254780746

254780746

hypothetical protein CLIBASIA_03165

GeneID in NCBI database:8209751Locus tag:CLIBASIA_03165
Protein GI in NCBI database:254780746Protein Accession:YP_003065159.1
Gene range:+(525272, 525919)Protein Length:215aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein; K11719 lipopolysaccharide export system protein LptC
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN
ccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccccccccEEEEcccEEccccccccEEEEEEEEEEEEccccccEEEEEEEEEEEEEEcccEEEEEEEEcccEEEccccEEEccccEEEEEccccEEEEEEEEEEccccEEcccccEEEEEcccEEEEEEEEEEcccEEEEEEccEEEEEcHHHHHcccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccEEEEccccccccccccccEEHHHHHHHHHccccccEEEEEEEEEEEcccccEEEEEEEEEccEEEccccEEEccccEEEEEcccEEEEEEEEEEEcccccccccccEEEEcccEEEEEcEEEEEcccEEEEEEccEEEEEcHHHHHHHcc
MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIstfskssidlldfepmIMKKFIlsdyskdrVKYSLVAERAKtsfnsgkgiiflqdfeltvptqrseygdmyLFAHSARfnlanhtlyisqpfkmkvkdnLRLDFETAVLDvknitinssdpviithSDFVLSANFarienssrsavfAGQVSVvvnpgvlqkken
mdhldrrnkillqrskyrQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFilsdyskdRVKYSLVAERaktsfnsgkgiiflqDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKnitinssdpviiTHSDFVLSANFARIENSsrsavfagqvsvvvnpgvlqkken
MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN
****************YRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIST****************KKFILSDYSKDRVKYSLVAERAKT*****KGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV***********
MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN
**HLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQ****
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN
MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN
MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target215 hypothetical protein CLIBASIA_03165 [Candidatus Liberib
315121909215 hypothetical protein CKC_00795 [Candidatus Liberibacter 1 1e-49
86356058221 hypothetical protein RHE_CH00401 [Rhizobium etli CFN 42 1 1e-11
241202815221 hypothetical protein Rleg_0061 [Rhizobium leguminosarum 1 2e-11
222084666228 hypothetical protein Arad_0623 [Agrobacterium radiobact 1 2e-11
116250188221 transmembrane protein [Rhizobium leguminosarum bv. vici 1 3e-11
163757834226 hypothetical protein HPDFL43_20527 [Hoeflea phototrophi 1 4e-11
190890073221 hypothetical protein RHECIAT_CH0000443 [Rhizobium etli 1 1e-10
218458734231 hypothetical protein RetlK5_04413 [Rhizobium etli Kim 5 1 3e-10
209547657221 hypothetical protein Rleg2_0045 [Rhizobium leguminosaru 1 8e-10
260460502237 protein of unknown function DUF1239 [Mesorhizobium oppo 1 1e-07
>gi|315121909|ref|YP_004062398.1| hypothetical protein CKC_00795 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 215 Back     alignment and organism information
 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 141/214 (65%), Gaps = 4/214 (1%)

Query: 1   MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL 60
           M+ LDRR K+LLQR KY QH + I+FLKFF P  +V ++ W   SSW+RI  FSK + D 
Sbjct: 4   MNELDRREKLLLQRKKYNQHFKLIRFLKFFLPTLSVVLLSWLFFSSWVRIKHFSKPAADF 63

Query: 61  LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120
           L+FE M++ KFILSDYS+D+ +YSL A+RA+ +    K  I LQD EL +P     Y +M
Sbjct: 64  LNFEFMVINKFILSDYSRDKKRYSLSAKRAQDN-EGSKNTILLQDLELVMPI--PGYDEM 120

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDN-LRLDFETAVLDVKNITINSSDPVIITHSDF 179
            L A+ A F+L  + L I  PFK+   +N  +L F+TAV+D+K I +NSSD V  T S F
Sbjct: 121 RLLANYASFDLYRNMLNIQHPFKIIFNNNDTQLYFKTAVMDIKKIVLNSSDAVKFTSSTF 180

