254780750

254780750

DNA mismatch repair protein

GeneID in NCBI database:8209755Locus tag:CLIBASIA_03185
Protein GI in NCBI database:254780750Protein Accession:YP_003065163.1
Gene range:-(520299, 523061)Protein Length:920aa
Gene description:DNA mismatch repair protein
COG prediction:[L] Mismatch repair ATPase (MutS family)
KEGG prediction:mutS; DNA mismatch repair protein; K03555 DNA mismatch repair protein MutS
SEED prediction:DNA mismatch repair protein MutS
Pathway involved in KEGG:Mismatch repair [PATH:las03430]
Subsystem involved in SEED:DNA repair system including RecA, MutS and a hypothetical protein;
DNA repair, bacterial MutL-MutS system
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920
MTKEFSSPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTALKTLYAVKAWTLEKYSTDEDSEPLSSKQEN
cccccccccccccccccccccHHHccHHHHHHHHHHHHcccEEEEEEEccEEEEcHHHHHHHHHHHcEEEEccccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHcccccccEEEEEEEEEcccEEEccHHcccccccEEEEEEEcccEEEEEEEEccccEEEEEcccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEccccEEEEcHHHHHccccHHcccccccccHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEcHHHHHHccccccccccEEEEEEccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccEEEEEcccHHHHHHHcccccccEEEEEEEEcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHccccEEEEEEEEEEccccEEEEEEEEEccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccc
cccEHccHHHHccccccccccHHHccHHHHHHHHHHHHccHHEEEEccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEcccccHHccccccccEEEEEEEEEccccccHHHHccHHHHHHHHHHHccccccEEEEEEEccccEEEEcccHHHHHHHHHHcccHHHcccccccHHHHHHcHHHHccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEcccccEEEEcHHHHHHccHHccccccccccHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEEcccEEcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEEEEEEccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEccccHHHHHHHHHHcccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccEEccHcHEEEEccccHHcccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccEEEEEEEEEccccEEEEEEcccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHcccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccccc
mtkefsspqklysEQIDLeenlksstPMMRQYIEIksinpdslvfyrmgdfyelfFDDALLASRCLGITltkrgkhlgkdipmcgvpvhTANHYIQKLIKIGHRIAICEQIESPleakkrgnkslvrrnvvrlvtpgtltedqllsptdsnYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNvavaqpnvffdhsisesriadyynittvdtfgsfSQVEKTAAAAAISYIKKTqmvnkptigyperediqsTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAEriaspltdstkintRLDSINffiqnpilinpiqkilksspdvprslsrlkigrgepkdiaVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMlsddlptfkrdggflrdgadasldetRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLeskdrfihrqtmsnltrftTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQnycrpiidnstnfivkdgrhpivektlkqqsskpfiandcdlscpndknsgklwlltgpnmggkstfLRQNALIVIMAQMgsyvpasyahiGIVDKLFSrvgsadnlasgRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHnatlqvsdsnegiIFLHKvipgiadhsygiqvgklaglpntviSRAYDILKTFEKLYHHNqkdmrlyypeiqtkesknnlsknDKLFVEKIKclnldemsplTALKTLYAVKAWTlekystdedseplsskqen
mtkefsspqklyseqidleenlksSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPleakkrgnkslvrrnvvrlvtpgtltedqllsptdsNYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRtlsgsreqslLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRslsrlkigrgepkdiavirdGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGadasldetrslrdqsKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLEskdrfihrqtmsnltrftTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTlkqqsskpfiandcdlscpNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATlqvsdsnegIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTkesknnlskndKLFVEKIKClnldemsplTALKTLYAVKAWTLEKystdedseplsskqen
MTKEFSSPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETkiknlkikhnnnlGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSAllielesfeilsNAIIEQSESLDNASQViaiidisialailaKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTALKTLYAVKAWTLEKYSTDEDSEPLSSKQEN
***************************MMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDIL*************************************VEKIKCLNLDEMSPLTALKTLYAV***********************
***********YSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTALKTLYAVKAWTLEKY***************
MTKEFSSPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKL*************************KNDKLFVEKIKCLNLDEMSPLTALKTLYAVKAWTLE*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKEFSSPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTALKTLYAVKAWTLEKYSTDEDSEPLSSKQEN
MTKEFSSPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTALKTLYAVKAWTLEKYSTDEDSEPLSSKQEN
MTKEFSSPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTALKTLYAVKAWTLEKYSTDEDSEPLSSKQEN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target920 DNA mismatch repair protein [Candidatus Liberibacter as
315121913912 DNA mismatch repair protein [Candidatus Liberibacter so 1 0.0
86356045908 DNA mismatch repair protein [Rhizobium etli CFN 42] Len 1 0.0
44888231904 RecName: Full=DNA mismatch repair protein mutS Length = 1 0.0
241202801908 DNA mismatch repair protein MutS [Rhizobium leguminosar 1 0.0
159184268883 DNA mismatch repair protein [Agrobacterium tumefaciens 1 0.0
190890059908 DNA mismatch repair protein [Rhizobium etli CIAT 652] L 1 0.0
325291779904 DNA mismatch repair protein MutS [Agrobacterium sp. H13 1 0.0
209547644880 DNA mismatch repair protein MutS [Rhizobium leguminosar 1 0.0
116250175908 DNA mismatch repair protein MutS [Rhizobium leguminosar 1 0.0
222147340883 DNA mismatch repair protein MutS [Agrobacterium vitis S 1 0.0
>gi|315121913|ref|YP_004062402.1| DNA mismatch repair protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 912 Back     alignment and organism information
 Score = 1525 bits (3949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/905 (81%), Positives = 823/905 (90%), Gaps = 3/905 (0%)

