254780747

254780747

putative protease IV transmembrane protein

GeneID in NCBI database:8209752Locus tag:CLIBASIA_03170
Protein GI in NCBI database:254780747Protein Accession:YP_003065160.1
Gene range:-(524153, 525034)Protein Length:293aa
Gene description:putative protease IV transmembrane protein
COG prediction:[O] [U] Periplasmic serine proteases (ClpP class)
KEGG prediction:putative protease IV transmembrane protein; K04773 protease IV [EC:3.4.21.-]
SEED prediction:macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MEFVLKKIKTRYVMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNYWFCDLKNLSISSLLEDTIPLMKQTKVQGLWAVWNP
cHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEccHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHcccEEEEcccccccccHHHHccccHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHcccccccccHHHHHHHHHHccccccccccEEccccccHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcEEccHHHHHHHHHEEEEEccccEEEEEEEEcccEEEHHHHHHHHHHHHHHcccEEEEEccccccccEEEEccccEEEEcccccccHHHHHcccccHHHHHHHcccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHcccccccccHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccc
MEFVLKKIKTRYVMLSLVTLTVVYFSWsshvednsphvARIAIRGQIEDSQELIERIERISRDDSATALIVSlsspggsayaGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLvgsigvlfqypyvkpfldKLGVsiksvksspmkaepspfsevnpkAVQMMQDVVDSSYHWFVRLVSesrnipydktlvlsdgriwtgaeakkVGLIDVVGGQEEVWQSLYALGVDQsirkikdwnppknywfcdlknlsiSSLLEDTIPLMKQTKVQGLWAVWNP
mefvlkkiktryvMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRGQIEDSQELIERIERISRDDSATALIVSLsspggsayAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVksspmkaepspfsevnpKAVQMMQDVVDSSYHWFVRLVsesrnipydktlvlsdgriWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNYWFCDLKNLSISSLLEDTIPLmkqtkvqglwavwnp
MEFVLKKIKTRYVMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNYWFCDLKNLSISSLLEDTIPLMKQTKVQGLWAVWNP
MEFVLKKIKTRYVMLSLVTLTVVYFSW**********VARIAIRGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPK************************QTKVQGLWAVWNP
MEFVLKKIKTRYVMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKS**************EVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNYWFCDLKNLSISSLLEDTIPLMKQTKVQGLWAVWNP
MEFVLKKIKTRYVMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNYWFCDLKNLSISSLLEDTIPLMKQTKVQGLWAVWNP
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MEFVLKKIKTRYVMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNYWFCDLKNLSISSLLEDTIPLMKQTKVQGLWAVWNP
MEFVLKKIKTRYVMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNYWFCDLKNLSISSLLEDTIPLMKQTKVQGLWAVWNP
MEFVLKKIKTRYVMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNYWFCDLKNLSISSLLEDTIPLMKQTKVQGLWAVWNP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target293 putative protease IV transmembrane protein [Candidatus
254780272216 ATP-dependent Clp protease proteolytic subunit [Ca 0.025
>gi|254780272|ref|YP_003064685.1| ATP-dependent Clp protease proteolytic subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 216 Back     alignment
 Score = 30.8 bits (68), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 16/109 (14%)

Query: 41  IAIRGQIEDSQE--LIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKP 98
           + + GQIED     +  ++  +  ++    + + ++SPGG   AG AI+  +Q +K   P
Sbjct: 45  VFVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIK--PP 102

Query: 99  VITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDK 147
           + T     AAS G L+  A            G  G+ F  P  +  L +
Sbjct: 103 ISTFCMGQAASMGSLLLSA------------GEKGMRFALPNARILLHQ 139