Query: 180 VLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
            LSA    IEN  + A+F+G VSVV++P +L KK
Sbjct: 181 TLSAQSCSIENDQKRAIFSGDVSVVIHPKILHKK 214


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86356058|ref|YP_467950.1| hypothetical protein RHE_CH00401 [Rhizobium etli CFN 42] Length = 221 Back     alignment and organism information
>gi|241202815|ref|YP_002973911.1| hypothetical protein Rleg_0061 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 221 Back     alignment and organism information
>gi|222084666|ref|YP_002543195.1| hypothetical protein Arad_0623 [Agrobacterium radiobacter K84] Length = 228 Back     alignment and organism information
>gi|116250188|ref|YP_766026.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 221 Back     alignment and organism information
>gi|163757834|ref|ZP_02164923.1| hypothetical protein HPDFL43_20527 [Hoeflea phototrophica DFL-43] Length = 226 Back     alignment and organism information
>gi|190890073|ref|YP_001976615.1| hypothetical protein RHECIAT_CH0000443 [Rhizobium etli CIAT 652] Length = 221 Back     alignment and organism information
>gi|218458734|ref|ZP_03498825.1| hypothetical protein RetlK5_04413 [Rhizobium etli Kim 5] Length = 231 Back     alignment and organism information
>gi|209547657|ref|YP_002279574.1| hypothetical protein Rleg2_0045 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 221 Back     alignment and organism information
>gi|260460502|ref|ZP_05808753.1| protein of unknown function DUF1239 [Mesorhizobium opportunistum WSM2075] Length = 237 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target215 hypothetical protein CLIBASIA_03165 [Candidatus Liberib
COG5375216 COG5375, COG5375, Uncharacterized protein conserved in 9e-09
>gnl|CDD|34939 COG5375, COG5375, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 215 hypothetical protein CLIBASIA_03165 [Candidatus Liberib
COG5375216 Uncharacterized protein conserved in bacteria [Function 100.0
pfam06835176 DUF1239 Protein of unknown function (DUF1239). This fam 99.91
PRK10893190 hypothetical protein; Provisional 99.83
COG3117188 Uncharacterized protein conserved in bacteria [Function 99.64
COG1934173 Uncharacterized protein conserved in bacteria [Function 98.7
PRK10894184 hypothetical protein; Provisional 98.59
COG1452 784 Imp Organic solvent tolerance protein OstA [Cell envelo 98.49
PRK03761 782 organic solvent tolerance protein; Provisional 98.36
PRK04423 798 organic solvent tolerance protein; Provisional 98.2
PRK10894184 hypothetical protein; Provisional 98.18
TIGR03002150 outer_YhbN cell envelope biogenesis protein YhbN; Inter 98.0
pfam03968141 OstA OstA-like protein. This family of proteins are mos 98.7
pfam06835176 DUF1239 Protein of unknown function (DUF1239). This fam 98.67
PRK10893190 hypothetical protein; Provisional 97.27
COG5375216 Uncharacterized protein conserved in bacteria [Function 93.89
COG1452 784 Imp Organic solvent tolerance protein OstA [Cell envelo 98.39
PRK03761 782 organic solvent tolerance protein; Provisional 98.34
pfam03968141 OstA OstA-like protein. This family of proteins are mos 98.19
COG1934173 Uncharacterized protein conserved in bacteria [Function 98.1
TIGR03002150 outer_YhbN cell envelope biogenesis protein YhbN; Inter 97.91
PRK04423 798 organic solvent tolerance protein; Provisional 97.84
COG3117188 Uncharacterized protein conserved in bacteria [Function 97.34
>COG5375 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam06835 DUF1239 Protein of unknown function (DUF1239) Back     alignment and domain information
>PRK10893 hypothetical protein; Provisional Back     alignment and domain information
>COG3117 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1934 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10894 hypothetical protein; Provisional Back     alignment and domain information
>COG1452 Imp Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03761 organic solvent tolerance protein; Provisional Back     alignment and domain information
>PRK04423 organic solvent tolerance protein; Provisional Back     alignment and domain information
>PRK10894 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03002 outer_YhbN cell envelope biogenesis protein YhbN; InterPro: IPR014340 Members of this entry include YhbN, which is an essential protein in Escherichia coli Back     alignment and domain information
>pfam03968 OstA OstA-like protein Back     alignment and domain information
>pfam06835 DUF1239 Protein of unknown function (DUF1239) Back     alignment and domain information
>PRK10893 hypothetical protein; Provisional Back     alignment and domain information
>COG5375 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1452 Imp Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03761 organic solvent tolerance protein; Provisional Back     alignment and domain information
>pfam03968 OstA OstA-like protein Back     alignment and domain information
>COG1934 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03002 outer_YhbN cell envelope biogenesis protein YhbN; InterPro: IPR014340 Members of this entry include YhbN, which is an essential protein in Escherichia coli Back     alignment and domain information
>PRK04423 organic solvent tolerance protein; Provisional Back     alignment and domain information
>COG3117 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target215 hypothetical protein CLIBASIA_03165 [Candidatus Liberib
3my2_A175 Lipopolysaccharide export system protein LPTC; lipopoly 99.81
2r19_A159 Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, s 98.82
3my2_A175 Lipopolysaccharide export system protein LPTC; lipopoly 98.47
2r19_A159 Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, s 97.6
>3my2_A Lipopolysaccharide export system protein LPTC; lipopolysaccharide export pathway, structural genomics scottish structural proteomics facility; 2.20A {Escherichia coli} Back     alignment and structure
Probab=99.81  E-value=7.7e-19  Score=124.08  Aligned_cols=144  Identities=15%  Similarity=0.117  Sum_probs=124.9

Q ss_pred             EEEEECEEEEEECCCCC-EEEEEEEEEEECCCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEEECCCCEEEEECCEE
Q ss_conf             05871108998849988-89999601133588987449999568999816884567999934589973564699977779
Q gi|254780746|r   65 PMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK  143 (215)
Q Consensus        65 ~~~m~~P~~~G~~~~g~-~~~itA~~A~~~~~~~~~~i~L~~v~a~i~~~~g~~~~i~i~A~~G~y~~~~~~l~L~g~V~  143 (215)
                      ...+++....-++.+|. .|.|+|+++....  +.+.+.|+.|...++..++. ..+.|+|++|.++.. +.+.|.|||+
T Consensus        25 dy~~~~~~~~~~d~~G~l~~~l~A~~~~~~~--~~~~~~l~~P~~~~~~~~~~-~~w~itA~~g~~~~~-~~l~L~gnV~  100 (175)
T 3my2_A           25 TYKSEHTDTLVYNPEGALSYRLIAQHVEYYS--DQAVSWFTQPVLTTFDKDKI-PTWSVKADKAKLTND-RMLYLYGHVE  100 (175)
T ss_dssp             ------------------CEEEECSSEEEET--TTTEEEEESCEEEEECTTCC-EEEEEECSEEEECTT-SEEEEEEEEE
T ss_pred             CEEEEEEEEEEECCCCCEEEEEECCHHEECC--CCCCEEEECCEEEEECCCCC-CEEEEEECEEEECCC-CEEEEECEEE
T ss_conf             4999951899999999899999916314214--88964882559999748998-229999385898799-6899964099


Q ss_pred             EEECCC----CEEEEEEEEEEEEEEEEEECCCEEEEECCCEEEEEEEEEEECCCEEEEECCEEEEECHHHHCC
Q ss_conf             995157----399982127997203899538589990771899707999927868999889699983113201
Q gi|254780746|r  144 MKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQK  212 (215)
Q Consensus       144 i~~~~G----~~l~t~~~~~d~~~~~i~s~~~V~~~~~~g~i~A~~m~i~~~~~~i~F~g~V~l~i~p~~~~~  212 (215)
                      +...++    +.|.|+.+.|+.+++.+.|+.||.++++++.++|.||+++.+.+.+.|.|+||..|.|..-+.
T Consensus       101 i~~~~~~~~~~~l~T~~L~~~~~~~~~~td~~V~i~~~~~~~~g~gm~~~l~~~~~~l~~~Vk~~ye~~~~~~  173 (175)
T 3my2_A          101 VNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQT  173 (175)
T ss_dssp             EEECSSSCSEEEEEEEEEEEETTTCEEEEEEEEEEEESSCEEEEEEEEEETTTTEEEEEEEEEETTCC-----
T ss_pred             EEECCCCCCCEEEEEEEEEEEECCCEEEECCCEEEECCCCEEEEEEEEEECCCCEEEEECCEEEEEECCCCCC
T ss_conf             9963788874699981599991567999488499992996999778999963899999406289992886678



>2r19_A Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure
>3my2_A Lipopolysaccharide export system protein LPTC; lipopolysaccharide export pathway, structural genomics scottish structural proteomics facility; 2.20A {Escherichia coli} Back     alignment and structure
>2r19_A Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target215 hypothetical protein CLIBASIA_03165 [Candidatus Liberib
2r19_A_159 Protein YHBN; beta-jellyroll, mainly beta, beta-TA 98.76
2r19_A_159 Protein YHBN; beta-jellyroll, mainly beta, beta-TA 98.71
>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure
Probab=98.76  E-value=1.8e-08  Score=66.26  Aligned_cols=126  Identities=6%  Similarity=0.035  Sum_probs=97.5

Q ss_pred             CCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEEECCCCEE-----------EEECCEEEEE
Q ss_conf             99888999960113358898744999956899981688456799993458997356469-----------9977779995
Q gi|254780746|r   78 KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL-----------YISQPFKMKV  146 (215)
Q Consensus        78 ~~g~~~~itA~~A~~~~~~~~~~i~L~~v~a~i~~~~g~~~~i~i~A~~G~y~~~~~~l-----------~L~g~V~i~~  146 (215)
                      ....++.|+|+++.-+.  ..+.+.+.+ .+.+  ..+.   ..|+|++..|+..++..           ...|+|++. 
T Consensus         5 ~~~~~i~i~Ad~~~~~~--~~~~~~~~G-nV~i--~~~~---~~l~ad~~~~~~~~~~~~~~~~~~~~~~~~~g~v~~~-   75 (159)
T 2r19_A            5 DTDQPIHIESDQQSLDM--QGNVVTFTG-NVIV--TQGT---IKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDN-   75 (159)
T ss_dssp             GGGSCEEEEESEEEEET--TTTEEEEEE-EEEE--EETT---EEEEEEEEEEECCC--CTTCEEEEECSSCEEEECCTT-
T ss_pred             CCCCCEEEEECEEEEEC--CCCEEEEEC-CEEE--EECC---EEEEEEEEEEEECCCCCCEEEEEEECCCEEEEEECCC-
T ss_conf             77899799956599235--699999975-6899--8086---7999989999977886642578751341189995168-


Q ss_pred             CCCCEEEEEEEEEEEEEEEEEECCCEEEEECCCEEEEEEEEEEECCCEEEEECC----EEEEECHHHHCC
Q ss_conf             157399982127997203899538589990771899707999927868999889----699983113201
Q gi|254780746|r  147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ----VSVVVNPGVLQK  212 (215)
Q Consensus       147 ~~G~~l~t~~~~~d~~~~~i~s~~~V~~~~~~g~i~A~~m~i~~~~~~i~F~g~----V~l~i~p~~~~~  212 (215)
                      .++..++++.+.|+.+++.+...++|.+..+.+.++|+.+.++.+.+.+...+.    +++.+.|..+.+
T Consensus        76 ~~~~~~~~~~~~y~~~~~~~~~~g~~~~~~~~~~~~g~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~  145 (159)
T 2r19_A           76 GKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQD  145 (159)
T ss_dssp             SCCEEEECSEEEEEGGGTEEEEEEEEEEEETTEEEEEEEEEEETTTTEEEEECSSSCCCCCCC-------
T ss_pred             CCEEEEEEEEEEEECCCCEEEEECCEEEEECCCEEEECEEEEEECCCEEEEECCCCCCEEEEECCCCCCC
T ss_conf             8339999845799746888998067899958999996789999168999996589994599999876676



>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure