254780748

254780748

integration host factor, beta subunit

GeneID in NCBI database:8209753Locus tag:CLIBASIA_03175
Protein GI in NCBI database:254780748Protein Accession:YP_003065161.1
Gene range:-(523817, 524119)Protein Length:100aa
Gene description:integration host factor, beta subunit
COG prediction:[L] Bacterial nucleoid DNA-binding protein
KEGG prediction:integration host factor, beta subunit; K05788 integration host factor subunit beta
SEED prediction:Integration host factor beta subunit
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA structural proteins, bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLKERLNSPDSTLSNS
ccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEccccccccccccEEEEccccEEEEEccHHHHHHHcccccHHccc
cEHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEEEEccEEEEccccccEEEEccEEEEEEEEcHHHHHHHcccHHHcccc
mikssligtiakknpklnyqDVEKIVNMLLEEMTQALANggrveirgfgSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLkerlnspdstlsns
mikssligtiakknpklnyqDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLAraplaqkvisveekmVPFFRagknlkerlnspdstlsns
MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVrkraarlaraplaQKVISVEEKMVPFFRAGKNLKERLNSPDSTLSNS
MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLK*************
MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLKER***********
MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLKERLN*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLKERLNSPDSTLSNS
MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLKERLNSPDSTLSNS
MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLKERLNSPDSTLSNS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target100 integration host factor, beta subunit [Candidatus Liber
254780496114 integration host factor subunit alpha [Candidatus 3e-06
>gi|254780496|ref|YP_003064909.1| integration host factor subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 114 Back     alignment
 Score = 41.6 bits (96), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 1  MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60
          + +S L+ +I+K+   L+ +D  + V  L  E+  +   G  ++I  F +F V+++ +R+
Sbjct: 5  ITRSDLVKSISKEFG-LSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRV 63

Query: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERL 90
           R     + + ++ + V  F+A   LK+R+
Sbjct: 64 GRNLQTNQEVKIDPRRVVVFKASSILKKRI 93

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target100 integration host factor, beta subunit [Candidatus Liber
315121911105 integration host factor, beta subunit [Candidatus Liber 1 1e-38
11063599794 integration host factor, beta subunit [Mesorhizobium sp 1 9e-24
30439232593 integration host factor, beta subunit [Ahrensia sp. R2A 1 2e-23
21797634096 integration host factor, beta subunit [Methylocella sil 1 2e-23
24084969592 integration host factor beta subunit [Bartonella graham 1 2e-23
11476657593 integration host factor beta subunit [Pelagibaca bermud 1 2e-23
18267983997 integration host factor, beta subunit [Beijerinckia ind 1 3e-23
25526355693 integration host factor, beta subunit [Thalassiobium sp 1 3e-23
16373457094 integration host factor subunit beta [Roseobacter litor 1 3e-23
5669570694 integration host factor subunit beta [Ruegeria pomeroyi 1 4e-23
>gi|315121911|ref|YP_004062400.1| integration host factor, beta subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 105 Back     alignment and organism information
 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/91 (86%), Positives = 89/91 (97%)

Query: 1  MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60
          MIKSSLI TIAKKNP++N+QDVEK+VN+LLEEMT+ALANGGRVEIRGFG+FSVRKR+ARL
Sbjct: 1  MIKSSLIYTIAKKNPQINHQDVEKMVNLLLEEMTKALANGGRVEIRGFGTFSVRKRSARL 60

Query: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERLN 91
          ARAPLAQKVISV+EKMVPFFR+GKNLKE LN
Sbjct: 61 ARAPLAQKVISVKEKMVPFFRSGKNLKECLN 91