Query: 1   MTKEFSSPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDAL 60
           MTKEFSS Q+   E ID+E++LKSSTPMMRQYIEIKSINPDSL+FYRMGDFYELFF+DA+
Sbjct: 1   MTKEFSSQQESCLENIDIEKDLKSSTPMMRQYIEIKSINPDSLLFYRMGDFYELFFEDAI 60

Query: 61  LASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKR 120
           +ASRCLGITLTKRGKHLGKDIPMCGVPVHT+NHYIQKLIKIGHRIA+CEQIE+PLEAK+R
Sbjct: 61  IASRCLGITLTKRGKHLGKDIPMCGVPVHTSNHYIQKLIKIGHRIALCEQIETPLEAKQR 120

Query: 121 GNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTS 180
             KSLVRRNVVRLVTPGT+TEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTG+FKIS S
Sbjct: 121 DKKSLVRRNVVRLVTPGTITEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGVFKISKS 180

Query: 181 NHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADY 240
           N +RLISDIMRIDPRE+IFSE+EL ++EYKSLFETLGN+++ QP VFFD++++E RI DY
Sbjct: 181 NRNRLISDIMRIDPREVIFSEEELLNSEYKSLFETLGNISIPQPCVFFDNAVAEKRIVDY 240

Query: 241 YNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNL 300
           Y ITT DTFGSFSQ EKTAAAAAISYIKKTQ+++KPTIGYPEREDI+S LFIDSAARSNL
Sbjct: 241 YGITTTDTFGSFSQAEKTAAAAAISYIKKTQLLDKPTIGYPEREDIKSILFIDSAARSNL 300

Query: 301 EILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPIL 360
           EIL TLSGSRE SLLK IDY++TG GGRLFAERIASPLT+  KIN RLDSINFF++NP L
Sbjct: 301 EILHTLSGSREGSLLKNIDYTLTGGGGRLFAERIASPLTNPQKINIRLDSINFFLKNPEL 360