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target293 putative protease IV transmembrane protein [Candidatus
315121910295 putative protease IV transmembrane protein [Candidatus 1 5e-95
15964138319 putative protease IV transmembrane protein [Sinorhizobi 1 9e-63
150395248319 signal peptide peptidase SppA, 36K type [Sinorhizobium 1 4e-62
227820608319 signal peptide peptidase S49, SppA [Sinorhizobium fredi 1 1e-61
209547656316 signal peptide peptidase SppA, 36K type [Rhizobium legu 1 5e-60
116250187327 peptidase [Rhizobium leguminosarum bv. viciae 3841] Len 1 3e-59
241202814316 signal peptide peptidase SppA, 36K type [Rhizobium legu 1 3e-59
15887687317 proteinase IV [Agrobacterium tumefaciens str. C58] Leng 1 7e-59
190890072316 proteinase IV protein [Rhizobium etli CIAT 652] Length 1 8e-59
218458242269 signal peptide peptidase SppA, 36K type [Rhizobium etli 1 4e-58
>gi|315121910|ref|YP_004062399.1| putative protease IV transmembrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 295 Back     alignment and organism information
 Score =  352 bits (902), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 221/290 (76%), Gaps = 2/290 (0%)

Query: 6   KKIKTRYVMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRGQI-EDSQELIERIERISRDD 64
           K IK R+++  L+ L + YF+W S   D +PHVARI I G I +D+++L++RI R+  DD
Sbjct: 6   KNIKKRHIVYLLIALGITYFAWDSIFPDRTPHVARITISGSIGDDNEDLLDRIHRVGTDD 65

Query: 65  SATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVHEMAASAGYLISCASNIIVAA 124
           SA AL++ +SSPGG+ Y  E++F A++KVK RKPV+T V  +AAS GYLISCASN I+A+
Sbjct: 66  SAKALVLWISSPGGTVYGSESLFEAVKKVKLRKPVVTLVGGVAASGGYLISCASNAIIAS 125

Query: 125 ETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDS 184
           ++S++GSIGV   YP  KPFLDKLG+S++++KSSP+K EPSP+S+ NP+ +Q ++++V+ 
Sbjct: 126 QSSIIGSIGVFLSYPQFKPFLDKLGISVETIKSSPLKGEPSPYSKPNPQTIQNLKELVND 185

Query: 185 SYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQ 244
            YHWFV+LVSE R+IPYDK L LS G +W+G +AKK+GLID +GG +EVW+SLY+LGVD+
Sbjct: 186 EYHWFVKLVSEERHIPYDKALTLSSGLVWSGTKAKKLGLIDAIGGNDEVWKSLYSLGVDK 245

Query: 245 SIRKIKDWNPPKNYWFCDLK-NLSISSLLEDTIPLMKQTKVQGLWAVWNP 293
            ++ IKDW  PKNYWF D      + S LED++P ++Q   +GL AVW P
Sbjct: 246 DVKIIKDWKSPKNYWFFDFNFKKYVKSTLEDSVPFIRQANFEGLLAVWRP 295