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110635997|ref|YP_676205.1| integration host factor, beta subunit [Mesorhizobium sp. BNC1] Length = 94 Back     alignment and organism information
>gi|304392325|ref|ZP_07374266.1| integration host factor, beta subunit [Ahrensia sp. R2A130] Length = 93 Back     alignment and organism information
>gi|217976340|ref|YP_002360487.1| integration host factor, beta subunit [Methylocella silvestris BL2] Length = 96 Back     alignment and organism information
>gi|240849695|ref|YP_002971083.1| integration host factor beta subunit [Bartonella grahamii as4aup] Length = 92 Back     alignment and organism information
>gi|114766575|ref|ZP_01445531.1| integration host factor beta subunit [Pelagibaca bermudensis HTCC2601] Length = 93 Back     alignment and organism information
>gi|182679839|ref|YP_001833985.1| integration host factor, beta subunit [Beijerinckia indica subsp. indica ATCC 9039] Length = 97 Back     alignment and organism information
>gi|255263556|ref|ZP_05342898.1| integration host factor, beta subunit [Thalassiobium sp. R2A62] Length = 93 Back     alignment and organism information
>gi|163734570|ref|ZP_02142009.1| integration host factor subunit beta [Roseobacter litoralis Och 149] Length = 94 Back     alignment and organism information
>gi|56695706|ref|YP_166057.1| integration host factor subunit beta [Ruegeria pomeroyi DSS-3] Length = 94 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target100 integration host factor, beta subunit [Candidatus Liber
PRK0019994 PRK00199, ihfB, integration host factor subunit beta; R 3e-31
TIGR0098894 TIGR00988, hip, integration host factor, beta subunit 1e-24
smart0041190 smart00411, BHL, bacterial (prokaryotic) histone like d 4e-22
COG077694 COG0776, HimA, Bacterial nucleoid DNA-binding protein [ 6e-20
cd0059187 cd00591, HU_IHF, Integration host factor (IHF) and HU a 7e-19
PRK1066490 PRK10664, PRK10664, transcriptional regulator HU subuni 2e-10
PRK0028599 PRK00285, ihfA, integration host factor subunit alpha; 1e-09
TIGR0098796 TIGR00987, himA, integration host factor, alpha subunit 2e-08
PRK1075390 PRK10753, PRK10753, transcriptional regulator HU subuni 3e-06
pfam0021690 pfam00216, Bac_DNA_binding, Bacterial DNA-binding prote 4e-22
>gnl|CDD|178925 PRK00199, ihfB, integration host factor subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|130061 TIGR00988, hip, integration host factor, beta subunit Back     alignment and domain information
>gnl|CDD|128689 smart00411, BHL, bacterial (prokaryotic) histone like domain Back     alignment and domain information
>gnl|CDD|31119 COG0776, HimA, Bacterial nucleoid DNA-binding protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|29683 cd00591, HU_IHF, Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and higher-order nucleoprotein complex assembly Back     alignment and domain information
>gnl|CDD|170612 PRK10664, PRK10664, transcriptional regulator HU subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|178961 PRK00285, ihfA, integration host factor subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|130060 TIGR00987, himA, integration host factor, alpha subunit Back     alignment and domain information
>gnl|CDD|138142 PRK10753, PRK10753, transcriptional regulator HU subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|143973 pfam00216, Bac_DNA_binding, Bacterial DNA-binding protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 100 integration host factor, beta subunit [Candidatus Liber
PRK0019991 ihfB integration host factor subunit beta; Reviewed 99.94
PRK1066490 transcriptional regulator HU subunit beta; Provisional 99.94
PRK00285100 ihfA integration host factor subunit alpha; Reviewed 99.94
PRK1075390 transcriptional regulator HU subunit alpha; Provisional 99.94
COG077694 HimA Bacterial nucleoid DNA-binding protein [DNA replic 99.94
smart0041190 BHL bacterial (prokaryotic) histone like domain. 99.93
TIGR0098894 hip integration host factor, beta subunit; InterPro: IP 99.92
pfam0021690 Bac_DNA_binding Bacterial DNA-binding protein. 99.92
cd0059187 HU_IHF Integration host factor (IHF) and HU are small h 99.89
TIGR0098796 himA integration host factor, alpha subunit; InterPro: 99.82
TIGR01201198 HU_rel DNA-binding protein, putative; InterPro: IPR0059 97.9
pfam08006181 DUF1700 Protein of unknown function (DUF1700). This fam 92.36
>PRK00199 ihfB integration host factor subunit beta; Reviewed Back     alignment and domain information
>PRK10664 transcriptional regulator HU subunit beta; Provisional Back     alignment and domain information
>PRK00285 ihfA integration host factor subunit alpha; Reviewed Back     alignment and domain information
>PRK10753 transcriptional regulator HU subunit alpha; Provisional Back     alignment and domain information
>COG0776 HimA Bacterial nucleoid DNA-binding protein [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00411 BHL bacterial (prokaryotic) histone like domain Back     alignment and domain information
>TIGR00988 hip integration host factor, beta subunit; InterPro: IPR005685 Integration host factor (IHF) is a heterodimeric protein consisting of alpha (IPR005684 from INTERPRO) and beta subunits Back     alignment and domain information
>pfam00216 Bac_DNA_binding Bacterial DNA-binding protein Back     alignment and domain information
>cd00591 HU_IHF Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and higher-order nucleoprotein complex assembly Back     alignment and domain information
>TIGR00987 himA integration host factor, alpha subunit; InterPro: IPR005684 Integration host factor (IHF) is a heterodimeric protein consisting of alpha and beta (IPR005685 from INTERPRO) subunits Back     alignment and domain information
>TIGR01201 HU_rel DNA-binding protein, putative; InterPro: IPR005902 This family of proteins is related to, but longer than, DNA-binding protein HU Back     alignment and domain information
>pfam08006 DUF1700 Protein of unknown function (DUF1700) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target100 integration host factor, beta subunit [Candidatus Liber
1hue_A90 Histone-Like Protein Length = 90 1e-21
1ihf_B94 Integration Host FactorDNA COMPLEX Length = 94 1e-21
1ouz_B94 Crystal Structure Of A Mutant Ihf (Betae44a) Comple 2e-21
2o97_B90 Crystal Structure Of E. Coli Hu Heterodimer Length 2e-20
2iif_A204 Single Chain Integration Host Factor Mutant Protein 7e-19
3rhi_A93 Dna-Binding Protein Hu From Bacillus Anthracis Leng 1e-18
2iie_A204 Single Chain Integration Host Factor Protein (Scihf 2e-18
1p51_A94 Anabaena Hu-Dna Cocrystal Structure (Ahu6) Length = 3e-17
1mul_A90 Crystal Structure Of The E. Coli Hu Alpha2 Protein 5e-17
1ihf_A99 Integration Host FactorDNA COMPLEX Length = 99 8e-17
1b8z_A90 Hu From Thermotoga Maritima Length = 90 1e-14
1riy_A90 Hu Mutant V42i From Thermotoga Maritima Length = 90 2e-14
3c4i_A99 Crystal Structure Analysis Of N Terminal Region Con 5e-13
2np2_A108 Hbb-Dna Complex Length = 108 8e-13
1exe_A99 Solution Structure Of A Mutant Of Transcription Fac 8e-11
1wtu_A99 Transcription Factor 1, Nmr, Minimized Average Stru 2e-09
2iif_A204 Single Chain Integration Host Factor Mutant Protein 7e-11
2iie_A204 Single Chain Integration Host Factor Protein (Scihf 1e-10
gi|1311345|pdb|1HUE|A Chain A, Histone-Like Protein Length = 90 Back     alignment and structure
 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 1/91 (1%)