Query: 361 INPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGA 420
           +  IQ ILKSSPD+PR+LSRLKI RGEP+DIAV+R+GIRSGI++L+   K D+PEELR A
Sbjct: 361 VKSIQTILKSSPDIPRALSRLKIERGEPRDIAVVRNGIRSGIDMLDAISKKDIPEELRDA 420

Query: 421 VEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQL 480
           V+KL+KLPQSLEKTLSSMLSDDLPT K+DGGFLRDGAD SLDE R LRDQSKRIIASLQL
Sbjct: 421 VKKLQKLPQSLEKTLSSMLSDDLPTLKKDGGFLRDGADPSLDEARLLRDQSKRIIASLQL 480

Query: 481 KYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLEL 540
           KYAEET IKN+KIKHNN+LGYFIEV SS+A +L KD ESKDRFIHRQTM+NLTRFTTLEL
Sbjct: 481 KYAEETNIKNIKIKHNNHLGYFIEVISSNAKILTKDFESKDRFIHRQTMTNLTRFTTLEL 540

Query: 541 IDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQN 600
           IDLENRITNATN AL IELE+FE LS AIIEQSESL++AS+VI +ID+SIAL  LA+EQN
Sbjct: 541 IDLENRITNATNRALSIELEAFETLSKAIIEQSESLNDASKVIDVIDVSIALTTLAREQN 600

Query: 601 YCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNM 660
           YCRPI+D+ST FIVKDGRHP+VEKTLK QSSKPFI NDCDLSC +DK +GKLWLLTGPNM
Sbjct: 601 YCRPIVDDSTKFIVKDGRHPVVEKTLKYQSSKPFITNDCDLSCSDDKKNGKLWLLTGPNM 660

Query: 661 GGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIET 720
           GGKSTFLRQNALIVIMAQMGSYVPAS  HIGIVDKLFSRVGSADNLASGRSTFMVEMIET
Sbjct: 661 GGKSTFLRQNALIVIMAQMGSYVPASSVHIGIVDKLFSRVGSADNLASGRSTFMVEMIET 720

Query: 721 ASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSK 780
           ASILNQATNQSFVILDEIGRGT+TLDGLSIAWATIEYLHE N CRGLLATHFHELTDLSK
Sbjct: 721 ASILNQATNQSFVILDEIGRGTSTLDGLSIAWATIEYLHEINLCRGLLATHFHELTDLSK 780

Query: 781 SLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFE 840
           SL RFHNATLQVS+S EGI+FLHKVIPGIADHSYGIQVGKLAGLP +VISRAY++LK F 
Sbjct: 781 SLARFHNATLQVSESAEGIVFLHKVIPGIADHSYGIQVGKLAGLPPSVISRAYEVLKKFA 840

Query: 841 KLYHHNQKDMRLY--YPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTALKTLYAVK 898
           KLY  NQKD+R Y    ++  +ESK ++SKND LF+EKI  ++ +EM+PL AL+TLY +K
Sbjct: 841 KLYDKNQKDVREYGQISKLPPEESKESISKND-LFLEKINQIDPNEMTPLKALETLYTLK 899

Query: 899 AWTLE 903
           AW LE
Sbjct: 900 AWALE 904


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86356045|ref|YP_467937.1| DNA mismatch repair protein [Rhizobium etli CFN 42] Length = 908 Back     alignment and organism information
>gi|44888231|sp|Q8UIF2|MUTS_AGRT5 RecName: Full=DNA mismatch repair protein mutS Length = 904 Back     alignment and organism information
>gi|241202801|ref|YP_002973897.1| DNA mismatch repair protein MutS [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 908 Back     alignment and organism information
>gi|159184268|ref|NP_353377.2| DNA mismatch repair protein [Agrobacterium tumefaciens str. C58] Length = 883 Back     alignment and organism information
>gi|190890059|ref|YP_001976601.1| DNA mismatch repair protein [Rhizobium etli CIAT 652] Length = 908 Back     alignment and organism information
>gi|325291779|ref|YP_004277643.1| DNA mismatch repair protein MutS [Agrobacterium sp. H13-3] Length = 904 Back     alignment and organism information
>gi|209547644|ref|YP_002279561.1| DNA mismatch repair protein MutS [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 880 Back     alignment and organism information
>gi|116250175|ref|YP_766013.1| DNA mismatch repair protein MutS [Rhizobium leguminosarum bv. viciae 3841] Length = 908 Back     alignment and organism information
>gi|222147340|ref|YP_002548297.1| DNA mismatch repair protein MutS [Agrobacterium vitis S4] Length = 883 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target920 DNA mismatch repair protein [Candidatus Liberibacter as
PRK05399854 PRK05399, PRK05399, DNA mismatch repair protein MutS; P 0.0
TIGR01070840 TIGR01070, mutS1, DNA mismatch repair protein MutS 0.0
COG0249843 COG0249, MutS, Mismatch repair ATPase (MutS family) [DN 0.0
pfam00488234 pfam00488, MutS_V, MutS domain V 1e-108
cd03284216 cd03284, ABC_MutS1, MutS1 homolog in eukaryotes 7e-91
cd03243202 cd03243, ABC_MutS_homologs, The MutS protein initiates 3e-62
cd03285222 cd03285, ABC_MSH2_euk, MutS2 homolog in eukaryotes 9e-61
cd03286218 cd03286, ABC_MSH6_euk, MutS6 homolog in eukaryotes 1e-55
cd03287222 cd03287, ABC_MSH3_euk, MutS3 homolog in eukaryotes 7e-55
cd03281213 cd03281, ABC_MSH5_euk, MutS5 homolog in eukaryotes 2e-48
cd03282204 cd03282, ABC_MSH4_euk, MutS4 homolog in eukaryotes 3e-38
cd03283199 cd03283, ABC_MutS-like, MutS-like homolog in eukaryotes 2e-30
cd03280200 cd03280, ABC_MutS2, MutS2 homologs in bacteria and euka 2e-24
KOG02171125 KOG0217, KOG0217, KOG0217, Mismatch repair ATPase MSH6 1e-100
KOG02181070 KOG0218, KOG0218, KOG0218, Mismatch repair MSH3 [Replic 2e-99
KOG0219902 KOG0219, KOG0219, KOG0219, Mismatch repair ATPase MSH2 4e-86
smart00534185 smart00534, MUTSac, ATPase domain of DNA mismatch repai 3e-77
pfam05192306 pfam05192, MutS_III, MutS domain III 2e-70
smart00533308 smart00533, MUTSd, DNA-binding domain of DNA mismatch r 2e-58
KOG0220867 KOG0220, KOG0220, KOG0220, Mismatch repair ATPase MSH4 6e-70
KOG0221849 KOG0221, KOG0221, KOG0221, Mismatch repair ATPase MSH5 1e-56
pfam01624113 pfam01624, MutS_I, MutS domain I 6e-46
TIGR01069 771 TIGR01069, mutS2, MutS2 family protein 3e-30
COG1193 753 COG1193, COG1193, Mismatch repair ATPase (MutS family) 2e-24
PRK00409 782 PRK00409, PRK00409, recombination and DNA strand exchan 3e-21
pfam0519092 pfam05190, MutS_IV, MutS family domain IV 1e-17
pfam05188133 pfam05188, MutS_II, MutS domain II 1e-15
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 4e-15
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 3e-06
>gnl|CDD|180056 PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>gnl|CDD|162188 TIGR01070, mutS1, DNA mismatch repair protein MutS Back     alignment and domain information
>gnl|CDD|30598 COG0249, MutS, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144180 pfam00488, MutS_V, MutS domain V Back     alignment and domain information
>gnl|CDD|73043 cd03284, ABC_MutS1, MutS1 homolog in eukaryotes Back     alignment and domain information
>gnl|CDD|73002 cd03243, ABC_MutS_homologs, The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>gnl|CDD|73044 cd03285, ABC_MSH2_euk, MutS2 homolog in eukaryotes Back     alignment and domain information
>gnl|CDD|73045 cd03286, ABC_MSH6_euk, MutS6 homolog in eukaryotes Back     alignment and domain information
>gnl|CDD|73046 cd03287, ABC_MSH3_euk, MutS3 homolog in eukaryotes Back     alignment and domain information
>gnl|CDD|73040 cd03281, ABC_MSH5_euk, MutS5 homolog in eukaryotes Back     alignment and domain information
>gnl|CDD|73041 cd03282, ABC_MSH4_euk, MutS4 homolog in eukaryotes Back     alignment and domain information
>gnl|CDD|73042 cd03283, ABC_MutS-like, MutS-like homolog in eukaryotes Back     alignment and domain information
>gnl|CDD|73039 cd03280, ABC_MutS2, MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>gnl|CDD|35438 KOG0217, KOG0217, KOG0217, Mismatch repair ATPase MSH6 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|35439 KOG0218, KOG0218, KOG0218, Mismatch repair MSH3 [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|35440 KOG0219, KOG0219, KOG0219, Mismatch repair ATPase MSH2 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|128807 smart00534, MUTSac, ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>gnl|CDD|147401 pfam05192, MutS_III, MutS domain III Back     alignment and domain information
>gnl|CDD|128806 smart00533, MUTSd, DNA-binding domain of DNA mismatch repair MUTS family Back     alignment and domain information
>gnl|CDD|35441 KOG0220, KOG0220, KOG0220, Mismatch repair ATPase MSH4 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|35442 KOG0221, KOG0221, KOG0221, Mismatch repair ATPase MSH5 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|144998 pfam01624, MutS_I, MutS domain I Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|31386 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|179009 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|147399 pfam05190, MutS_IV, MutS family domain IV Back     alignment and domain information
>gnl|CDD|147397 pfam05188, MutS_II, MutS domain II Back     alignment and domain information
>gnl|CDD|72986 cd03227, ABC_Class2, ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 920 DNA mismatch repair protein [Candidatus Liberibacter as
TIGR01070863 mutS1 DNA mismatch repair protein MutS; InterPro: IPR00 100.0
PRK05399848 DNA mismatch repair protein; Provisional 100.0
COG0249843 MutS Mismatch repair ATPase (MutS family) [DNA replicat 100.0
KOG02181070 consensus 100.0
KOG02171125 consensus 100.0
KOG0219902 consensus 100.0
KOG0220867 consensus 100.0
PRK00409 780 recombination and DNA strand exchange inhibitor protein 100.0
TIGR01069 834 mutS2 MutS2 family protein; InterPro: IPR005747 Mismatc 100.0
COG1193 753 Mismatch repair ATPase (MutS family) [DNA replication, 100.0
KOG0221849 consensus 100.0
pfam00488234 MutS_V MutS domain V. This domain is found in proteins 100.0
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS prot 100.0
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein 100.0
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS prot 100.0
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS prot 100.0
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS prot 100.0
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS prot 100.0
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes. Th 100.0
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA mismat 100.0
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The MutS 100.0
KOG0219902 consensus 99.47
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS family 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 97.88
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.84
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.79
PRK13409590 putative ATPase RIL; Provisional 97.35
KOG02171125 consensus 96.04
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 92.09
KOG0743457 consensus 91.92
pfam00931285 NB-ARC NB-ARC domain. 91.45
pfam05192306 MutS_III MutS domain III. This domain is found in prote 100.0
smart00533308 MUTSd DNA-binding domain of DNA mismatch repair MUTS fa 100.0
pfam01624113 MutS_I MutS domain I. This domain is found in proteins 100.0
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 100.0
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 98.62
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 98.47
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 98.28
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 98.24
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 98.24
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 98.23
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 98.23
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 98.22
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 98.21
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 98.21
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 98.15
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 98.15
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 98.14
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 98.13
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 98.12
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 98.1
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 98.1
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 98.08
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 98.07
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 98.07
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttransla 98.05
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 98.03
PRK13544208 consensus 98.02
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 98.02
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 98.01
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 97.99
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 97.99
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.98
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 97.98
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 97.97
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 97.97
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 97.96
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 97.95
COG0488530 Uup ATPase components of ABC transporters with duplicat 97.95
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 97.95
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 97.93
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 97.93
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 97.92
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 97.92
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 97.92
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 97.91
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.89
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 97.89
PRK03695245 vitamin B12-transporter ATPase; Provisional 97.88
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 97.87
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.87
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 97.86
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 97.86
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 97.85
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 97.84
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 97.83
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 97.83
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 97.83
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 97.81
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 97.81
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 97.8
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.79
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 97.79
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 97.78
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 97.78
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 97.76
PRK13542224 consensus 97.76
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.76
cd03246173 ABCC_Protease_Secretion This family represents the ABC 97.76
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 97.76
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 97.75
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 97.75
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 97.75
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 97.74
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.74
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 97.73
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 97.73
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 97.73
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 97.7
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 97.7
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.69
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.69
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.68
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.67
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 97.65
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 97.63
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 97.63
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 97.63
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 97.62
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 97.61
PRK11147632 ABC transporter ATPase component; Reviewed 97.6
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 97.59
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 97.58
COG4586325 ABC-type uncharacterized transport system, ATPase compo 97.56
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 97.56
PRK10908222 cell division protein FtsE; Provisional 97.54
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 97.53
PRK10636638 putative ABC transporter ATP-binding protein; Provision 97.52
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.51
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.49
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.47
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 97.46
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 97.46
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 97.46
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 97.41
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 97.41
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 97.39
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 97.38
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 97.34
COG4619223 ABC-type uncharacterized transport system, ATPase compo 97.29
COG4152300 ABC-type uncharacterized transport system, ATPase compo 97.28
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 97.27
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 97.25
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 97.21
KOG0927614 consensus 97.16
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 97.09
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 97.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 96.98
PRK09354350 recA recombinase A; Provisional 96.91
COG2401593 ABC-type ATPase fused to a predicted acetyltransferase 96.75
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 96.54
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 96.48
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 96.47
COG3839338 MalK ABC-type sugar transport systems, ATPase component 96.46
COG0410237 LivF ABC-type branched-chain amino acid transport syste 96.33
KOG0056790 consensus 96.32
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 96.18
TIGR01288303 nodI nodulation ABC transporter NodI; InterPro: IPR0059 96.1
PRK10790593 putative multidrug transporter membrane\ATP-binding com 96.04
COG0411250 LivG ABC-type branched-chain amino acid transport syste 95.58
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 94.36
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 94.08
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 93.24
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 92.76
TIGR02012322 tigrfam_recA protein RecA; InterPro: IPR001553 The recA 92.37
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 92.28
COG4615546 PvdE ABC-type siderophore export system, fused ATPase a 92.2
COG1127263 Ttg2A ABC-type transport system involved in resistance 91.34
pfam05188133 MutS_II MutS domain II. This domain is found in protein 99.78
pfam0519092 MutS_IV MutS family domain IV. This domain is found in 99.61
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.27
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 98.12
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 98.12
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 97.98
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 97.98
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 97.93
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 97.91
KOG0062582 consensus 97.89
PRK09700510 D-allose transporter ATP-binding protein; Provisional 97.88
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 97.87
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.81
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 97.79
PRK09984262 phosphonate/organophosphate ester transporter subunit; 97.76
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 97.74
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 97.73
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 97.71
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 97.68
PRK13536306 nodulation factor exporter subunit NodI; Provisional 97.63
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.63
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.61
