254780745

254780745

OstA family protein

GeneID in NCBI database:8209750Locus tag:CLIBASIA_03160
Protein GI in NCBI database:254780745Protein Accession:YP_003065158.1
Gene range:+(525949, 526494)Protein Length:181aa
Gene description:OstA family protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:OstA family protein; K09774 lipopolysaccharide export system protein LptA
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP
ccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccccccccEEEEEcEEEEEccccEEEEEEEEEEEEccEEEEEcEEEEEEcccccccccEEEEEEEEccEEEcccccEEEEEEEEEEEcccEEEEEcccccEEEEEEcccEEEEEEEEEEEEccEEEEEcccccEEEEEEcccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccEEEcccccEEEEEEEEEEEEccEEEEccEEEEEEEcccccccccEEEEEEcccEEEEcccEEEEccEEEEEccccEEEEEcccccEEEEEccccEEEccEEEEEEcccEEEEEcccccEEEEEEcccccc
MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLgnekihikADMLEVKDAVQKAFFkgnvfmtqedfslqadkmtidynntnrdvsnkinrmdvernifiqsgeinviasngyvdfQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDtsfaslqgcesdqVQSIIRYDGRP
MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTidynntnrdvsnkinrMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSfaslqgcesdqvqsiirydgrp
MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP
******S**LYIHLLALVFVLLKADLSQA***************IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN******IN*MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI******************IR*****
MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP
MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP
MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP
MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target181 OstA family protein [Candidatus Liberibacter asiaticus
315121908155 OstA family protein [Candidatus Liberibacter solanacear 1 6e-33
227820606187 putative OstA-like protein [Sinorhizobium fredii NGR234 1 6e-18
150395245186 OstA family protein [Sinorhizobium medicae WSM419] Leng 1 8e-17
159184263187 hypothetical protein Atu0334 [Agrobacterium tumefaciens 1 1e-16
15964136186 hypothetical protein SMc01137 [Sinorhizobium meliloti 1 1 1e-16
325291769218 hypothetical protein AGROH133_03499 [Agrobacterium sp. 1 5e-16
163757835183 hypothetical protein HPDFL43_20532 [Hoeflea phototrophi 1 7e-15
222147329187 cell envelope biogenesis protein YhbN [Agrobacterium vi 1 7e-15
116250189213 outer membrane OstA family protein [Rhizobium leguminos 1 2e-14
260460503196 OstA family protein [Mesorhizobium opportunistum WSM207 1 1e-13
>gi|315121908|ref|YP_004062397.1| OstA family protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 155 Back     alignment and organism information
 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 111/157 (70%), Gaps = 7/157 (4%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           +K DLS+A +SY + FK+  +++I+I +D L+V+D ++KA F+G V +TQ D ++QA+++
Sbjct: 1   MKTDLSRAESSYFSSFKIGRDQEIYIHSDTLDVQDDLKKASFRGGVTVTQGDTNMQAEEI 60

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + Y     D S++++RMD+  N+ I S +   +A NGY DFQK+ILVL G   DKVI +
Sbjct: 61  ILHYT----DSSDQLSRMDMRNNVIINSDKNKAMAKNGYCDFQKKILVLYG---DKVIFQ 113

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           E +NTFLGC+L V +D   A LQGC S QV+SII+Y+
Sbjct: 114 EGMNTFLGCRLTVKLDVGTAYLQGCGSQQVKSIIKYN 150


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820606|ref|YP_002824576.1| putative OstA-like protein [Sinorhizobium fredii NGR234] Length = 187 Back     alignment and organism information
>gi|150395245|ref|YP_001325712.1| OstA family protein [Sinorhizobium medicae WSM419] Length = 186 Back     alignment and organism information
>gi|159184263|ref|NP_353366.2| hypothetical protein Atu0334 [Agrobacterium tumefaciens str. C58] Length = 187 Back     alignment and organism information
>gi|15964136|ref|NP_384489.1| hypothetical protein SMc01137 [Sinorhizobium meliloti 1021] Length = 186 Back     alignment and organism information
>gi|325291769|ref|YP_004277633.1| hypothetical protein AGROH133_03499 [Agrobacterium sp. H13-3] Length = 218 Back     alignment and organism information
>gi|163757835|ref|ZP_02164924.1| hypothetical protein HPDFL43_20532 [Hoeflea phototrophica DFL-43] Length = 183 Back     alignment and organism information
>gi|222147329|ref|YP_002548286.1| cell envelope biogenesis protein YhbN [Agrobacterium vitis S4] Length = 187 Back     alignment and organism information
>gi|116250189|ref|YP_766027.1| outer membrane OstA family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 213 Back     alignment and organism information
>gi|260460503|ref|ZP_05808754.1| OstA family protein [Mesorhizobium opportunistum WSM2075] Length = 196 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target181 OstA family protein [Candidatus Liberibacter asiaticus
pfam03968141 pfam03968, OstA, OstA-like protein 3e-12
COG1934173 COG1934, COG1934, Uncharacterized protein conserved in 2e-14
TIGR03002142 TIGR03002, outer_YhbN_LptA, lipopolysaccharide transpor 8e-06
>gnl|CDD|146549 pfam03968, OstA, OstA-like protein Back     alignment and domain information
>gnl|CDD|32117 COG1934, COG1934, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|163098 TIGR03002, outer_YhbN_LptA, lipopolysaccharide transport periplasmic protein LptA Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 181 OstA family protein [Candidatus Liberibacter asiaticus
PRK10894184 hypothetical protein; Provisional 100.0
TIGR03002150 outer_YhbN cell envelope biogenesis protein YhbN; Inter 100.0
COG1934173 Uncharacterized protein conserved in bacteria [Function 100.0
pfam03968141 OstA OstA-like protein. This family of proteins are mos 99.97
PRK03761 782 organic solvent tolerance protein; Provisional 99.71
PRK04423 798 organic solvent tolerance protein; Provisional 99.52
pfam06835176 DUF1239 Protein of unknown function (DUF1239). This fam 98.93
COG1452 784 Imp Organic solvent tolerance protein OstA [Cell envelo 98.63
PRK10893190 hypothetical protein; Provisional 98.33
COG3117188 Uncharacterized protein conserved in bacteria [Function 97.31
PRK10893190 hypothetical protein; Provisional 96.8
COG3117188 Uncharacterized protein conserved in bacteria [Function 94.42
COG5375216 Uncharacterized protein conserved in bacteria [Function 93.41
COG1452 784 Imp Organic solvent tolerance protein OstA [Cell envelo 99.53
COG1934173 Uncharacterized protein conserved in bacteria [Function 98.44
TIGR03002150 outer_YhbN cell envelope biogenesis protein YhbN; Inter 98.14
PRK10894184 hypothetical protein; Provisional 97.83
PRK03761 782 organic solvent tolerance protein; Provisional 98.73
pfam06835176 DUF1239 Protein of unknown function (DUF1239). This fam 98.62
PRK04423 798 organic solvent tolerance protein; Provisional 98.4
pfam03968141 OstA OstA-like protein. This family of proteins are mos 98.28
PRK11397 390 dacD D-alanyl-D-alanine carboxypeptidase; Provisional 92.72
>PRK10894 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03002 outer_YhbN cell envelope biogenesis protein YhbN; InterPro: IPR014340 Members of this entry include YhbN, which is an essential protein in Escherichia coli Back     alignment and domain information
>COG1934 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam03968 OstA OstA-like protein Back     alignment and domain information
>PRK03761 organic solvent tolerance protein; Provisional Back     alignment and domain information
>PRK04423 organic solvent tolerance protein; Provisional Back     alignment and domain information
>pfam06835 DUF1239 Protein of unknown function (DUF1239) Back     alignment and domain information
>COG1452 Imp Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10893 hypothetical protein; Provisional Back     alignment and domain information
>COG3117 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10893 hypothetical protein; Provisional Back     alignment and domain information
>COG3117 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5375 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1452 Imp Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1934 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03002 outer_YhbN cell envelope biogenesis protein YhbN; InterPro: IPR014340 Members of this entry include YhbN, which is an essential protein in Escherichia coli Back     alignment and domain information
>PRK10894 hypothetical protein; Provisional Back     alignment and domain information
>PRK03761 organic solvent tolerance protein; Provisional Back     alignment and domain information
>pfam06835 DUF1239 Protein of unknown function (DUF1239) Back     alignment and domain information
>PRK04423 organic solvent tolerance protein; Provisional Back     alignment and domain information
>pfam03968 OstA OstA-like protein Back     alignment and domain information
>PRK11397 dacD D-alanyl-D-alanine carboxypeptidase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target181 OstA family protein [Candidatus Liberibacter asiaticus
2r19_A159 Crystal Structure Of The Periplasmic Lipopolysaccha 2e-21
>gi|186972769|pdb|2R19|A Chain A, Crystal Structure Of The Periplasmic Lipopolysaccharide Transport Protein Lpta (Yhbn), Orthorhombic Form Length = 159 Back     alignment and structure
 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 53/145 (36%), Gaps = 6/145 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVS 93
                 ++ IHI++D   +        F GNV +TQ    + ADK+ +        ++V 
Sbjct: 1   AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVI 60