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964138|ref|NP_384491.1| putative protease IV transmembrane protein [Sinorhizobium meliloti 1021] Length = 319 Back     alignment and organism information
>gi|150395248|ref|YP_001325715.1| signal peptide peptidase SppA, 36K type [Sinorhizobium medicae WSM419] Length = 319 Back     alignment and organism information
>gi|227820608|ref|YP_002824578.1| signal peptide peptidase S49, SppA [Sinorhizobium fredii NGR234] Length = 319 Back     alignment and organism information
>gi|209547656|ref|YP_002279573.1| signal peptide peptidase SppA, 36K type [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 316 Back     alignment and organism information
>gi|116250187|ref|YP_766025.1| peptidase [Rhizobium leguminosarum bv. viciae 3841] Length = 327 Back     alignment and organism information
>gi|241202814|ref|YP_002973910.1| signal peptide peptidase SppA, 36K type [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 316 Back     alignment and organism information
>gi|15887687|ref|NP_353368.1| proteinase IV [Agrobacterium tumefaciens str. C58] Length = 317 Back     alignment and organism information
>gi|190890072|ref|YP_001976614.1| proteinase IV protein [Rhizobium etli CIAT 652] Length = 316 Back     alignment and organism information
>gi|218458242|ref|ZP_03498333.1| signal peptide peptidase SppA, 36K type [Rhizobium etli Kim 5] Length = 269 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target293 putative protease IV transmembrane protein [Candidatus
COG0616317 COG0616, SppA, Periplasmic serine proteases (ClpP class 6e-47
TIGR00706207 TIGR00706, SppA_dom, signal peptide peptidase SppA, 36K 4e-42
TIGR00705584 TIGR00705, SppA_67K, signal peptide peptidase SppA, 67K 2e-33
cd07022214 cd07022, S49_Sppa_36K_type, Signal peptide peptidase A 8e-27
PRK10949618 PRK10949, PRK10949, protease 4; Provisional 1e-24
cd07019211 cd07019, S49_SppA_1, Signal peptide peptidase A (SppA), 4e-23
cd07018222 cd07018, S49_SppA_67K_type, Signal peptide peptidase A 2e-19
cd00394161 cd00394, Clp_protease_like, Caseinolytic protease (ClpP 1e-17
cd07014177 cd07014, S49_SppA, Signal peptide peptidase A 3e-11
TIGR00705 584 TIGR00705, SppA_67K, signal peptide peptidase SppA, 67K 3e-07
COG0740200 COG0740, ClpP, Protease subunit of ATP-dependent Clp pr 5e-07
cd07021178 cd07021, Clp_protease_NfeD_like, Nodulation formation e 5e-07
cd06558195 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (Co 2e-06
cd07023208 cd07023, S49_Sppa_N_C, Signal peptide peptidase A (SppA 4e-58
pfam01343154 pfam01343, Peptidase_S49, Peptidase family S49 3e-31
PRK11778330 PRK11778, PRK11778, putative inner membrane peptidase; 7e-10
COG1030 436 COG1030, NfeD, Membrane-bound serine protease (ClpP cla 1e-07
cd07020187 cd07020, Clp_protease_NfeD_1, Nodulation formation effi 1e-06
cd07015172 cd07015, Clp_protease_NfeD, Nodulation formation effici 4e-06
cd07016160 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an 7e-06
PRK12553207 PRK12553, PRK12553, ATP-dependent Clp protease proteoly 9e-05
cd07013162 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an A 0.002
PRK14512197 PRK14512, PRK14512, ATP-dependent Clp protease proteoly 0.002
pfam01972286 pfam01972, SDH_sah, Serine dehydrogenase proteinase 7e-05
pfam00574182 pfam00574, CLP_protease, Clp protease 9e-04
cd07017171 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an 0.001
>gnl|CDD|30961 COG0616, SppA, Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|129789 TIGR00706, SppA_dom, signal peptide peptidase SppA, 36K type Back     alignment and domain information
>gnl|CDD|162004 TIGR00705, SppA_67K, signal peptide peptidase SppA, 67K type Back     alignment and domain information
>gnl|CDD|132933 cd07022, S49_Sppa_36K_type, Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>gnl|CDD|182860 PRK10949, PRK10949, protease 4; Provisional Back     alignment and domain information
>gnl|CDD|132930 cd07019, S49_SppA_1, Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>gnl|CDD|132929 cd07018, S49_SppA_67K_type, Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>gnl|CDD|132923 cd00394, Clp_protease_like, Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>gnl|CDD|132925 cd07014, S49_SppA, Signal peptide peptidase A Back     alignment and domain information
>gnl|CDD|162004 TIGR00705, SppA_67K, signal peptide peptidase SppA, 67K type Back     alignment and domain information
>gnl|CDD|31083 COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|132932 cd07021, Clp_protease_NfeD_like, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>gnl|CDD|132934 cd07023, S49_Sppa_N_C, Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>gnl|CDD|144805 pfam01343, Peptidase_S49, Peptidase family S49 Back     alignment and domain information
>gnl|CDD|183309 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|31233 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|132931 cd07020, Clp_protease_NfeD_1, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>gnl|CDD|132926 cd07015, Clp_protease_NfeD, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>gnl|CDD|132927 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|183589 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|132924 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|184720 PRK14512, PRK14512, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|110924 pfam01972, SDH_sah, Serine dehydrogenase proteinase Back     alignment and domain information
>gnl|CDD|144241 pfam00574, CLP_protease, Clp protease Back     alignment and domain information
>gnl|CDD|132928 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 293 putative protease IV transmembrane protein [Candidatus
TIGR00706224 SppA_dom signal peptide peptidase SppA, 36K type; Inter 100.0
PRK10949618 protease 4; Provisional 100.0
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K 100.0
TIGR00705614 SppA_67K signal peptide peptidase SppA, 67K type; Inter 100.0
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serin 100.0
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a serine 100.0
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Posttra 100.0
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K 100.0
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptide pep 100.0
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is an AT 99.97
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-depen 99.87
cd07021178 Clp_protease_NfeD_like Nodulation formation efficiency 99.87
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficiency D ( 99.85
cd07015172 Clp_protease_NfeD Nodulation formation efficiency D (Nf 99.78
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [Postt 99.74
pfam00574182 CLP_protease Clp protease. The Clp protease has an acti 99.68
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-depende 99.68
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteases [P 99.67
PRK12553204 ATP-dependent Clp protease proteolytic subunit; Reviewe 99.6
PRK00277197 clpP ATP-dependent Clp protease proteolytic subunit; Re 99.6
CHL00028201 clpP ATP-dependent Clp protease proteolytic subunit 99.59
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Reviewe 99.56
pfam01972286 SDH_sah Serine dehydrogenase proteinase. This family of 99.41
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 99.38
KOG0840275 consensus 99.26
PRK05869225 enoyl-CoA hydratase; Validated 99.19
PRK06495257 enoyl-CoA hydratase; Provisional 99.19
PRK08138260 enoyl-CoA hydratase; Provisional 99.19
PRK06688263 enoyl-CoA hydratase; Provisional 99.17
PRK09674257 enoyl-CoA hydratase-isomerase; Provisional 99.15
PRK07657261 enoyl-CoA hydratase; Provisional 99.13
PRK07511259 enoyl-CoA hydratase; Provisional 99.13
PRK07854243 enoyl-CoA hydratase; Provisional 99.13
PRK07830267 consensus 99.12
PRK06951254 consensus 99.11
PRK09076258 enoyl-CoA hydratase; Provisional 99.11
PRK07658257 enoyl-CoA hydratase; Provisional 99.1
PRK06494259 enoyl-CoA hydratase; Provisional 99.1
PRK05864269 enoyl-CoA hydratase; Provisional 99.09
PRK06144262 enoyl-CoA hydratase; Provisional 99.09
PRK06142271 enoyl-CoA hydratase; Provisional 99.09
PRK05995261 enoyl-CoA hydratase; Provisional 99.09
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Members o 99.09
PRK07938249 enoyl-CoA hydratase; Provisional 99.07
PRK07510266 consensus 99.07
PRK08139265 enoyl-CoA hydratase; Validated 99.06
PRK06210272 enoyl-CoA hydratase; Provisional 99.06
PRK07110257 polyketide biosynthesis enoyl-CoA hydratase; Validated 99.06
PRK09245266 enoyl-CoA hydratase; Provisional 99.06
PRK11730 715 fadB multifunctional fatty acid oxidation complex subun 99.06
PRK05674271 gamma-carboxygeranoyl-CoA hydratase; Validated 99.06
PRK06023248 enoyl-CoA hydratase; Provisional 99.05
PRK05862257 enoyl-CoA hydratase; Provisional 99.05
PRK06190258 enoyl-CoA hydratase; Provisional 99.05
PRK05980260 enoyl-CoA hydratase; Provisional 99.05
PRK03580262 carnitinyl-CoA dehydratase; Provisional 99.04
PRK06143260 enoyl-CoA hydratase; Provisional 99.04
PRK09120277 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 99.04
PRK11154 706 fadJ multifunctional fatty acid oxidation complex subun 99.04
PRK07629261 consensus 99.04
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 99.04
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydrata 99.03
PRK05870254 enoyl-CoA hydratase; Provisional 99.03
PRK07396273 naphthoate synthase; Validated 99.02
PRK05981266 enoyl-CoA hydratase; Provisional 99.02
PRK07260260 enoyl-CoA hydratase; Provisional 99.02
PRK06563255 enoyl-CoA hydratase; Provisional 99.01
PRK07509262 enoyl-CoA hydratase; Provisional 99.01
PRK08260293 enoyl-CoA hydratase; Provisional 99.01
PRK07799263 enoyl-CoA hydratase; Provisional 99.0
PRK08272308 enoyl-CoA hydratase; Provisional 99.0
PRK07327271 enoyl-CoA hydratase; Provisional 99.0
PRK08290284 enoyl-CoA hydratase; Provisional 99.0
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 98.99
PRK07468262 enoyl-CoA hydratase; Provisional 98.99
PRK06127269 enoyl-CoA hydratase; Provisional 98.99
PRK12478298 enoyl-CoA hydratase; Provisional 98.99
PRK08140262 enoyl-CoA hydratase; Provisional 98.96
PRK07659260 enoyl-CoA hydratase; Provisional 98.95
PRK08252254 enoyl-CoA hydratase; Provisional 98.95
PRK08259254 enoyl-CoA hydratase; Provisional 98.94
PRK08258270 enoyl-CoA hydratase; Provisional 98.93
PRK08321302 naphthoate synthase; Validated 98.92
PRK08150264 enoyl-CoA hydratase; Provisional 98.87
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydrata 98.87
PRK07827255 enoyl-CoA hydratase; Provisional 98.85
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid met 98.84
KOG1680290 consensus 98.84
pfam00378169 ECH Enoyl-CoA hydratase/isomerase family. This family c 98.74
PRK06213229 enoyl-CoA hydratase; Provisional 98.67
PRK06072240 enoyl-CoA hydratase; Provisional 98.66
PRK07112251 polyketide biosynthesis enoyl-CoA hydratase; Validated 98.65
TIGR00493192 clpP ATP-dependent Clp protease, proteolytic subunit Cl 98.36
TIGR02440 732 FadJ fatty oxidation complex, alpha subunit FadJ; Inter 97.81
KOG1681292 consensus 97.79
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 97.69
PRK05724318 acetyl-CoA carboxylase carboxyltransferase subunit alph 97.58
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase alpha s 97.5
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabol 97.46
TIGR02280259 PaaB1 phenylacetate degradation probable enoyl-CoA hydr 97.45
KOG1679291 consensus 97.15
PRK05654288 acetyl-CoA carboxylase subunit beta; Validated 96.88
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabo 96.81
, MenB or dihydroxynaphthoic acid synthetase), which is involved in the fifth step of the menaquinone biosynthesis pathway. Menaquinone (vitamin K2), is an essential quinone used in electron-transfer pathways serving as the major electron carrier during anaerobic growth. In the bacterium, the biosynthetic pathway in bacteria typically comprises 6-7 steps . Together with o-succinylbenzoate-CoA ligase (menE IPR010192 from INTERPRO),MenB takes 2-succinylbenzoate and converts it into 1,4-di-hydroxy-2-naphthoic acid (DHNA) , , , . The conversion of o-succinylbenzoate-CoA ligase to DHNA is mediated by the enzyme DHNA synthase, which is encoded by menB . The protein structure of naphthoate synthase has been expressed in Escherichia coli, purified and crystallized, and found to have fold characteristics of the crotonase family of enzymes, which is notable for the presence of several highly flexible regions around the active site. The C-terminal region of the protein may play a critical role both in completion of the binding pocket and in stabilisation of the hexamer, suggesting a link between oligomerization and catalytic activity . Included in this entry are two enzymes from Arabidopsis thaliana and one from Staphylococcus aureus, which are identified as putative enoyl-CoA hydratase/isomerases. These enzymes group with the naphthoate synthases when building a tree and when doing BLAST searches.; GO: 0008935 naphthoate synthase activity, 0009234 menaquinone biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01929">TIGR01929278 menB naphthoate synthase; InterPro: IPR010198 This entr 96.57
). It catalyzes the first step in the synthesis of long-chain fatty acids which involves the carboxylation of acetyl-CoA to malonyl-CoA. The acetyl-CoA carboxylase complex () is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase and two non-identical carboxyl transferase subunits (alpha and beta) in a 2:2 association . The reaction involves two steps: Biotin carrier protein + ATP + HCO_3^- -> Carboxybiotin carrier protein + ADP + P_i Carboxybiotin carrier protein + Acetyl-CoA -> Malonyl-CoA + Biotin carrier protein ; GO: 0003989 acetyl-CoA carboxylase activity, 0006633 fatty acid biosynthetic process, 0009317 acetyl-CoA carboxylase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00513">TIGR00513329 accA acetyl-CoA carboxylase, carboxyl transferase, alph 96.51
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabol 96.28
KOG0016266 consensus 96.0
KOG1682287 consensus 95.37
CHL00174305 accD acetyl-CoA carboxylase beta subunit; Reviewed 95.03
TIGR00515292 accD acetyl-CoA carboxylase, carboxyl transferase, beta 94.79
TIGR02437 716 FadB fatty oxidation complex, alpha subunit FadB; Inter 94.63
PRK10949 618 protease 4; Provisional 100.0
TIGR00705 614 SppA_67K signal peptide peptidase SppA, 67K type; Inter 100.0
PRK11778317 putative periplasmic protease; Provisional 100.0
pfam01343154 Peptidase_S49 Peptidase family S49. 100.0
PRK08788286 enoyl-CoA hydratase; Validated 98.12
TIGR02441 740 fa_ox_alpha_mit fatty acid oxidation complex, alpha sub 98.31
PRK05617356 enoyl-CoA hydratase; Provisional 98.19
PRK07189302 malonate decarboxylase subunit beta; Reviewed 97.4
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit. Mem 97.19
TIGR03222 548 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the presen 97.12
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrola 97.01
pfam00549128 Ligase_CoA CoA-ligase. This family includes the CoA lig 96.65
PRK08184 558 enoyl-CoA hydratase; Provisional 96.46
PTZ00187309 succinyl-CoA synthetase alpha subunit; Provisional 96.45
COG0074293 SucD Succinyl-CoA synthetase, alpha subunit [Energy pro 96.1
PRK05678289 succinyl-CoA synthetase subunit alpha; Validated 95.58
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis, out 95.26
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subunit. M 95.05
pfam06833234 MdcE Malonate decarboxylase gamma subunit (MdcE). This 94.69
pfam03572166 Peptidase_S41 Peptidase family S41. 94.28
COG3904245 Predicted periplasmic protein [Function unknown] 93.8
TIGR02717457 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP formi 92.86
pfam01039 487 Carboxyl_trans Carboxyl transferase domain. All of the 91.8
pfam08496154 Peptidase_S49_N Peptidase family S49 N-terminal. This d 95.55
PRK11186673 carboxy-terminal protease; Provisional 92.95
smart00245192 TSPc tail specific protease. tail specific protease 93.64
pfam01740106 STAS STAS domain. The STAS (after Sulphate Transporter 93.07
cd07560211 Peptidase_S41_CPP C-terminal processing peptidase; seri 92.91
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type; InterPro: IPR004635 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type; InterPro: IPR004634 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam00574 CLP_protease Clp protease Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>pfam01972 SDH_sah Serine dehydrogenase proteinase Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>KOG0840 consensus Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07830 consensus Back     alignment and domain information
>PRK06951 consensus Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07510 consensus Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK07629 consensus Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 naphthoate synthase; Validated Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>KOG1680 consensus Back     alignment and domain information
>pfam00378 ECH Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP; InterPro: IPR001907 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ; InterPro: IPR012802 Members of this family represent the alpha subunit of the multifunctional enzyme complex of the fatty acid degradation cycle, which plays a minor role in aerobic beta-oxidation of fatty acids Back     alignment and domain information
>KOG1681 consensus Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB; InterPro: IPR011968 This family of proteins are found within apparent operons for the degradation of phenylacetic acid Back     alignment and domain information
>KOG1679 consensus Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>TIGR01929 menB naphthoate synthase; InterPro: IPR010198 This entry represents an enzyme, naphthoate synthase Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit; InterPro: IPR001095 This entry contains the alpha subunit the acetyl coenzyme A carboxylase complex (Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>KOG0016 consensus Back     alignment and domain information
>KOG1682 consensus Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit; InterPro: IPR000438 Fatty acid synthesis involves a set of reactions, commencing with carboxylation of acetyl-CoA to malonyl-CoA Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB; InterPro: IPR012799 Members of this family represent the alpha subunit of the multifunctional enzyme complex of the fatty acid degradation cycle Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type; InterPro: IPR004634 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>PRK11778 putative periplasmic protease; Provisional Back     alignment and domain information
>pfam01343 Peptidase_S49 Peptidase family S49 Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial; InterPro: IPR012803 Members of this family represent the alpha subunit of the mitochondrial multifunctional fatty acid degradation enzyme complex Back     alignment and domain information
>PRK05617 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>pfam00549 Ligase_CoA CoA-ligase Back     alignment and domain information
>PRK08184 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>pfam06833 MdcE Malonate decarboxylase gamma subunit (MdcE) Back     alignment and domain information
>pfam03572 Peptidase_S41 Peptidase family S41 Back     alignment and domain information
>COG3904 Predicted periplasmic protein [Function unknown] Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain; InterPro: IPR014089 This group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which they have been characterised , , Back     alignment and domain information
>pfam01039 Carboxyl_trans Carboxyl transferase domain Back     alignment and domain information
>pfam08496 Peptidase_S49_N Peptidase family S49 N-terminal Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>smart00245 TSPc tail specific protease Back     alignment and domain information
>pfam01740 STAS STAS domain Back     alignment and domain information
>cd07560 Peptidase_S41_CPP C-terminal processing peptidase; serine protease family S41 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target293 putative protease IV transmembrane protein [Candidatus
3bf0_A593 Crystal Structure Of Escherichia Coli Signal Peptid 3e-30
3bez_A593 Crystal Structure Of Escherichia Coli Signal Peptid 5e-28
3bf0_A 593 Crystal Structure Of Escherichia Coli Signal Peptid 6e-16
3bez_A 593 Crystal Structure Of Escherichia Coli Signal Peptid 3e-15
>gi|163311063|pdb|3BF0|A Chain A, Crystal Structure Of Escherichia Coli Signal Peptide Peptidase (Sppa), Native Crystals Length = 593 Back     alignment and structure
 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 72/271 (26%), Positives = 123/271 (45%), Gaps = 14/271 (5%)

Query: 29  SHVEDNSPHVARIAIRGQIEDSQEL---------IERIERISRDDSATALIVSLSSPGGS 79
               D    +  +   G I D +E            +I     D    A+++ ++SPGGS
Sbjct: 294 KTPADTGDSIGVVFANGAIMDGEETQGNVGGDTTAAQIRDARLDPKVKAIVLRVNSPGGS 353

Query: 80  AYAGEAIFRAIQKVKN-RKPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQY 138
             A E I   +   +   KPV+  +  MAAS GY IS  +N IVA  ++L GSIG+    
Sbjct: 354 VTASEVIRAELAAARAAGKPVVVSMGGMAASGGYWISTPANYIVANPSTLTGSIGIFGVI 413

Query: 139 PYVKPFLDKLGVSIKSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRN 198
             V+  LD +GV    V +SP+    S    + P+A  MMQ  +++ Y  F+ LV+++R+
Sbjct: 414 TTVENSLDSIGVHTDGVSTSPLADV-SITRALPPEAQLMMQLSIENGYKRFITLVADARH 472

Query: 199 IPYDKTLVLSDGRIWTGAEAKKVGLIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNY 258
              ++   ++ G +WTG +AK  GL+D +G  ++       L        ++ +     +
Sbjct: 473 STPEQIDKIAQGHVWTGQDAKANGLVDSLGDFDDAVAKAAELAKV-KQWHLEYYVDEPTF 531

