254780749

254780749

lipoprotein signal peptidase transmembrane

GeneID in NCBI database:8209754Locus tag:CLIBASIA_03180
Protein GI in NCBI database:254780749Protein Accession:YP_003065162.1
Gene range:-(523148, 523474)Protein Length:108aa
Gene description:lipoprotein signal peptidase transmembrane
COG prediction:[M] [U] Lipoprotein signal peptidase
KEGG prediction:lspA; lipoprotein signal peptidase transmembrane; K03101 signal peptidase II [EC:3.4.23.36]
SEED prediction:Lipoprotein signal peptidase (EC 3.4.23.36)
Pathway involved in KEGG:Protein export [PATH:las03060]
Subsystem involved in SEED:Lipoprotein Biosynthesis;
Signal peptidase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ
ccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccc
mlsnvsptILVSIRILIIAFIFFIwkknpktksifDIGYILITTGalgnvvdhCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHrqkgkidfpq
mlsnvsptILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ
MLSNVSPTILVSiriliiafiffiWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFisigtciiiyddiiLQHRQKGKIDFPQ
**SNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYD****************
MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ
*LSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQH**********
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
oooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ
MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ
MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKIDFPQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target108 lipoprotein signal peptidase transmembrane [Candidatus
315121912163 lipoprotein signal peptidase [Candidatus Liberibacter s 1 8e-24
227820614166 lipoprotein signal peptidase [Sinorhizobium fredii NGR2 1 7e-23
307301289166 lipoprotein signal peptidase [Sinorhizobium meliloti BL 1 2e-22
15964144166 lipoprotein signal peptidase transmembrane [Sinorhizobi 1 3e-22
150395254165 lipoprotein signal peptidase [Sinorhizobium medicae WSM 1 4e-22
163757827167 probable lipoprotein signal peptidase transmembrane [Ho 1 1e-21
222084675172 signal peptidase II [Agrobacterium radiobacter K84] Len 1 2e-21
218680737167 putative transmembrane lipoprotein signal peptidase [Rh 1 1e-20
15887692162 lipoprotein signal peptidase [Agrobacterium tumefaciens 1 4e-20
218671454154 lipoprotein signal peptidase protein [Rhizobium etli GR 1 4e-20
>gi|315121912|ref|YP_004062401.1| lipoprotein signal peptidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 163 Back     alignment and organism information
 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (80%)

Query: 1   MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTGALGNVVDHCLYGYVI 60
           MLSN+SP I++SIRILI +FI FIW K+ +    FD+GYILI  GA+GN++DH LYGYVI
Sbjct: 57  MLSNISPKIIISIRILITSFIVFIWMKSARKNFAFDMGYILIIAGAVGNIIDHYLYGYVI 116

Query: 61  DYIMIHTQTWSFAVFNLADLFISIGTCIIIYDD 93
           DY+M+ TQ WSFA+FNLAD  IS+G CI+I ++
Sbjct: 117 DYVMLRTQVWSFAIFNLADFLISLGACILICNE 149


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820614|ref|YP_002824584.1| lipoprotein signal peptidase [Sinorhizobium fredii NGR234] Length = 166 Back     alignment and organism information
>gi|307301289|ref|ZP_07581051.1| lipoprotein signal peptidase [Sinorhizobium meliloti BL225C] Length = 166 Back     alignment and organism information
>gi|15964144|ref|NP_384497.1| lipoprotein signal peptidase transmembrane [Sinorhizobium meliloti 1021] Length = 166 Back     alignment and organism information
>gi|150395254|ref|YP_001325721.1| lipoprotein signal peptidase [Sinorhizobium medicae WSM419] Length = 165 Back     alignment and organism information
>gi|163757827|ref|ZP_02164916.1| probable lipoprotein signal peptidase transmembrane [Hoeflea phototrophica DFL-43] Length = 167 Back     alignment and organism information
>gi|222084675|ref|YP_002543204.1| signal peptidase II [Agrobacterium radiobacter K84] Length = 172 Back     alignment and organism information
>gi|218680737|ref|ZP_03528634.1| putative transmembrane lipoprotein signal peptidase [Rhizobium etli CIAT 894] Length = 167 Back     alignment and organism information
>gi|15887692|ref|NP_353373.1| lipoprotein signal peptidase [Agrobacterium tumefaciens str. C58] Length = 162 Back     alignment and organism information
>gi|218671454|ref|ZP_03521124.1| lipoprotein signal peptidase protein [Rhizobium etli GR56] Length = 154 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target108 lipoprotein signal peptidase transmembrane [Candidatus
PRK14795158 PRK14795, PRK14795, lipoprotein signal peptidase; Provi 2e-25
PRK00376160 PRK00376, lspA, lipoprotein signal peptidase; Reviewed 6e-16
COG0597167 COG0597, LspA, Lipoprotein signal peptidase [Cell envel 1e-14
PRK14785171 PRK14785, PRK14785, lipoprotein signal peptidase; Provi 4e-12
PRK14796161 PRK14796, PRK14796, lipoprotein signal peptidase; Provi 1e-11
PRK14791146 PRK14791, PRK14791, lipoprotein signal peptidase; Provi 3e-11
PRK14773192 PRK14773, PRK14773, lipoprotein signal peptidase; Provi 1e-10
PRK14770167 PRK14770, PRK14770, lipoprotein signal peptidase; Provi 4e-10
PRK14793150 PRK14793, PRK14793, lipoprotein signal peptidase; Provi 4e-09
TIGR00077166 TIGR00077, lspA, lipoprotein signal peptidase 6e-09
PRK14797150 PRK14797, PRK14797, lipoprotein signal peptidase; Provi 5e-08
PRK14779159 PRK14779, PRK14779, lipoprotein signal peptidase; Provi 1e-07
PRK14790169 PRK14790, PRK14790, lipoprotein signal peptidase; Provi 4e-07
PRK14775170 PRK14775, PRK14775, lipoprotein signal peptidase; Provi 5e-07
PRK14769156 PRK14769, PRK14769, lipoprotein signal peptidase; Provi 5e-07
PRK14782157 PRK14782, PRK14782, lipoprotein signal peptidase; Provi 5e-07
PRK14794136 PRK14794, PRK14794, lipoprotein signal peptidase; Provi 3e-06
PRK14778186 PRK14778, PRK14778, lipoprotein signal peptidase; Provi 5e-06
PRK14768148 PRK14768, PRK14768, lipoprotein signal peptidase; Provi 3e-05
PRK14787159 PRK14787, PRK14787, lipoprotein signal peptidase; Provi 3e-05
PRK14767174 PRK14767, PRK14767, lipoprotein signal peptidase; Provi 4e-05
PRK14792159 PRK14792, PRK14792, lipoprotein signal peptidase; Provi 5e-05
PRK14781153 PRK14781, PRK14781, lipoprotein signal peptidase; Provi 1e-04
PRK14786154 PRK14786, PRK14786, lipoprotein signal peptidase; Provi 1e-04
PRK14774185 PRK14774, PRK14774, lipoprotein signal peptidase; Provi 2e-04
PRK14777184 PRK14777, PRK14777, lipoprotein signal peptidase; Provi 2e-04
pfam01252143 pfam01252, Peptidase_A8, Signal peptidase (SPase) II 1e-15
PRK14776170 PRK14776, PRK14776, lipoprotein signal peptidase; Provi 8e-08
PRK14764209 PRK14764, PRK14764, lipoprotein signal peptidase; Provi 1e-04
>gnl|CDD|173256 PRK14795, PRK14795, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|178992 PRK00376, lspA, lipoprotein signal peptidase; Reviewed Back     alignment and domain information
>gnl|CDD|30942 COG0597, LspA, Lipoprotein signal peptidase [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|184820 PRK14785, PRK14785, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|184824 PRK14796, PRK14796, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|184822 PRK14791, PRK14791, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173234 PRK14773, PRK14773, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173231 PRK14770, PRK14770, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|184823 PRK14793, PRK14793, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|161694 TIGR00077, lspA, lipoprotein signal peptidase Back     alignment and domain information
>gnl|CDD|184825 PRK14797, PRK14797, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|184818 PRK14779, PRK14779, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173251 PRK14790, PRK14790, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|184817 PRK14775, PRK14775, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173230 PRK14769, PRK14769, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173243 PRK14782, PRK14782, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173255 PRK14794, PRK14794, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173239 PRK14778, PRK14778, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173229 PRK14768, PRK14768, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173248 PRK14787, PRK14787, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|184815 PRK14767, PRK14767, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173253 PRK14792, PRK14792, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173242 PRK14781, PRK14781, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173247 PRK14786, PRK14786, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173235 PRK14774, PRK14774, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|173238 PRK14777, PRK14777, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|144736 pfam01252, Peptidase_A8, Signal peptidase (SPase) II Back     alignment and domain information
>gnl|CDD|173237 PRK14776, PRK14776, lipoprotein signal peptidase; Provisional Back     alignment and domain information
>gnl|CDD|184814 PRK14764, PRK14764, lipoprotein signal peptidase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 108 lipoprotein signal peptidase transmembrane [Candidatus
PRK00376162 lspA lipoprotein signal peptidase; Reviewed 100.0
COG0597167 LspA Lipoprotein signal peptidase [Cell envelope biogen 100.0
TIGR00077183 lspA signal peptidase II; InterPro: IPR001872 Peptidase 100.0
PRK01574169 lspA signal peptidase II; Provisional 99.98
pfam01252143 Peptidase_A8 Signal peptidase (SPase) II. 99.97
PRK00573184 lspA signal peptidase II; Provisional 99.24
pfam11368 248 DUF3169 Protein of unknown function (DUF3169). Some mem 93.48
>PRK00376 lspA lipoprotein signal peptidase; Reviewed Back     alignment and domain information
>COG0597 LspA Lipoprotein signal peptidase [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00077 lspA signal peptidase II; InterPro: IPR001872 Peptidases are grouped into clans and families Back     alignment and domain information
>PRK01574 lspA signal peptidase II; Provisional Back     alignment and domain information
>pfam01252 Peptidase_A8 Signal peptidase (SPase) II Back     alignment and domain information
>PRK00573 lspA signal peptidase II; Provisional Back     alignment and domain information
>pfam11368 DUF3169 Protein of unknown function (DUF3169) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00