Query: 1  MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60
          M K+ LI  +A+    L+ +D  K V+ + + +T+AL  G +V++ GFG+F VR+RAAR 
Sbjct: 1  MNKTELINAVAE-TSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARK 59

Query: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERLN 91
           R P   + + +    VP F+ GK LK+ + 
Sbjct: 60 GRNPQTGEEMEIPASKVPAFKPGKALKDAVK 90


gi|1942276|pdb|1IHF|B Chain B, Integration Host FactorDNA COMPLEX Length = 94 Back     alignment and structure
>gi|34811460|pdb|1OUZ|B Chain B, Crystal Structure Of A Mutant Ihf (Betae44a) Complexed With A Variant H' Site (T44a) Length = 94 Back     alignment and structure
gi|134105079|pdb|2O97|B Chain B, Crystal Structure Of E. Coli Hu Heterodimer Length = 90 Back     alignment and structure
>gi|134104523|pdb|2IIF|A Chain A, Single Chain Integration Host Factor Mutant Protein (Scihf2- K45ae) In Complex With Dna Length = 204 Back     alignment and structure
>gi|329666305|pdb|3RHI|A Chain A, Dna-Binding Protein Hu From Bacillus Anthracis Length = 93 Back     alignment and structure
>gi|134104519|pdb|2IIE|A Chain A, Single Chain Integration Host Factor Protein (Scihf2) In Complex With Dna Length = 204 Back     alignment and structure
gi|31615985|pdb|1P51|A Chain A, Anabaena Hu-Dna Cocrystal Structure (Ahu6) Length = 94 Back     alignment and structure
gi|34810779|pdb|1MUL|A Chain A, Crystal Structure Of The E. Coli Hu Alpha2 Protein Length = 90 Back     alignment and structure
gi|1942275|pdb|1IHF|A Chain A, Integration Host FactorDNA COMPLEX Length = 99 Back     alignment and structure
gi|7245986|pdb|1B8Z|A Chain A, Hu From Thermotoga Maritima Length = 90 Back     alignment and structure
>gi|58176578|pdb|1RIY|A Chain A, Hu Mutant V42i From Thermotoga Maritima Length = 90 Back     alignment and structure
>gi|222447026|pdb|3C4I|A Chain A, Crystal Structure Analysis Of N Terminal Region Containing The Dimerization Domain And Dna Binding Domain Of Hu Protein(Histone Like Protein-Dna Binding) From Mycobacterium Tuberculosis [h37rv] Length = 99 Back     alignment and structure
gi|134104949|pdb|2NP2|A Chain A, Hbb-Dna Complex Length = 108 Back     alignment and structure
>gi|11514467|pdb|1EXE|A Chain A, Solution Structure Of A Mutant Of Transcription Factor 1. Length = 99 Back     alignment and structure
gi|1942238|pdb|1WTU|A Chain A, Transcription Factor 1, Nmr, Minimized Average Structure Length = 99 Back     alignment and structure
>gi|134104523|pdb|2IIF|A Chain A, Single Chain Integration Host Factor Mutant Protein (Scihf2- K45ae) In Complex With Dna Length = 204 Back     alignment and structure
>gi|134104519|pdb|2IIE|A Chain A, Single Chain Integration Host Factor Protein (Scihf2) In Complex With Dna Length = 204 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target100 integration host factor, beta subunit [Candidatus Liber
1owf_B94 IHF-beta, integration HOST factor beta-subunit; protein 2e-21
1exe_A99 Transcription factor 1; beta ribbon ARMS, DNA-binding, 2e-18
1p71_A94 DNA-binding protein HU; protein-DNA complex, DNA bendin 2e-18
3c4i_A99 DNA-binding protein HU homolog; dimerization by four he 9e-18
1hue_A90 HU protein; DNA-binding; NMR {Geobacillus stearothermop 1e-17
1owf_A99 IHF-alpha, integration HOST factor alpha-subunit; prote 1e-17
1mul_A90 NS2, HU-2, DNA binding protein HU-alpha; histone-like; 2e-17
2o97_B90 NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DN 3e-15
2np2_A108 HBB; protein-DNA complex, DNA-binding protein, DNA-bend 4e-15
1b8z_A90 Protein (histonelike protein HU); thermostable DNA bind 3e-14
2iie_A204 Integration HOST factor; DNA kinking, bending, U-turn, 5e-14
2iie_A204 Integration HOST factor; DNA kinking, bending, U-turn, 6e-10
>1owf_B IHF-beta, integration HOST factor beta-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} SCOP: a.55.1.1 PDB: 1ouz_B 2ht0_B 1ihf_B 1owg_B Length = 94 Back     alignment and structure
 Score = 95.9 bits (239), Expect = 2e-21
 Identities = 39/91 (42%), Positives = 51/91 (56%)

Query: 1  MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60
          M KS LI  +A +   +  + VE  V  +LE M   LA G R+ IRGFGSFS+  RA R 
Sbjct: 1  MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGSFSLHYRAPRT 60

Query: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERLN 91
           R P     + +E K VP F+ GK L++R N
Sbjct: 61 GRNPKTGDKVELEGKYVPHFKPGKELRDRAN 91


>1exe_A Transcription factor 1; beta ribbon ARMS, DNA-binding, DNA-bending protein; NMR {Bacillus phage SPO1} SCOP: a.55.1.1 PDB: 1wtu_A Length = 99 Back     alignment and structure
>1p71_A DNA-binding protein HU; protein-DNA complex, DNA bending, DNA binding protein/DNA complex; 1.90A {Anabaena SP} SCOP: a.55.1.1 PDB: 1p51_A 1p78_A Length = 94 Back     alignment and structure
>3c4i_A DNA-binding protein HU homolog; dimerization by four helix bundle interaction, DNA condensation; 2.04A {Mycobacterium tuberculosis} Length = 99 Back     alignment and structure
>1hue_A HU protein; DNA-binding; NMR {Geobacillus stearothermophilus} SCOP: a.55.1.1 PDB: 1huu_A Length = 90 Back     alignment and structure
>1owf_A IHF-alpha, integration HOST factor alpha-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} SCOP: a.55.1.1 PDB: 1ouz_A 1ihf_A 1owg_A 2ht0_A Length = 99 Back     alignment and structure
>1mul_A NS2, HU-2, DNA binding protein HU-alpha; histone-like; HET: DNA; 2.30A {Escherichia coli} SCOP: a.55.1.1 PDB: 2o97_A Length = 90 Back     alignment and structure
>2o97_B NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DNA structure, DNA supercoiling, E. coli; 2.45A {Escherichia coli} SCOP: a.55.1.1 Length = 90 Back     alignment and structure
>2np2_A HBB; protein-DNA complex, DNA-binding protein, DNA-bending protein, dnabii family, HU/IHF family, DNA binding protein/DNA complex; 3.02A {Borrelia burgdorferi} Length = 108 Back     alignment and structure
>1b8z_A Protein (histonelike protein HU); thermostable DNA binding protein; 1.60A {Thermotoga maritima} SCOP: a.55.1.1 PDB: 1riy_A Length = 90 Back     alignment and structure
>2iie_A Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Length = 204 Back     alignment and structure
>2iie_A Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Length = 204 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target100 integration host factor, beta subunit [Candidatus Liber
1owf_B94 IHF-beta, integration HOST factor beta-subunit; protein 99.93
1p71_A94 DNA-binding protein HU; protein-DNA complex, DNA bendin 99.93
1owf_A99 IHF-alpha, integration HOST factor alpha-subunit; prote 99.93
3c4i_A99 DNA-binding protein HU homolog; dimerization by four he 99.93
2o97_B90 NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DN 99.92
2iie_A204 Integration HOST factor; DNA kinking, bending, U-turn, 99.92
2np2_A108 HBB; protein-DNA complex, DNA-binding protein, DNA-bend 99.91
1mul_A90 NS2, HU-2, DNA binding protein HU-alpha; histone-like; 99.91
1exe_A99 Transcription factor 1; beta ribbon ARMS, DNA-binding, 99.91
1hue_A90 HU protein; DNA-binding; NMR {Geobacillus stearothermop 99.91
1b8z_A90 Protein (histonelike protein HU); thermostable DNA bind 99.91
2iie_A204 Integration HOST factor; DNA kinking, bending, U-turn, 99.61
>1owf_B IHF-beta, integration HOST factor beta-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} SCOP: a.55.1.1 PDB: 1ouz_B 2ht0_B 1ihf_B 1owg_B Back     alignment and structure
Probab=99.93  E-value=3.1e-26  Score=186.81  Aligned_cols=93  Identities=42%  Similarity=0.669  Sum_probs=90.7