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 97.61
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 97.59
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 97.58
PRK10762501 D-ribose transporter ATP binding protein; Provisional 97.58
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.58
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 97.57
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.57
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.55
PRK13549513 xylose transporter ATP-binding subunit; Provisional 97.53
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 97.52
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 97.5
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.48
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.42
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.16
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 97.1
COG3845501 ABC-type uncharacterized transport systems, ATPase comp 97.03
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 96.94
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 96.74
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.59
COG1129500 MglA ABC-type sugar transport system, ATPase component 96.5
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 96.3
KOG0059885 consensus 96.15
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are 95.42
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 95.2
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 95.19
PRK03918882 chromosome segregation protein; Provisional 94.67
COG3950440 Predicted ATP-binding protein involved in virulence [Ge 94.09
TIGR006181063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 94.09
PRK02224880 chromosome segregation protein; Provisional 93.81
PRK01156895 chromosome segregation protein; Provisional 93.81
COG0419908 SbcC ATPase involved in DNA repair [DNA replication, re 93.76
COG1106371 Predicted ATPases [General function prediction only] 93.4
COG2884223 FtsE Predicted ATPase involved in cell division [Cell d 92.9
COG4987573 CydC ABC-type transport system involved in cytochrome b 92.68
PRK00064355 recF recombination protein F; Reviewed 92.68
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPase th 91.17
COG4674249 Uncharacterized ABC-type transport system, ATPase compo 90.75
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 98.04
cd03239178 ABC_SMC_head The structural maintenance of chromosomes 97.81
COG3910233 Predicted ATPase [General function prediction only] 97.64
COG4555245 NatA ABC-type Na+ transport system, ATPase component [E 97.49
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.22
PRK06526254 transposase; Provisional 97.01
pfam03266168 DUF265 Protein of unknown function, DUF265. 96.97
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.86
PRK08116262 hypothetical protein; Validated 96.73
PRK08181269 transposase; Validated 96.42
PRK08939306 primosomal protein DnaI; Reviewed 96.32
PRK09183258 transposase/IS protein; Provisional 96.19
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 96.13
PRK00440318 rfc replication factor C small subunit; Reviewed 96.01
PRK13695174 putative NTPase; Provisional 95.83
KOG0060659 consensus 95.71
PRK07952242 DNA replication protein DnaC; Validated 95.41
PRK12402337 replication factor C small subunit 2; Reviewed 95.19
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 95.14
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.1
pfam00004131 AAA ATPase family associated with various cellular acti 94.56
PRK06835330 DNA replication protein DnaC; Validated 94.47
KOG0065 1391 consensus 93.89
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are 93.81
PRK09112352 DNA polymerase III subunit delta'; Validated 93.49
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 93.42
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 93.38
cd01394218 radB RadB. The archaeal protein radB shares similarity 93.26
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 93.18
COG1193753 Mismatch repair ATPase (MutS family) [DNA replication, 92.67
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 92.59
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 92.37
KOG0057591 consensus 92.21
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 92.15
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 90.85
COG4637373 Predicted ATPase [General function prediction only] 90.58
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 90.11
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 97.98
cd03234226 ABCG_White The White subfamily represents ABC transport 97.78
COG1119257 ModF ABC-type molybdenum transport system, ATPase compo 97.76
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.75
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 97.67
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 97.52
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 97.51
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 97.46
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 97.45
PRK10744257 phosphate transporter subunit; Provisional 97.43
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 97.4
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 97.38
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 97.35
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.35
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 97.34
PRK13549513 xylose transporter ATP-binding subunit; Provisional 97.32
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 97.32
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 97.31
PRK10762501 D-ribose transporter ATP binding protein; Provisional 97.26
PRK09700510 D-allose transporter ATP-binding protein; Provisional 97.25
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 97.15
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 97.1
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 96.97
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 96.94
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.91
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 96.86
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 96.83
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 96.79
TIGR00954788 3a01203 Peroxysomal long chain fatty acyl transporter; 96.7
COG4133209 CcmA ABC-type transport system involved in cytochrome c 96.68
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.66
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 96.18
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 95.93
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 95.77
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 95.43
COG4559259 ABC-type hemin transport system, ATPase component [Inor 95.13
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 94.89
PRK10789569 putative multidrug transporter membrane\ATP-binding com 94.87
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes ar 94.74
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 93.98
COG4138248 BtuD ABC-type cobalamin transport system, ATPase compon 93.89
PTZ002431560 ABC transporter; Provisional 93.75
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 93.67
PRK10522547 multidrug transporter membrane component/ATP-binding co 93.23
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are 92.99
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 92.8
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 92.46
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 92.46
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 92.43
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 92.24
COG3044554 Predicted ATPase of the ABC class [General function pre 91.97
COG4161242 ArtP ABC-type arginine transport system, ATPase compone 91.86
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 91.65
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 90.76
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 90.47
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 90.28
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 90.11
COG4778235 PhnL ABC-type phosphonate transport system, ATPase comp 90.05
PRK10535648 macrolide transporter ATP-binding /permease protein; Pr 97.78
PRK11147632 ABC transporter ATPase component; Reviewed 97.58
PRK10636638 putative ABC transporter ATP-binding protein; Provision 97.5
KOG0927614 consensus 96.49
TIGR00602670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 92.38
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 97.57
PRK13409590 putative ATPase RIL; Provisional 93.51
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.55
PRK10869553 recombination and repair protein; Provisional 95.47
COG0497557 RecN ATPase involved in DNA repair [DNA replication, re 94.36
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-b 93.86
COG1480700 Predicted membrane-associated HD superfamily hydrolase 92.26
KOG0064728 consensus 96.81
pfam09818447 ABC_ATPase Predicted ATPase of the ABC class. Members o 93.5
PRK13545549 tagH teichoic acids export protein ATP-binding subunit; 96.68
COG4988559 CydD ABC-type transport system involved in cytochrome b 96.66
COG4178604 ABC-type uncharacterized transport system, permease and 96.59
PRK04195403 replication factor C large subunit; Provisional 95.83
PRK13342417 recombination factor protein RarA; Reviewed 94.41
smart00382148 AAA ATPases associated with a variety of cellular activ 95.73
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 94.61
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 93.22
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 92.57
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 92.51
COG4604252 CeuD ABC-type enterochelin transport system, ATPase com 92.22
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 90.18
PRK06921265 hypothetical protein; Provisional 95.08
PRK04296197 thymidine kinase; Provisional 90.17
pfam00265175 TK Thymidine kinase. 90.08
KOG0922674 consensus 94.04
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. This m 93.93
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 92.54
PRK102461047 exonuclease subunit SbcC; Provisional 93.35
COG4717984 Uncharacterized conserved protein [Function unknown] 91.29
TIGR02169 1202 SMC_prok_A chromosome segregation protein SMC; InterPro 93.06
pfam02463 1162 SMC_N RecF/RecN/SMC N terminal domain. This domain is f 90.6
PRK13341726 recombination factor protein RarA/unknown domain fusion 92.94
PRK09519790 recA recombinase A; Reviewed 91.42
KOG0979 1072 consensus 91.77
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 90.84
>TIGR01070 mutS1 DNA mismatch repair protein MutS; InterPro: IPR005748 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome Back     alignment and domain information
>PRK05399 DNA mismatch repair protein; Provisional Back     alignment and domain information
>COG0249 MutS Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0218 consensus Back     alignment and domain information
>KOG0217 consensus Back     alignment and domain information
>KOG0219 consensus Back     alignment and domain information
>KOG0220 consensus Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein; InterPro: IPR005747 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome Back     alignment and domain information
>COG1193 Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0221 consensus Back     alignment and domain information
>pfam00488 MutS_V MutS domain V Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>KOG0219 consensus Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>KOG0217 consensus Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0743 consensus Back     alignment and domain information
>pfam00931 NB-ARC NB-ARC domain Back     alignment and domain information