP-dependent protease LA; LONN119, LON protease, hydrolase; 2.03A {Escherichia coli} SCOP: b.122.1.10 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 221 peptidase S16 lon domain protein [Candidatus Liberibact
d1zboa1197 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bord 3e-19
d2anea1110 b.122.1.10 (A:8-117) ATP-dependent protease La (Lon), N 2e-12
>d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]} Length = 197 Back     information, alignment and structure

class: All beta proteins
fold: PUA domain-like
superfamily: PUA domain-like
family: LON domain-like
domain: Hypothetical protein BPP1347
species: Bordetella parapertussis [TaxId: 519]
 Score = 88.8 bits (219), Expect = 3e-19
 Identities = 36/195 (18%), Positives = 61/195 (31%), Gaps = 9/195 (4%)

Query: 18  LPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLA--NSDNGL 75
           +P+FPL    L P       VFE RY+ M    +A     G+V       +   +    L
Sbjct: 3   IPLFPL-SNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVVVLEQGTEVRRPDGREVL 61

Query: 76  SQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDND 135
           ++ G + RI  +         +   G  RFRL                P   D       
Sbjct: 62  ARAGTMARIDHWEAPMPALLELACTGTGRFRLHACTQGKYGLWTGQAEPVPDDAPLEVPP 121

Query: 136 GVDRVA-----LLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLE 190
            + R A     L+   +      ++              + +  A +      +K  LL 
Sbjct: 122 ELARSASALGRLIARLQREGVPPHIMPMAAPFRLDDCGWVADRWAEMLSLPPADKARLLL 181

Query: 191 APDFRARAQTLIAIM 205
            P    R + + A++
Sbjct: 182 LPP-LDRLREIDAVL 195


>d2anea1 b.122.1.10 (A:8-117) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 110 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target221 peptidase S16 lon domain protein [Candidatus Liberibact
d1zboa1197 Hypothetical protein BPP1347 {Bordetella parapertussis 100.0
d2anea1110 ATP-dependent protease La (Lon), N-terminal domain {Esc 99.93
>d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]} Back     information, alignment and structure
class: All beta proteins
fold: PUA domain-like
superfamily: PUA domain-like
family: LON domain-like
domain: Hypothetical protein BPP1347
species: Bordetella parapertussis [TaxId: 519]
Probab=100.00  E-value=5.3e-37  Score=249.26  Aligned_cols=189  Identities=18%  Similarity=0.180  Sum_probs=147.1

Q ss_pred             CCCCEEECCCCEECCCCCCCEEECCHHHHHHHHHHHHCCCCEEEEECC--CCCCCCCCCCCHHHEEEEEEEECCCCCCCC
Q ss_conf             315533308735788851234318389999999999709932662012--343344664352110013242101346666
Q gi|254780740|r   16 CLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPA--ISGFLANSDNGLSQIGCIGRITSFVETDDG   93 (221)
Q Consensus        16 ~~lPi~PL~~~VlFP~~~~pL~Ife~ry~~~i~~~l~~~~~igiv~~~--~~~~~~~~~~~l~~vGt~a~I~~~~~~~dG   93 (221)
                      ..||+||| ++|+|||+.+|||||||||++|+++|+++++.||++...  ......++.+++|+|||+|+|.++.++|||
T Consensus         1 ~elPlfpL-~~VlfP~~~~PL~Ife~ry~~~i~~~l~~~~~~~~v~~~~~~~~~~~~~~~~l~~vGt~~~I~~~~~~~dG   79 (197)
T d1zboa1           1 AEIPLFPL-SNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVVVLEQGTEVRRPDGREVLARAGTMARIDHWEAPMPA   79 (197)
T ss_dssp             CEEEEEEE-SSCCCTTBEEEEEECSTTTHHHHHHHHHTTCCEEEEEESSSCSSCCSSCCCCEEEEEEEEEEEEEECSSTT
T ss_pred             CCCCEEEC-CCCCCCCCCEEEEECCHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCC
T ss_conf             99777848-87567995354675856999999999854997023112356531123565540134578887520236777


Q ss_pred             CEEEEEEEEEEEEECCCCCCCCCEEEEEEEECCCCCCCHH--HHHHHHHHHHHHHHHHHHHCCCCHH---HHHHHHCCHH
Q ss_conf             2489875421111010002454068999952222254102--4567888657889988651032013---5777630535
Q gi|254780740|r   94 HYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGND--NDGVDRVALLEVFRNYLTVNNLDAD---WESIEEASNE  168 (221)
Q Consensus        94 ~~~i~v~G~~R~kI~~~~~~~~py~~a~v~~~~~d~~~~~--~~~~~~~~l~~~~~~~~~~~~~~~~---~~~i~~~~~~  168 (221)
                      ++.|+++|.+||||.++....++|+.+.++..+++.....  +.......+.+.++++.........   .......++.
T Consensus        80 ~~~i~v~G~~R~~i~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (197)
T d1zboa1          80 LLELACTGTGRFRLHACTQGKYGLWTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPHIMPMAAPFRLDDCG  159 (197)
T ss_dssp             CEEEEEEEEEEEEEEEEEECGGGCEEEEEEEECCCCCCCCCGGGHHHHHHHHHHHHHHHHTTCCTTTCSBCSCCCTTCHH
T ss_pred             CEEEEEEECCCEEEEEEEECCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCHH
T ss_conf             53676522000333346613675378898742666775673999999999999999999735785065553123127899


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             79999998679998999998536898999999999999
Q gi|254780740|r  169 ILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMK  206 (221)
Q Consensus       169 ~l~d~iA~~l~~~~~eKQ~lLE~~~~~~Rl~~l~~~Le  206 (221)
                      .++|++|++++++.++||+|||+ |..+|++++.++|+
T Consensus       160 ~l~~~la~~l~l~~~~kQ~lLE~-~~~~RL~~l~~~L~  196 (197)
T d1zboa1         160 WVADRWAEMLSLPPADKARLLLL-PPLDRLREIDAVLA  196 (197)
T ss_dssp             HHHHHHHHHSCCCHHHHHHHHHS-CHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCHHHHHHHHCC-CHHHHHHHHHHHHC
T ss_conf             99999998289999999998779-98999999999976



>d2anea1 b.122.1.10 (A:8-117) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 221 peptidase S16 lon domain protein [Candidatus Liber
1zbo_A_210 (A:) Hypothetical protein BPP1347; alpha-beta prot 3e-22
2ane_A_125 (A:) ATP-dependent protease LA; LONN119, LON prote 7e-20
>1zbo_A (A:) Hypothetical protein BPP1347; alpha-beta protein, structural genomics, PSI, protein structure initiative; 2.60A {Bordetella parapertussis 12822}Length = 210 Back     alignment and structure
 Score = 99.4 bits (247), Expect = 3e-22
 Identities = 33/196 (16%), Positives = 54/196 (27%), Gaps = 9/196 (4%)

Query: 18  LPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAI--SGFLANSDNGL 75
           +P+FPL    L P       VFE RY+      +A     G+V           +    L
Sbjct: 4   IPLFPL-SNALFPAGVLRLRVFEIRYLDXVRRCIADGSEFGVVVLEQGTEVRRPDGREVL 62

Query: 76  SQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRC--FYIAPFISDLAGND 133
           ++ G   RI  +         +   G  RFRL                  P  + L    
Sbjct: 63  ARAGTXARIDHWEAPXPALLELACTGTGRFRLHACTQGKYGLWTGQAEPVPDDAPLEVPP 122

Query: 134 NDGVDRVALLEVFRNYLTVN---NLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLE 190
                  AL  +           ++              + +  A        +K  LL 
Sbjct: 123 ELARSASALGRLIARLQREGVPPHIXPXAAPFRLDDCGWVADRWAEXLSLPPADKARLLL 182

Query: 191 APDFRARAQTLIAIMK 206
                 R + + A++ 
Sbjct: 183 L-PPLDRLREIDAVLA 197


>2ane_A (A:) ATP-dependent protease LA; LONN119, LON protease, hydrolase; 2.03A {Escherichia coli}Length = 125 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target221 peptidase S16 lon domain protein [Candidatus Liberibact
1zbo_A_210 Hypothetical protein BPP1347; alpha-beta protein, 100.0
2ane_A_125 ATP-dependent protease LA; LONN119, LON protease, 99.94
>1zbo_A (A:) Hypothetical protein BPP1347; alpha-beta protein, structural genomics, PSI, protein structure initiative; 2.60A {Bordetella parapertussis 12822} Back     alignment and structure
Probab=100.00  E-value=4.1e-34  Score=233.58  Aligned_cols=199  Identities=17%  Similarity=0.156  Sum_probs=162.7

Q ss_pred             CCCCEEECCCCEECCCCCCCEEECCHHHHHHHHHHHHCCCCEEEEE--CCCCCCCCCCCCCHHHEEEEEEEECCCCCCCC
Q ss_conf             3155333087357888512343183899999999997099326620--12343344664352110013242101346666
Q gi|254780740|r   16 CLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQ--PAISGFLANSDNGLSQIGCIGRITSFVETDDG   93 (221)
Q Consensus        16 ~~lPi~PL~~~VlFP~~~~pL~Ife~ry~~~i~~~l~~~~~igiv~--~~~~~~~~~~~~~l~~vGt~a~I~~~~~~~dG   93 (221)
                      .+||+||+ +.|+|||+.+||+||||||++|+++|+++++.||++.  +.+...+.++.+++|+|||+|+|.++.+.+||
T Consensus         2 ~~lPilpl-~~vlfPg~~~~l~i~~~~~~~~i~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG~~~~I~~~~~~~dg   80 (210)
T 1zbo_A            2 AEIPLFPL-SNALFPAGVLRLRVFEIRYLDXVRRCIADGSEFGVVVLEQGTEVRRPDGREVLARAGTXARIDHWEAPXPA   80 (210)
T ss_dssp             CEEEEEEE-SSCCCTTBEEEEEECSTTTHHHHHHHHHTTCCEEEEEESSSCSSCCSSCCCCEEEEEEEEEEEEEECSSTT
T ss_pred             CCCCEEEC-CCCCCCCCCEEEEECCHHHHHHHHHHHHCCCCCCCEEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCC
T ss_conf             84787616-86567995256776856899999999853998641010147644456665441002355665201346663


Q ss_pred             CEEEEEEEEEEEEECCCCCCCCCEEEEEEEECCCCCC--CHHHHHHHHHHHHHHHHHHHHHCCCCHH--HHHH-HHCCHH
Q ss_conf             2489875421111010002454068999952222254--1024567888657889988651032013--5777-630535
Q gi|254780740|r   94 HYIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLA--GNDNDGVDRVALLEVFRNYLTVNNLDAD--WESI-EEASNE  168 (221)
Q Consensus        94 ~~~i~v~G~~R~kI~~~~~~~~py~~a~v~~~~~d~~--~~~~~~~~~~~l~~~~~~~~~~~~~~~~--~~~i-~~~~~~  168 (221)
                      ++.|.++|++||||.++.+.+++|+.|.|++..++..  ...+.......+.+.++++....+....  ...+ ...+++
T Consensus        81 ~~~i~~~G~~R~~i~~~~~~~~~~~~a~v~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (210)
T 1zbo_A           81 LLELACTGTGRFRLHACTQGKYGLWTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPHIXPXAAPFRLDDCG  160 (210)
T ss_dssp             CEEEEEEEEEEEEEEEEEECGGGCEEEEEEEECCCCCCCCCGGGHHHHHHHHHHHHHHHHTTCCTTTCSBCSCCCTTCHH
T ss_pred             CEEEEEEECCCEEEEEEEECCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHH
T ss_conf             24676521000234245622675256777742666765441889999999999999999845774033443243114499


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHH--HHHHHHH
Q ss_conf             79999998679998999998536898999999999999999--9974232
Q gi|254780740|r  169 ILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVL--ARAYTHC  216 (221)
Q Consensus       169 ~l~d~iA~~l~~~~~eKQ~lLE~~~~~~Rl~~l~~~Le~el--~~~~~~~  216 (221)
                      .++|++|++++++.++||+|||+ |+.+|+.+++++|+.|+  .+.+++|
T Consensus       161 ~l~d~~a~~l~l~~~~kq~lLe~-d~~~Rl~~l~~~l~~e~~~~~l~~~I  209 (210)
T 1zbo_A          161 WVADRWAEXLSLPPADKARLLLL-PPLDRLREIDAVLAADGHALEHHHHH  209 (210)
T ss_dssp             HHHHHHHHHSCCCHHHHHHHHHS-CHHHHHHHHHHHHHC-----------
T ss_pred             HHHHHHHHHCCCCHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99999998389999999998789-99999999999999865566303357



>2ane_A (A:) ATP-dependent protease LA; LONN119, LON protease, hydrolase; 2.03A {Escherichia coli} Back     alignment and structure