Query: 259 WFCDLKNLSISSLLEDTIPLMKQTKVQGLWA 289
           +   + N+S S  +   +P   Q  +    A
Sbjct: 532 FDKVMDNMSGS--VRAMLPDAFQAMLPAPLA 560


>gi|163311059|pdb|3BEZ|A Chain A, Crystal Structure Of Escherichia Coli Signal Peptide Peptidase (Sppa), Semet Crystals Length = 593 Back     alignment and structure
>gi|163311063|pdb|3BF0|A Chain A, Crystal Structure Of Escherichia Coli Signal Peptide Peptidase (Sppa), Native Crystals Length = 593 Back     alignment and structure
>gi|163311059|pdb|3BEZ|A Chain A, Crystal Structure Of Escherichia Coli Signal Peptide Peptidase (Sppa), Semet Crystals Length = 593 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target293 putative protease IV transmembrane protein [Candidatus
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, membr 1e-29
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, membr 4e-27
3bpp_A230 1510-N membrane protease; specific for A stomatin homol 1e-11
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; endopep 7e-07
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle structura 5e-06
1tg6_A277 Putative ATP-dependent CLP protease proteolytic subunit 1e-04
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hydrola 2e-04
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; serin 5e-04
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; structu 4e-07
2x58_A 727 Peroxisomal bifunctional enzyme; beta oxidation pathway 1e-05
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); oxid 2e-05
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 hete 3e-04
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; 3e-04
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seattle s 0.001
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural genom 0.003
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Length = 593 Back     alignment and structure
 Score =  125 bits (315), Expect = 1e-29
 Identities = 70/259 (27%), Positives = 123/259 (47%), Gaps = 8/259 (3%)

Query: 34  NSPHVARIAIRGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKV 93
           N   +     +G +        +I     D    A+++ ++SPGGS  A E I   +   
Sbjct: 309 NGAIMDGEETQGNV-GGDTTAAQIRDARLDPKVKAIVLRVNSPGGSVTASEVIRAELAAA 367

Query: 94  KNR-KPVITEVHEMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSI 152
           +   KPV+  +  MAAS GY IS  +N IVA  ++L GSIG+      V+  LD +GV  
Sbjct: 368 RAAGKPVVVSMGGMAASGGYWISTPANYIVANPSTLTGSIGIFGVITTVENSLDSIGVHT 427

Query: 153 KSVKSSPMKAEPSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRI 212
             V +SP+  + S    + P+A  MMQ  +++ Y  F+ LV+++R+   ++   ++ G +
Sbjct: 428 DGVSTSPLA-DVSITRALPPEAQLMMQLSIENGYKRFITLVADARHSTPEQIDKIAQGHV 486

Query: 213 WTGAEAKKVGLIDVVGGQEEVWQSLYAL-GVDQSIRKIKDWNPPKNYW--FCDLKNLSIS 269
           WTG +AK  GL+D +G  ++       L  V Q    ++ +     ++    D  + S+ 
Sbjct: 487 WTGQDAKANGLVDSLGDFDDAVAKAAELAKVKQ--WHLEYYVDEPTFFDKVMDNMSGSVR 544

Query: 270 SLLEDTIPLMKQTKVQGLW 288
           ++L D    M    +  + 
Sbjct: 545 AMLPDAFQAMLPAPLASVA 563


>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Length = 593 Back     alignment and structure
>3bpp_A 1510-N membrane protease; specific for A stomatin homolog, archaea, thermostable, catalytic DYAD, hydrolase; 2.30A {Pyrococcus horikoshii} PDB: 2deo_A Length = 230 Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 1yg8_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A Length = 193 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic subunit; mitochondrial CLPP, CLP/HSP 100, X-RAY crystallography, ATP- dependent protease; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Length = 277 Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Length = 218 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopeptidase, ATP-dependent protease, hydrolase; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Length = 208 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Length = 201 Back     alignment and structure
>2x58_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, lyase, isomerase, peroxisome; HET: ADP COA; 2.80A {Rattus norvegicus} Length = 727 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target293 putative protease IV transmembrane protein [Candidatus
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, membr 100.0
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, membr 100.0