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
           +   +      +      +   AS  + +  K  +VL G+      L++  +   G K+ 
Sbjct: 61  DGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAY----LQQVDSNIKGDKIT 116

Query: 154 VNIDTSFASLQGCESDQVQSIIRYD 178
             +          +  +V +++   
Sbjct: 117 YLVKEQKMQAFSDKGKRVTTVLVPS 141


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target181 OstA family protein [Candidatus Liberibacter asiaticus
2r19_A159 Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, s 3e-13
>2r19_A Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Length = 159 Back     alignment and structure
 Score = 70.1 bits (171), Expect = 3e-13
 Identities = 24/136 (17%), Positives = 53/136 (38%), Gaps = 6/136 (4%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN--RDVSNKINRM 99
           ++ IHI++D   +        F GNV +TQ    + ADK+ +        ++V +   + 
Sbjct: 7   DQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKP 66

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
                +      +   AS  + +  K  +VL G+      L++  +   G K+   +   
Sbjct: 67  ATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGN----AYLQQVDSNIKGDKITYLVKEQ 122

Query: 160 FASLQGCESDQVQSII 175
                  +  +V +++
Sbjct: 123 KMQAFSDKGKRVTTVL 138


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target181 OstA family protein [Candidatus Liberibacter asiaticus
2r19_A159 Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, s 99.97
3my2_A175 Lipopolysaccharide export system protein LPTC; lipopoly 98.81
3my2_A175 Lipopolysaccharide export system protein LPTC; lipopoly 98.45
2r19_A159 Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, s 98.1
>2r19_A Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure
Probab=99.97  E-value=2.4e-30  Score=181.75  Aligned_cols=141  Identities=16%  Similarity=0.160  Sum_probs=120.3

Q ss_pred             CCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEECCEEEEEEEEEEEECCCCCCCCC--CEEEEEECCCCCCCCCCCC
Q ss_conf             24457778479991169999238879998008999787599996899996176654442--0012220122202455653
Q gi|254780745|r   36 RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN--KINRMDVERNIFIQSGEIN  113 (181)
Q Consensus        36 ~~~~d~~~Pi~I~AD~~~~d~~~~~~~~~GNV~i~qg~~~i~aD~l~i~~~~~~~~~~~--~i~~~~a~gnv~~~~~~~~  113 (181)
                      |+++|+++||+|+||+++||++++.++|+|||++.||++.|+||+++++++.+......  ......+...+....+...
T Consensus         1 A~~~D~~qpi~I~Ad~l~~d~~~~~~~~~GnV~i~~g~~~i~ad~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (159)
T 2r19_A            1 AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVE   80 (159)
T ss_dssp             -CGGGGGSCEEEEESEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEECCC--CTTCEEEEECSSCEEEECCTTSCCEE
T ss_pred             CCCCCCCCCEEEEECEEEEECCCCEEEEECCEEEEECCEEEEEEEEEEEECCCCCCEEEEEECCCEEEEEEEECCCCEEE
T ss_conf             98867789989997779966089999998148998487699997799995377652146762143168999715884399


Q ss_pred             EEEEEEEEECCCCEEEEEECCCCEEEEEECCCEEEEEEEEEEECCCEEEEEECCCCEEEEEEECCCC
Q ss_conf             3211279941665899994786349997179769922999992165899992899809999811876
Q gi|254780745|r  114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR  180 (181)
Q Consensus       114 ~~a~~~~y~~~~~~~~l~Gna~~~v~l~q~~~~i~gdki~yn~~tg~~~~~g~~~~rV~~i~~~~~r  180 (181)
                      ++|+++.|+..++.++|+||+    .++|+++.++|++|+||++++.+.+.|++++||+++|.|...
T Consensus        81 a~a~~~~Y~~~~~~~~l~Gna----~l~q~~~~i~g~~i~y~~~~~~~~~~g~~~~RV~~~~~P~~~  143 (159)
T 2r19_A           81 GHASQMHYELAKDFVVLTGNA----YLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQL  143 (159)
T ss_dssp             EECSEEEEEGGGTEEEEEEEE----EEEETTEEEEEEEEEEETTTTEEEEECSSSCCCCCCC-----
T ss_pred             EEEEEEEEECCCCEEEEECCE----EEEECCCEEEEEEEEEECCCCEEEEECCCCCCEEEEECCCCC
T ss_conf             999899997779999996419----999799999975999990689999965899958999997655