Q ss_pred             CCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCEECCCCCCEEEECCCCEEEE
Q ss_conf             98899999999973899989999999999999999986498512034578886214654102588988899468734676
Q gi|254780748|r    1 MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFF   80 (100)
Q Consensus         1 MtK~eli~~ia~~~~~ls~~~~~~~vd~~~~~i~~~L~~~~~V~i~gfGtF~~~~~~~r~~rNP~Tge~i~i~~~~~v~F   80 (100)
                      |||+|||+.||.+++++++++++.++|+|++.|.++|.+|++|+|+|||+|+++.+++|.||||+|||.++|||+++|+|
T Consensus         1 MtK~eli~~ia~~~~~ls~~~~~~~v~~~~~~i~~~L~~~~~V~i~gfG~F~~~~~~~R~~rNPkTge~i~ip~k~~v~F   80 (94)
T 1owf_B            1 MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHF   80 (94)
T ss_dssp             CBHHHHHHHHHHHCTTSCHHHHHHHHHHHHHHHHHHHHTTCCEEETTTEEEEEEEECCEEEECTTTCCEEEECCEEEEEE
T ss_pred             CCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCEEEEEEEEECCCEEECCCCCCEEEECCCCCEEE
T ss_conf             97899999999867999999999999999999999997699599444089999983670137839998898648631898


Q ss_pred             CCCHHHHHHHCCC
Q ss_conf             2698999970786
Q gi|254780748|r   81 RAGKNLKERLNSP   93 (100)
Q Consensus        81 k~sk~lk~~iN~~   93 (100)
                      +||+.|+++||..
T Consensus        81 k~sk~lk~~vN~~   93 (94)
T 1owf_B           81 KPGKELRDRANIY   93 (94)
T ss_dssp             EECHHHHHHHCCC
T ss_pred             ECCHHHHHHHCCC
T ss_conf             1798999987559



>1p71_A DNA-binding protein HU; protein-DNA complex, DNA bending, DNA binding protein/DNA complex; 1.90A {Anabaena SP} SCOP: a.55.1.1 PDB: 1p51_A 1p78_A Back     alignment and structure
>1owf_A IHF-alpha, integration HOST factor alpha-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} SCOP: a.55.1.1 PDB: 1ouz_A 1ihf_A 1owg_A 2ht0_A Back     alignment and structure
>3c4i_A DNA-binding protein HU homolog; dimerization by four helix bundle interaction, DNA condensation; 2.04A {Mycobacterium tuberculosis} Back     alignment and structure
>2o97_B NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DNA structure, DNA supercoiling, E. coli; 2.45A {Escherichia coli} SCOP: a.55.1.1 Back     alignment and structure
>2iie_A Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Back     alignment and structure
>2np2_A HBB; protein-DNA complex, DNA-binding protein, DNA-bending protein, dnabii family, HU/IHF family, DNA binding protein/DNA complex; 3.02A {Borrelia burgdorferi} Back     alignment and structure
>1mul_A NS2, HU-2, DNA binding protein HU-alpha; histone-like; HET: DNA; 2.30A {Escherichia coli} SCOP: a.55.1.1 PDB: 2o97_A Back     alignment and structure
>1exe_A Transcription factor 1; beta ribbon ARMS, DNA-binding, DNA-bending protein; NMR {Bacillus phage SPO1} SCOP: a.55.1.1 PDB: 1wtu_A Back     alignment and structure
>1hue_A HU protein; DNA-binding; NMR {Geobacillus stearothermophilus} SCOP: a.55.1.1 PDB: 1huu_A Back     alignment and structure
>1b8z_A Protein (histonelike protein HU); thermostable DNA binding protein; 1.60A {Thermotoga maritima} SCOP: a.55.1.1 PDB: 1riy_A Back     alignment and structure
>2iie_A Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 100 integration host factor, beta subunit [Candidatus Liber
d1owfb_94 a.55.1.1 (B:) Integration host factor beta subunit (IHF 3e-19
d1p71a_94 a.55.1.1 (A:) HU protein {Anabaena sp. [TaxId: 1167]} L 8e-17
d1huua_90 a.55.1.1 (A:) HU protein {Bacillus stearothermophilus [ 1e-16
d1mula_90 a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562] 3e-16
d1owfa_96 a.55.1.1 (A:) Integration host factor alpha subunit (IH 3e-16
d2o97b190 a.55.1.1 (B:1-90) HU protein {Escherichia coli, beta-is 5e-16
d1b8za_90 a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2 2e-15
d1exea_99 a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophag 3e-15
>d1owfb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: IHF-like DNA-binding proteins
superfamily: IHF-like DNA-binding proteins
family: Prokaryotic DNA-bending protein
domain: Integration host factor beta subunit (IHFB)
species: Escherichia coli [TaxId: 562]
 Score = 87.2 bits (216), Expect = 3e-19
 Identities = 39/91 (42%), Positives = 51/91 (56%)

Query: 1  MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60
          M KS LI  +A +   +  + VE  V  +LE M   LA G R+ IRGFGSFS+  RA R 
Sbjct: 1  MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGSFSLHYRAPRT 60

Query: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERLN 91
           R P     + +E K VP F+ GK L++R N
Sbjct: 61 GRNPKTGDKVELEGKYVPHFKPGKELRDRAN 91


>d1p71a_ a.55.1.1 (A:) HU protein {Anabaena sp. [TaxId: 1167]} Length = 94 Back     information, alignment and structure
>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus [TaxId: 1422]} Length = 90 Back     information, alignment and structure
>d1mula_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]} Length = 90 Back     information, alignment and structure
>d1owfa_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]} Length = 96 Back     information, alignment and structure
>d2o97b1 a.55.1.1 (B:1-90) HU protein {Escherichia coli, beta-isoform [TaxId: 562]} Length = 90 Back     information, alignment and structure
>d1b8za_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]} Length = 90 Back     information, alignment and structure
>d1exea_ a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 10685]} Length = 99 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target100 integration host factor, beta subunit [Candidatus Liber
d1p71a_94 HU protein {Anabaena sp. [TaxId: 1167]} 99.93
d1owfb_94 Integration host factor beta subunit (IHFB) {Escherichi 99.93
d1owfa_96 Integration host factor alpha subunit (IHFA) {Escherich 99.93
d2o97b190 HU protein {Escherichia coli, beta-isoform [TaxId: 562] 99.92
d1mula_90 HU protein {Escherichia coli [TaxId: 562]} 99.91
d1exea_99 Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 99.91
d1b8za_90 HU protein {Thermotoga maritima [TaxId: 2336]} 99.91
d1huua_90 HU protein {Bacillus stearothermophilus [TaxId: 1422]} 99.9
>d1p71a_ a.55.1.1 (A:) HU protein {Anabaena sp. [TaxId: 1167]} Back     information, alignment and structure
class: All alpha proteins
fold: IHF-like DNA-binding proteins
superfamily: IHF-like DNA-binding proteins
family: Prokaryotic DNA-bending protein
domain: HU protein
species: Anabaena sp. [TaxId: 1167]
Probab=99.93  E-value=1.9e-26  Score=186.66  Aligned_cols=94  Identities=31%  Similarity=0.592  Sum_probs=91.8

Q ss_pred             CCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCEECCCCCCEEEECCCCEEEE
Q ss_conf             98899999999973899989999999999999999986498512034578886214654102588988899468734676
Q gi|254780748|r    1 MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFF   80 (100)
Q Consensus         1 MtK~eli~~ia~~~~~ls~~~~~~~vd~~~~~i~~~L~~~~~V~i~gfGtF~~~~~~~r~~rNP~Tge~i~i~~~~~v~F   80 (100)
                      |||+|||+.||+++ ++++++++.++|+|++.|.++|..|++|+|+|||+|+++.+++|.||||+|||.+.||++++|+|
T Consensus         1 M~K~eli~~ia~~~-~ls~~~~~~~v~~~~~~i~~~L~~~~~V~l~~fG~F~~~~~~~R~grNP~Tge~i~ip~k~~v~F   79 (94)
T d1p71a_           1 MNKGELVDAVAEKA-SVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKMEIPATRVPAF   79 (94)
T ss_dssp             CBHHHHHHHHHHHH-TCCHHHHHHHHHHHHHHHHHHHHTTCCEEETTTEEEEEEEECCEEEECTTTCCEEEECCEEEEEE
T ss_pred             CCHHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHHHCCCEEEEECEEEEEEEECCCCEEECCCCCCEEEECCCCEEEE
T ss_conf             97899999999855-96999999999999999999984599799934378988823663048899998898628720899


Q ss_pred             CCCHHHHHHHCCCCC
Q ss_conf             269899997078610
Q gi|254780748|r   81 RAGKNLKERLNSPDS   95 (100)
Q Consensus        81 k~sk~lk~~iN~~~~   95 (100)
                      +||+.|++.||++.+
T Consensus        80 k~sk~Lk~~vN~~ka   94 (94)
T d1p71a_          80 SAGKLFREKVAPPKA   94 (94)
T ss_dssp             EECHHHHHHHSCCCC
T ss_pred             ECCHHHHHHHCCCCC
T ss_conf             559999997677899



>d1owfb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1owfa_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o97b1 a.55.1.1 (B:1-90) HU protein {Escherichia coli, beta-isoform [TaxId: 562]} Back     information, alignment and structure
>d1mula_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1exea_ a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 10685]} Back     information, alignment and structure
>d1b8za_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 100 integration host factor, beta subunit [Candidatus
1owf_B_94 (B:) IHF-beta, integration HOST factor beta-subuni 2e-19
1p71_A_94 (A:) DNA-binding protein HU; protein-DNA complex, 9e-18
2o97_B_90 (B:) NS1, HU-1, DNA-binding protein HU-beta; heter 2e-17
1b8z_A_90 (A:) Protein (histonelike protein HU); thermostabl 4e-17
3c4i_A_99 (A:) DNA-binding protein HU homolog; dimerization 8e-17
1exe_A_99 (A:) Transcription factor 1; beta ribbon ARMS, DNA 1e-16
1hue_A_90 (A:) HU protein; DNA-binding; NMR {Geobacillus ste 2e-16
1mul_A_90 (A:) NS2, HU-2, DNA binding protein HU-alpha; hist 2e-16
2iie_A_204 (A:) Integration HOST factor; DNA kinking, bending 7e-10
2iie_A_204 (A:) Integration HOST factor; DNA kinking, bending 2e-07
1owf_A_42-9958 (A:42-99) IHF-alpha, integration HOST factor alpha 9e-13
2np2_A_53-10856 (A:53-108) HBB; protein-DNA complex, DNA-binding p 7e-12
>1owf_B (B:) IHF-beta, integration HOST factor beta-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli}Length = 94 Back     alignment and structure
 Score = 89.1 bits (221), Expect = 2e-19
 Identities = 39/92 (42%), Positives = 51/92 (55%)

Query: 1  MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60
          M KS LI  +A +   +  + VE  V  +LE M   LA G R+ IRGFGSFS+  RA R 
Sbjct: 1  MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGSFSLHYRAPRT 60

Query: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERLNS 92
           R P     + +E K VP F+ GK L++R N 
Sbjct: 61 GRNPKTGDKVELEGKYVPHFKPGKELRDRANI 92


>1p71_A (A:) DNA-binding protein HU; protein-DNA complex, DNA bending, DNA binding protein/DNA complex; 1.90A {Anabaena SP}Length = 94 Back     alignment and structure
>2o97_B (B:) NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DNA structure, DNA supercoiling, E. coli; 2.45A {Escherichia coli}Length = 90 Back     alignment and structure
>1b8z_A (A:) Protein (histonelike protein HU); thermostable DNA binding protein; 1.60A {Thermotoga maritima}Length = 90 Back     alignment and structure
>3c4i_A (A:) DNA-binding protein HU homolog; dimerization by four helix bundle interaction, DNA condensation; 2.04A {Mycobacterium tuberculosis}Length = 99 Back     alignment and structure
>1exe_A (A:) Transcription factor 1; beta ribbon ARMS, DNA-binding, DNA-bending protein; NMR {Bacillus phage SPO1}Length = 99 Back     alignment and structure
>1hue_A (A:) HU protein; DNA-binding; NMR {Geobacillus stearothermophilus}Length = 90 Back     alignment and structure
>1mul_A (A:) NS2, HU-2, DNA binding protein HU-alpha; histone-like; HET: DNA; 2.30A {Escherichia coli}Length = 90 Back     alignment and structure
>2iie_A (A:) Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A*Length = 204 Back     alignment and structure
>2iie_A (A:) Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A*Length = 204 Back     alignment and structure
>1owf_A (A:42-99) IHF-alpha, integration HOST factor alpha-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli}Length = 58 Back     alignment and structure
>2np2_A (A:53-108) HBB; protein-DNA complex, DNA-binding protein, DNA-bending protein, dnabii family, HU/IHF family, DNA binding protein/DNA complex; 3.02A {Borrelia burgdorferi}Length = 56 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target100 integration host factor, beta subunit [Candidatus Liber
1p71_A_94 DNA-binding protein HU; protein-DNA complex, DNA b 99.92
1owf_B_94 IHF-beta, integration HOST factor beta-subunit; pr 99.92
3c4i_A_99 DNA-binding protein HU homolog; dimerization by fo 99.91
2o97_B_90 NS1, HU-1, DNA-binding protein HU-beta; heterodime 99.91
1mul_A_90 NS2, HU-2, DNA binding protein HU-alpha; histone-l 99.9
1b8z_A_90 Protein (histonelike protein HU); thermostable DNA 99.9
1hue_A_90 HU protein; DNA-binding; NMR {Geobacillus stearoth 99.88
1exe_A_99 Transcription factor 1; beta ribbon ARMS, DNA-bind 99.88
2iie_A_204 Integration HOST factor; DNA kinking, bending, U-t 99.87
2iie_A_204 Integration HOST factor; DNA kinking, bending, U-t 99.67
1owf_A_42-9958 IHF-alpha, integration HOST factor alpha-subunit; 99.54
2np2_A_53-10856 HBB; protein-DNA complex, DNA-binding protein, DNA 99.5
>1p71_A (A:) DNA-binding protein HU; protein-DNA complex, DNA bending, DNA binding protein/DNA complex; 1.90A {Anabaena SP} Back     alignment and structure
Probab=99.92  E-value=6.6e-25  Score=179.38  Aligned_cols=94  Identities=31%  Similarity=0.592  Sum_probs=91.5

Q ss_pred             CCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCEECCCCCCEEEECCCCEEEE
Q ss_conf             98899999999973899989999999999999999986498512034578886214654102588988899468734676
Q gi|254780748|r    1 MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFF   80 (100)
Q Consensus         1 MtK~eli~~ia~~~~~ls~~~~~~~vd~~~~~i~~~L~~~~~V~i~gfGtF~~~~~~~r~~rNP~Tge~i~i~~~~~v~F   80 (100)
                      |||+|||+.||+++ ++++++++.++|+|++.|.++|.+|+.|+|+|||+|+++.+++|.|+||+|||.+.||++++|+|
T Consensus         1 MtK~eli~~ia~~~-~ls~~~v~~~i~~~~~~i~~~L~~~~~V~l~~fG~F~v~~~~~r~~~Np~Tge~i~i~~~~~v~F   79 (94)
T 1p71_A            1 MNKGELVDAVAEKA-SVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKMEIPATRVPAF   79 (94)
T ss_dssp             CBHHHHHHHHHHHH-TCCHHHHHHHHHHHHHHHHHHHHTTCCEEETTTEEEEEEEECCEEEECTTTCCEEEECCEEEEEE
T ss_pred             CCHHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHHHCCCCCEECCEEEEEEEEECCCEEECCCCCCEEEECCCCCEEE
T ss_conf             98899999999845-97999999999999999999986488605035269999983672328979997899648740899


Q ss_pred             CCCHHHHHHHCCCCC
Q ss_conf             269899997078610
Q gi|254780748|r   81 RAGKNLKERLNSPDS   95 (100)
Q Consensus        81 k~sk~lk~~iN~~~~   95 (100)
                      +||+.|+++||+..+
T Consensus        80 kpsk~lk~~in~~~a   94 (94)
T 1p71_A           80 SAGKLFREKVAPPKA   94 (94)
T ss_dssp             EECHHHHHHHSCCCC
T ss_pred             ECCHHHHHHHCCCCC
T ss_conf             549899997577899



>1owf_B (B:) IHF-beta, integration HOST factor beta-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} Back     alignment and structure
>3c4i_A (A:) DNA-binding protein HU homolog; dimerization by four helix bundle interaction, DNA condensation; 2.04A {Mycobacterium tuberculosis} Back     alignment and structure
>2o97_B (B:) NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DNA structure, DNA supercoiling, E. coli; 2.45A {Escherichia coli} Back     alignment and structure
>1mul_A (A:) NS2, HU-2, DNA binding protein HU-alpha; histone-like; HET: DNA; 2.30A {Escherichia coli} Back     alignment and structure
>1b8z_A (A:) Protein (histonelike protein HU); thermostable DNA binding protein; 1.60A {Thermotoga maritima} Back     alignment and structure
>1hue_A (A:) HU protein; DNA-binding; NMR {Geobacillus stearothermophilus} Back     alignment and structure
>1exe_A (A:) Transcription factor 1; beta ribbon ARMS, DNA-binding, DNA-bending protein; NMR {Bacillus phage SPO1} Back     alignment and structure
>2iie_A (A:) Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Back     alignment and structure
>2iie_A (A:) Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Back     alignment and structure
>1owf_A (A:42-99) IHF-alpha, integration HOST factor alpha-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} Back     alignment and structure
>2np2_A (A:53-108) HBB; protein-DNA complex, DNA-binding protein, DNA-bending protein, dnabii family, HU/IHF family, DNA binding protein/DNA complex; 3.02A {Borrelia burgdorferi} Back     alignment and structure