>3my2_A Lipopolysaccharide export system protein LPTC; lipopolysaccharide export pathway, structural genomics scottish structural proteomics facility; 2.20A {Escherichia coli} Back     alignment and structure
>3my2_A Lipopolysaccharide export system protein LPTC; lipopolysaccharide export pathway, structural genomics scottish structural proteomics facility; 2.20A {Escherichia coli} Back     alignment and structure
>2r19_A Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 181 OstA family protein [Candidatus Liberibacter asiat
2r19_A_159 (A:) Protein YHBN; beta-jellyroll, mainly beta, be 2e-12
>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_ALength = 159 Back     alignment and structure
 Score = 67.0 bits (163), Expect = 2e-12
 Identities = 24/137 (17%), Positives = 53/137 (38%), Gaps = 6/137 (4%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY--NNTNRDVSNKINRM 99
           ++ IHI++D   +        F GNV +TQ    + ADK+ +        ++V +   + 
Sbjct: 7   DQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKP 66

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
                +      +   AS  + +  K  +VL G+      L++  +   G K+   +   
Sbjct: 67  ATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGN----AYLQQVDSNIKGDKITYLVKEQ 122

Query: 160 FASLQGCESDQVQSIIR 176
                  +  +V +++ 
Sbjct: 123 KMQAFSDKGKRVTTVLV 139


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target181 OstA family protein [Candidatus Liberibacter asiaticus
2r19_A_159 Protein YHBN; beta-jellyroll, mainly beta, beta-TA 99.91
2r19_A_159 Protein YHBN; beta-jellyroll, mainly beta, beta-TA 98.72
>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure
Probab=99.91  E-value=4.4e-23  Score=143.20  Aligned_cols=137  Identities=17%  Similarity=0.173  Sum_probs=124.0

Q ss_pred             CCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEECCEEEEEEEEEEEECCCCCCCCC--CEEEEEECCCCCCCCCCCCE
Q ss_conf             4457778479991169999238879998008999787599996899996176654442--00122201222024556533
Q gi|254780745|r   37 FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN--KINRMDVERNIFIQSGEINV  114 (181)
Q Consensus        37 ~~~d~~~Pi~I~AD~~~~d~~~~~~~~~GNV~i~qg~~~i~aD~l~i~~~~~~~~~~~--~i~~~~a~gnv~~~~~~~~~  114 (181)
                      .+.+.++|++|+||++++|..++.++|+|||+|++++..|+||+++++++++.....+  ....+.+.|+|.+.+++..+
T Consensus         2 ~~~~~~~~i~i~Ad~~~~~~~~~~~~~~GnV~i~~~~~~l~ad~~~~~~~~~~~~~~~~~~~~~~~~~g~v~~~~~~~~~   81 (159)
T 2r19_A            2 VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEG   81 (159)
T ss_dssp             CGGGGGSCEEEEESEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEECCC--CTTCEEEEECSSCEEEECCTTSCCEEE
T ss_pred             CCCCCCCCEEEEECEEEEECCCCEEEEECCEEEEECCEEEEEEEEEEEECCCCCCEEEEEEECCCEEEEEECCCCCEEEE
T ss_conf             87677899799956599235699999975689980867999989999977886642578751341189995168833999


Q ss_pred             EEEEEEEECCCCEEEEEECCCCEEEEEECCCEEEEEEEEEEECCCEEEEEECCCCEEEEEEEC
Q ss_conf             211279941665899994786349997179769922999992165899992899809999811
Q gi|254780745|r  115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY  177 (181)
Q Consensus       115 ~a~~~~y~~~~~~~~l~Gna~~~v~l~q~~~~i~gdki~yn~~tg~~~~~g~~~~rV~~i~~~  177 (181)
                      +|+++.|+..++.++|+||+    .++++.+.++|+++.|+++++.+.+.|..+.+++..+.+
T Consensus        82 ~~~~~~y~~~~~~~~~~g~~----~~~~~~~~~~g~~~~~~~~~~~~t~~~~~~~~~~~~~~~  140 (159)
T 2r19_A           82 HASQMHYELAKDFVVLTGNA----YLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVP  140 (159)
T ss_dssp             ECSEEEEEGGGTEEEEEEEE----EEEETTEEEEEEEEEEETTTTEEEEECSSSCCCCCCC--
T ss_pred             EEEEEEEECCCCEEEEECCE----EEEECCCEEEECEEEEEECCCEEEEECCCCCCEEEEECC
T ss_conf             98457997468889980678----999589999967899991689999965899945999998



>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure