254780752

254780752

penicillin binding peptidoglycan synthetase protein

GeneID in NCBI database:8209757Locus tag:CLIBASIA_03195
Protein GI in NCBI database:254780752Protein Accession:YP_003065165.1
Gene range:-(514686, 517139)Protein Length:817aa
Gene description:penicillin binding peptidoglycan synthetase protein
COG prediction:[M] Membrane carboxypeptidase/penicillin-binding protein
KEGG prediction:mrcA; penicillin binding peptidoglycan synthetase protein; K05366 penicillin-binding protein 1A [EC:2.4.1.- 3.4.-.-]
SEED prediction:Multimodular transpeptidase-transglycosylase (EC 2.4.1.129) (EC 3.4.-.-)
Pathway involved in KEGG:Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED4 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------
MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHGRRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVYNKEQTTEETSENRNVLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQIRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPGTGPAETYTVIDEDSNVSSEEILRRSPQANQAINSGSGGLY
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccEEEEEccccEEEEEcccccEEEcHHHccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccccHHHHHHHHHHHccccHHHccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcHHHHHcccEEEEEcccHHHHHHHHHHHHHcccccccccccccccHHcccccHHHHHHHHHccccHHHHHHHHHHccccccccEEEHHHHHHHHHHcccccccccccccccccccccccccccccccccEEcHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEccccccccccccHHccccccccHHHHHHHHHHHHcccccccEEEcccEEEEcccEEEEEEEcccccccEEEHHHHHHHHcHHHHHHHHHHHcHHHHHHHHHHccccccccccccEEEccccccHHHHHHHHHHHHcccEEEccEEEEEEEcccccEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccccEEEEEEcccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccHHcccccccEEEEEcccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccEEEEcccccHHHHHcccccccccHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccEEEcccccccHccHHHHHHHHHHHHHHHHcHHHHHccccEEEEEccHHHHHHHHHHHHHccHHHHHHcccccccHHccccccHHHHHHHHcccccccccccEEEEEEcccccEEEEEccccccccEEccccEEEEccccccHcccccccccccccHHHHcccccEEEEEEccccEEEEEccccccEEEEEcccccEEEEEEccccccccHHHHHHHHcccccccccHHHHHHHHHccccccEEEccccEEEccccccEccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccHHHHcccccccHHHHHHHHHHHHccccEEccEEEEEEEcccccEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHcccccccccccccccccEEEEcccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccccccccccccEEEEEcccccccccEEEEcccccccccccccccccccccccccccccc
MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISqnlpdyaalnsyspavttrihagNGALMAEYARENrlflpiqiipshvKYAFVsaedknfyyhsgVDIFGIMRAVLHNIrnishgrrpegasTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAalpkgpsnydpfrknkaaiARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRrshlfgseyFAEEVRRQLIDRYgekalyedglsirtslDPQLQLYARKALQNGlinydqndgfrgpikridlkkdwgntlasiptlydvpewDIAVVLEVsnshitigirptidsngkvtTERKKGIIEADSMRWVYNKeqtteetsenrnvlsLGDVIYVEHInegwrlrqipkvqggliamdprtgRILATIggfsysqsefnrstqamrqpgscfkpIVYAAAldsgytpasvimdapievvsrgkiwkpenysknfsgastLRFGLEKSRNLMTVRLAHNMGMTVVADYAEnfgiydkmlpvlpmslgagetTVLRMVSAYAVFanggkqirpsFIDRIQNRygktifnqeqricddcnydtwngqdepeiIDKREQVLDPMTAYQITSMLEGVIKHGtatgkvrlnrpvagktgttssyrdtwfigytpTLVVGVYVgydipaplnnhatgstltaPIFNAFMKEALknipssrfvappgmslipinkwtgmlskkgdpdtiieafkpgtgpaetytvidedsnvsseeilrrspqanqainsgsggly
MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNIShgrrpegastiTQQVAKNflltsnqtmdrKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAAlpkgpsnydpfrkNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQrrshlfgseyfaEEVRRQLIDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGlinydqndgfrgPIKRIDLKKDWGNTLASiptlydvpeWDIAVVLEVsnshitigirptidsngkvtterkkgiieadsmrwvYNKEqtteetsenrnvlsLGDVIYVEHInegwrlrqiPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRgkiwkpenysknfsgastlRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFanggkqirpsFIDRIQNRYGktifnqeqriCDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVIKHGtatgkvrlnrpvagktgttssyrdtwfiGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPGTGPAETYTVIDEDSNVSSEEilrrspqanqainsgsggly
MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHGRRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVYNKEQTTEETSENRNVLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQIRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPGTGPAETYTVIDEDSNVSSEEILRRSPQANQAINSGSGGLY
*YYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNI*******GASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVY**************VLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQIRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTW*************QVLDPMTAYQITSMLEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPGTGPAE***********************************
MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHGRRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVYNKE*********RNVLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQIRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPGTGPAETYTVIDEDSNVSSEEILRRSPQAN***********
MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHGRRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVYNKEQTTEETSENRNVLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQIRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPGTGPAETYTVIDED***************************
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHGRRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVYNKEQTTEETSENRNVLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQIRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPGTGPAETYTVIDEDSNVSSEEILRRSPQANQAINSGSGGLY
MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHGRRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVYNKEQTTEETSENRNVLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQIRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPGTGPAETYTVIDEDSNVSSEEILRRSPQANQAINSGSGGLY
MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHGRRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVYNKEQTTEETSENRNVLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQIRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPGTGPAETYTVIDEDSNVSSEEILRRSPQANQAINSGSGGLY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target817 penicillin binding peptidoglycan synthetase protein [Ca
254781103598 penicillin-binding transmembrane protein [Candidat 3e-04
>gi|254781103|ref|YP_003065516.1| penicillin-binding transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 598 Back     alignment
 Score = 38.9 bits (89), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 79/198 (39%), Gaps = 43/198 (21%)

Query: 442 GLIAMDPRTGRILATIGGFSYSQSE---------FNRSTQAMRQPGSCFKPIVYAAALDS 492
           G + ++  TG +++ +    Y   E         FNR +  + + GS FK    A  +DS
Sbjct: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344

Query: 493 GYTPASVIMDA--PIEVVSRGKI----WKPENYSKNFSGASTLRFGLEKSRNLMTVRLAH 546
           G      + D   PI+V   GK     + P+N  +  +     R+    S N+   ++A 
Sbjct: 345 GLFTVKDLFDTRNPIKV---GKHVIHDYHPQN--RILTIPEIFRY----SSNIGAAQIAD 395

Query: 547 NMGMTVVADYAENFGIYDKMLPVLP------------------MSLGAG-ETTVLRMVSA 587
            MG+    ++    G+  K+   LP                  +S G G  TT L+   A
Sbjct: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455

Query: 588 YAVFANGGKQIRPSFIDR 605
            A   N G+ I P+F+ R
Sbjct: 456 AAALINEGRLIPPTFMIR 473

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target817 penicillin binding peptidoglycan synthetase protein [Ca
315121915819 penicillin binding peptidoglycan synthetase protein [Ca 1 0.0
190891330819 penicillin binding peptidoglycan synthetase [Rhizobium 1 0.0
327190273819 penicillin binding peptidoglycan synthetase protein [Rh 1 0.0
86357281819 penicillin binding peptidoglycan synthetase protein [Rh 1 0.0
209548907819 penicillin-binding protein, 1A family [Rhizobium legumi 1 0.0
307317884817 penicillin-binding protein, 1A family [Sinorhizobium me 1 0.0
15965083817 penicillin-binding 1A transmembrane protein [Sinorhizob 1 0.0
116251509819 peptidoglycan transglycosylase penicillin-binding prote 1 0.0
227821684817 penicillin binding peptidoglycan synthetase protein [Si 1 0.0
241204130809 penicillin-binding protein, 1A family [Rhizobium legumi 1 0.0
>gi|315121915|ref|YP_004062404.1| penicillin binding peptidoglycan synthetase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 819 Back     alignment and organism information
 Score = 1478 bits (3825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/821 (85%), Positives = 768/821 (93%), Gaps = 6/821 (0%)

Query: 1   MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALNSYSPAVTTRIHAGNG 60
           MY RIV FIGYFFGFATYSILGAILGASIYIAKISQNLPDYA LNSYSP++TTRIHAGNG
Sbjct: 1   MYSRIVRFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAILNSYSPSITTRIHAGNG 60

Query: 61  ALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHG 120
           +L+AEYA+ENRLFLPI  IPSHVKYAFVSAEDKNFYYHSGVDIFGI+RA LHNI+NI +G
Sbjct: 61  SLIAEYAKENRLFLPIHTIPSHVKYAFVSAEDKNFYYHSGVDIFGIIRASLHNIKNIGYG 120

Query: 121 RRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFN 180
           RRPEGASTITQQVAKNFLL+SNQTMDRKIKEILLSFRLEKAY+KEKILEFYLNEIFFGFN
Sbjct: 121 RRPEGASTITQQVAKNFLLSSNQTMDRKIKEILLSFRLEKAYNKEKILEFYLNEIFFGFN 180

Query: 181 SYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEEN 240
           SYGIASAALTYF+KSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEEN
Sbjct: 181 SYGIASAALTYFDKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDRMEEN 240

Query: 241 GYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTS 300
            YIS EQA+VAK K LKIT +QRRSHLFG+EYF+EEVRRQ+IDRYGEKALYEDGLS+RTS
Sbjct: 241 SYISHEQAVVAKSKSLKITNRQRRSHLFGTEYFSEEVRRQIIDRYGEKALYEDGLSVRTS 300

Query: 301 LDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVV 360
           L+PQLQ +ARKALQ+GL+NYDQ DGFRGPIK+IDLKKDWG+ LASI +LYDVPEW+IAVV
Sbjct: 301 LNPQLQFHARKALQDGLVNYDQRDGFRGPIKKIDLKKDWGHALASISSLYDVPEWNIAVV 360

Query: 361 LEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVYN---KEQTTEETSENRNVLS 417
           LEVSNSHITIG+RPTI+SNGK+TTERKKG+IE DS+RW YN   K Q +E+  + RN+LS
Sbjct: 361 LEVSNSHITIGLRPTIESNGKITTERKKGVIEVDSIRWAYNSLSKNQNSEQ--DPRNILS 418

Query: 418 LGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQP 477
            GDVIYVEHI+EGWRLRQIPK+QGGLIAMDPRTGRILAT+GGFSYSQSEFNRSTQAMRQP
Sbjct: 419 PGDVIYVEHIDEGWRLRQIPKLQGGLIAMDPRTGRILATVGGFSYSQSEFNRSTQAMRQP 478

Query: 478 GSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSR 537
           GSCFKPIVYAAALDSGYTPAS+IMD PIEV SRG IW+PEN+SK  SGA TLRFGLEKSR
Sbjct: 479 GSCFKPIVYAAALDSGYTPASIIMDEPIEVFSRGNIWRPENFSKTSSGAYTLRFGLEKSR 538

Query: 538 NLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQ 597
           N MTVRLAHNMGM+VVADYAENFG+YDKMLPVL MSLGAGETTVLRMV+AYAVFANGGKQ
Sbjct: 539 NRMTVRLAHNMGMSVVADYAENFGVYDKMLPVLAMSLGAGETTVLRMVAAYAVFANGGKQ 598

Query: 598 IRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSM 657
           IRPSFIDRIQ+R+GKTIFNQEQRICD CNYDTW+GQDEPEIIDKREQVLDPMTAYQITS+
Sbjct: 599 IRPSFIDRIQDRFGKTIFNQEQRICDYCNYDTWSGQDEPEIIDKREQVLDPMTAYQITSI 658

Query: 658 LEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHA 717
           LEG IK GTA G+VRLNRPVAGKTGT+S+ RD WFIGYTPTLV GVY+GYDIP+PL N+A
Sbjct: 659 LEGAIKRGTAAGQVRLNRPVAGKTGTSSNNRDAWFIGYTPTLVTGVYIGYDIPSPLKNNA 718

Query: 718 TGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTIIEAFKPG 777
           TG TL APIFNAFM+EA+K  P +RFV P GMSLIPINKWTGMLS+KG+PDTIIE FKPG
Sbjct: 719 TGGTLAAPIFNAFMREAVKETPYARFVVPTGMSLIPINKWTGMLSQKGNPDTIIETFKPG 778

Query: 778 TGPAETYTVIDEDSNVSS-EEILRRSPQANQAINSGSGGLY 817
           TGPA+TYTVID+++NVSS EEILRRSPQAN+AINS SGGLY
Sbjct: 779 TGPAKTYTVIDDNNNVSSQEEILRRSPQANKAINSSSGGLY 819


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891330|ref|YP_001977872.1| penicillin binding peptidoglycan synthetase [Rhizobium etli CIAT 652] Length = 819 Back     alignment and organism information
>gi|327190273|gb|EGE57373.1| penicillin binding peptidoglycan synthetase protein [Rhizobium etli CNPAF512] Length = 819 Back     alignment and organism information
>gi|86357281|ref|YP_469173.1| penicillin binding peptidoglycan synthetase protein [Rhizobium etli CFN 42] Length = 819 Back     alignment and organism information
>gi|209548907|ref|YP_002280824.1| penicillin-binding protein, 1A family [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 819 Back     alignment and organism information
>gi|307317884|ref|ZP_07597322.1| penicillin-binding protein, 1A family [Sinorhizobium meliloti AK83] Length = 817 Back     alignment and organism information
>gi|15965083|ref|NP_385436.1| penicillin-binding 1A transmembrane protein [Sinorhizobium meliloti 1021] Length = 817 Back     alignment and organism information
>gi|116251509|ref|YP_767347.1| peptidoglycan transglycosylase penicillin-binding protein 1A [Rhizobium leguminosarum bv. viciae 3841] Length = 819 Back     alignment and organism information
>gi|227821684|ref|YP_002825654.1| penicillin binding peptidoglycan synthetase protein [Sinorhizobium fredii NGR234] Length = 817 Back     alignment and organism information
>gi|241204130|ref|YP_002975226.1| penicillin-binding protein, 1A family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 809 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target817 penicillin binding peptidoglycan synthetase protein [Ca
PRK11636850 PRK11636, mrcA, penicillin-binding protein 1a; Provisio 1e-134
TIGR02074530 TIGR02074, PBP_1a_fam, penicillin-binding protein, 1A f 9e-92
COG0744661 COG0744, MrcB, Membrane carboxypeptidase (penicillin-bi 2e-67
TIGR02071730 TIGR02071, PBP_1b, penicillin-binding protein 1B 3e-40
pfam00905296 pfam00905, Transpeptidase, Penicillin binding protein t 4e-35
PRK14850764 PRK14850, PRK14850, penicillin-binding protein 1b; Prov 3e-32
PRK09506830 PRK09506, mrcB, bifunctional glycosyl transferase/trans 1e-27
COG0768599 COG0768, FtsI, Cell division protein FtsI/penicillin-bi 2e-25
TIGR03423592 TIGR03423, pbp2_mrdA, penicillin-binding protein 2 2e-23
TIGR02214636 TIGR02214, spoVD_pbp, stage V sporulation protein D 2e-14
TIGR02074530 TIGR02074, PBP_1a_fam, penicillin-binding protein, 1A f 6e-81
TIGR02071730 TIGR02071, PBP_1b, penicillin-binding protein 1B 3e-53
TIGR02073727 TIGR02073, PBP_1c, penicillin-binding protein 1C 2e-44
PRK09506830 PRK09506, mrcB, bifunctional glycosyl transferase/trans 7e-39
PRK14850764 PRK14850, PRK14850, penicillin-binding protein 1b; Prov 5e-35
PRK11240772 PRK11240, PRK11240, penicillin-binding protein 1C; Prov 5e-27
COG0744661 COG0744, MrcB, Membrane carboxypeptidase (penicillin-bi 4e-71
pfam00912174 pfam00912, Transgly, Transglycosylase 5e-63
PRK13481232 PRK13481, PRK13481, glycosyltransferase; Provisional 1e-34
PRK00056236 PRK00056, mtgA, monofunctional biosynthetic peptidoglyc 2e-31
TIGR02070224 TIGR02070, mono_pep_trsgly, monofunctional biosynthetic 9e-28
COG4953733 COG4953, PbpC, Membrane carboxypeptidase/penicillin-bin 8e-41
TIGR02073 727 TIGR02073, PBP_1c, penicillin-binding protein 1C 4e-38
COG4953733 COG4953, PbpC, Membrane carboxypeptidase/penicillin-bin 5e-38
PRK11240 772 PRK11240, PRK11240, penicillin-binding protein 1C; Prov 1e-15
COG5009797 COG5009, MrcA, Membrane carboxypeptidase/penicillin-bin 0.0
>gnl|CDD|183248 PRK11636, mrcA, penicillin-binding protein 1a; Provisional Back     alignment and domain information
>gnl|CDD|162686 TIGR02074, PBP_1a_fam, penicillin-binding protein, 1A family Back     alignment and domain information
>gnl|CDD|31087 COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162683 TIGR02071, PBP_1b, penicillin-binding protein 1B Back     alignment and domain information
>gnl|CDD|144486 pfam00905, Transpeptidase, Penicillin binding protein transpeptidase domain Back     alignment and domain information
>gnl|CDD|184852 PRK14850, PRK14850, penicillin-binding protein 1b; Provisional Back     alignment and domain information
>gnl|CDD|181917 PRK09506, mrcB, bifunctional glycosyl transferase/transpeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|31111 COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|163256 TIGR03423, pbp2_mrdA, penicillin-binding protein 2 Back     alignment and domain information
>gnl|CDD|131269 TIGR02214, spoVD_pbp, stage V sporulation protein D Back     alignment and domain information
>gnl|CDD|162686 TIGR02074, PBP_1a_fam, penicillin-binding protein, 1A family Back     alignment and domain information
>gnl|CDD|162683 TIGR02071, PBP_1b, penicillin-binding protein 1B Back     alignment and domain information
>gnl|CDD|162685 TIGR02073, PBP_1c, penicillin-binding protein 1C Back     alignment and domain information
>gnl|CDD|181917 PRK09506, mrcB, bifunctional glycosyl transferase/transpeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|184852 PRK14850, PRK14850, penicillin-binding protein 1b; Provisional Back     alignment and domain information
>gnl|CDD|183049 PRK11240, PRK11240, penicillin-binding protein 1C; Provisional Back     alignment and domain information
>gnl|CDD|31087 COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144490 pfam00912, Transgly, Transglycosylase Back     alignment and domain information
>gnl|CDD|184078 PRK13481, PRK13481, glycosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178830 PRK00056, mtgA, monofunctional biosynthetic peptidoglycan transglycosylase; Provisional Back     alignment and domain information
>gnl|CDD|162682 TIGR02070, mono_pep_trsgly, monofunctional biosynthetic peptidoglycan transglycosylase Back     alignment and domain information
>gnl|CDD|34561 COG4953, PbpC, Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162685 TIGR02073, PBP_1c, penicillin-binding protein 1C Back     alignment and domain information
>gnl|CDD|34561 COG4953, PbpC, Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183049 PRK11240, PRK11240, penicillin-binding protein 1C; Provisional Back     alignment and domain information
>gnl|CDD|34614 COG5009, MrcA, Membrane carboxypeptidase/penicillin-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 817 penicillin binding peptidoglycan synthetase protein [Ca
COG5009797 MrcA Membrane carboxypeptidase/penicillin-binding prote 100.0
PRK11636850 mrcA peptidoglycan synthetase; Provisional 100.0
TIGR02074700 PBP_1a_fam penicillin-binding protein, 1A family; Inter 100.0
PRK09506839 mrcB penicillin-binding protein 1b; Reviewed 100.0
PRK11240 770 penicillin-binding protein 1C; Provisional 100.0
TIGR02071742 PBP_1b penicillin-binding protein 1B; InterPro: IPR0118 100.0
TIGR02073 786 PBP_1c penicillin-binding protein 1C; InterPro: IPR0118 100.0
COG4953733 PbpC Membrane carboxypeptidase/penicillin-binding prote 100.0
COG0744661 MrcB Membrane carboxypeptidase (penicillin-binding prot 100.0
PRK13481269 glycosyltransferase; Provisional 100.0
pfam00912174 Transgly Transglycosylase. The penicillin-binding prote 100.0
TIGR02070228 mono_pep_trsgly monofunctional biosynthetic peptidoglyc 100.0
PRK00056226 mtgA monofunctional biosynthetic peptidoglycan transgly 100.0
TIGR03423592 pbp2_mrdA penicillin-binding protein 2. Members of this 100.0
pfam00905296 Transpeptidase Penicillin binding protein transpeptidas 100.0
PRK10795619 penicillin-binding protein 2; Provisional 100.0
COG0768599 FtsI Cell division protein FtsI/penicillin-binding prot 100.0
TIGR02214660 spoVD_pbp stage V sporulation protein D; InterPro: IPR0 100.0
COG2602254 Beta-lactamase class D [Defense mechanisms] 98.81
PRK11669308 pbpG D-alanyl-D-alanine endopeptidase; Provisional 97.58
pfam00768241 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase. 97.35
PRK10001400 D-alanyl-D-alanine carboxypeptidase fraction C; Provisi 96.02
PRK10793403 D-alanyl-D-alanine carboxypeptidase fraction A; Provisi 95.48
PRK11397390 dacD D-alanyl-D-alanine carboxypeptidase; Provisional 95.17
COG1686389 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope 94.11
COG2367329 PenP Beta-lactamase class A [Defense mechanisms] 95.95
PRK00971308 glutaminase; Provisional 95.49
pfam04960286 Glutaminase Glutaminase. This family of enzymes deamina 94.43
PRK12356319 glutaminase; Reviewed 94.08
PRK12357326 glutaminase; Reviewed 93.9
>COG5009 MrcA Membrane carboxypeptidase/penicillin-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11636 mrcA peptidoglycan synthetase; Provisional Back     alignment and domain information
>TIGR02074 PBP_1a_fam penicillin-binding protein, 1A family; InterPro: IPR011816 Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task Back     alignment and domain information
>PRK09506 mrcB penicillin-binding protein 1b; Reviewed Back     alignment and domain information
>PRK11240 penicillin-binding protein 1C; Provisional Back     alignment and domain information
>TIGR02071 PBP_1b penicillin-binding protein 1B; InterPro: IPR011813 Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task Back     alignment and domain information
>TIGR02073 PBP_1c penicillin-binding protein 1C; InterPro: IPR011815 This entry contains penicillin binding proteins includes the member from Escherichia coli designated penicillin-binding protein 1C Back     alignment and domain information
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0744 MrcB Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13481 glycosyltransferase; Provisional Back     alignment and domain information
>pfam00912 Transgly Transglycosylase Back     alignment and domain information
>TIGR02070 mono_pep_trsgly monofunctional biosynthetic peptidoglycan transglycosylase; InterPro: IPR011812 This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis Back     alignment and domain information
>PRK00056 mtgA monofunctional biosynthetic peptidoglycan transglycosylase; Provisional Back     alignment and domain information
>TIGR03423 pbp2_mrdA penicillin-binding protein 2 Back     alignment and domain information
>pfam00905 Transpeptidase Penicillin binding protein transpeptidase domain Back     alignment and domain information
>PRK10795 penicillin-binding protein 2; Provisional Back     alignment and domain information
>COG0768 FtsI Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02214 spoVD_pbp stage V sporulation protein D; InterPro: IPR011927 This entry describes the SpoVD family of homologs of the cell division protein FtsI, a penicillin binding protein Back     alignment and domain information
>COG2602 Beta-lactamase class D [Defense mechanisms] Back     alignment and domain information
>PRK11669 pbpG D-alanyl-D-alanine endopeptidase; Provisional Back     alignment and domain information
>pfam00768 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase Back     alignment and domain information
>PRK10001 D-alanyl-D-alanine carboxypeptidase fraction C; Provisional Back     alignment and domain information
>PRK10793 D-alanyl-D-alanine carboxypeptidase fraction A; Provisional Back     alignment and domain information
>PRK11397 dacD D-alanyl-D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>COG1686 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2367 PenP Beta-lactamase class A [Defense mechanisms] Back     alignment and domain information
>PRK00971 glutaminase; Provisional Back     alignment and domain information
>pfam04960 Glutaminase Glutaminase Back     alignment and domain information
>PRK12356 glutaminase; Reviewed Back     alignment and domain information
>PRK12357 glutaminase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target817 penicillin binding peptidoglycan synthetase protein [Ca
2oqo_A200 Crystal Structure Of A Peptidoglycan Glycosyltransf 1e-62
3hzs_A209 S. Aureus Monofunctional Glycosyltransferase (Mtga) 2e-42
2je5_A720 Structural And Mechanistic Basis Of Penicillin Bind 8e-58
3fwm_A751 Crystal Structure Of The Full-Length Transglycosyla 1e-57
3fwl_A751 Crystal Structure Of The Full-Length Transglycosyla 1e-55
3dwk_A625 Identification Of Dynamic Structural Motifs Involve 4e-55
2olu_A669 Structural Insight Into The Transglycosylation Step 7e-54
3fwm_A751 Crystal Structure Of The Full-Length Transglycosyla 1e-41
3fwl_A751 Crystal Structure Of The Full-Length Transglycosyla 2e-38
2c5w_B385 Penicillin-Binding Protein 1a (Pbp-1a) Acyl-Enzyme 2e-30
2c6w_B384 Penicillin-Binding Protein 1a (Pbp-1a) From Strepto 2e-30
2zc5_B390 Penicillin-Binding Protein 1a (Pbp 1a) Acyl-Enzyme 9e-30
2v2f_F390 Crystal Structure Of Pbp1a From Drug-Resistant Stra 1e-26
3oc2_A564 Crystal Structure Of Penicillin-Binding Protein 3 F 1e-25
3pbn_A538 Crystal Structure Of Apo Pbp3 From Pseudomonas Aeru 3e-25
2fff_B453 Open Form Of A Class A Transpeptidase Domain Length 2e-24
2uwy_B494 Active Site Restructuring Regulates Ligand Recognit 3e-24
2bg1_A494 Active Site Restructuring Regulates Ligand Recognit 4e-24
2jci_A469 Structural Insights Into The Catalytic Mechanism An 5e-24
2uwx_A494 Active Site Restructuring Regulates Ligand Recognit 7e-24
2jch_A461 Structural And Mechanistic Basis Of Penicillin Bind 7e-24
3lo7_A483 Crystal Structure Of Pbpa From Mycobacterium Tuberc 2e-21
3dwk_A625 Identification Of Dynamic Structural Motifs Involve 1e-29
2olu_A669 Structural Insight Into The Transglycosylation Step 2e-26
3eqv_A542 Crystal Structure Of Penicillin-Binding Protein 2 F 1e-22
3equ_A542 Crystal Structure Of Penicillin-Binding Protein 2 F 5e-21
>gi|145580129|pdb|2OQO|A Chain A, Crystal Structure Of A Peptidoglycan Glycosyltransferase From A Class A Pbp: Insight Into Bacterial Cell Wall Synthesis Length = 200 Back     alignment and structure
 Score =  246 bits (628), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 93/197 (47%), Positives = 129/197 (65%), Gaps = 3/197 (1%)

Query: 57  AGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRN 116
              G L      + R ++ I  IP HV  AFV+ ED+NF++H G+D   I+RA + N R 
Sbjct: 6   DPKGRLYGTIGIQKRFYVSIDKIPEHVINAFVATEDRNFWHHFGIDPVAIVRAAIVNYR- 64

Query: 117 ISHGRRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIF 176
              GR  +G STITQQ+AKN  LT  +T++RKIKE LL+ ++E+ +DK+KI+E YLN+I+
Sbjct: 65  --AGRIVQGGSTITQQLAKNLFLTRERTLERKIKEALLAIKIERTFDKKKIMELYLNQIY 122

Query: 177 FGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIARRNWVIDR 236
            G  +YG+ +AA  YF K V EL+++EAA LAALPK P+ Y+PF   + A+ RRN V+ R
Sbjct: 123 LGSGAYGVEAAAQVYFGKHVWELSLDEAALLAALPKAPAKYNPFYHPERALQRRNLVLKR 182

Query: 237 MEENGYISQEQALVAKQ 253
           M E GYI+ EQ   A  
Sbjct: 183 MLEEGYITPEQYEEAVN 199


>gi|251837135|pdb|3HZS|A Chain A, S. Aureus Monofunctional Glycosyltransferase (Mtga)in Complex With Moenomycin Length = 209 Back     alignment and structure
>gi|157835256|pdb|2JE5|A Chain A, Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins Length = 720 Back     alignment and structure
>gi|238828189|pdb|3FWM|A Chain A, Crystal Structure Of The Full-Length Transglycosylase Pbp1b From Escherichia Coli Length = 751 Back     alignment and structure
>gi|238828188|pdb|3FWL|A Chain A, Crystal Structure Of The Full-Length Transglycosylase Pbp1b From Escherichia Coli Length = 751 Back     alignment and structure
>gi|208435656|pdb|3DWK|A Chain A, Identification Of Dynamic Structural Motifs Involved In Peptidoglycan Glycosyltransfer Length = 625 Back     alignment and structure
>gi|145580077|pdb|2OLU|A Chain A, Structural Insight Into The Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme Length = 669 Back     alignment and structure
>gi|238828189|pdb|3FWM|A Chain A, Crystal Structure Of The Full-Length Transglycosylase Pbp1b From Escherichia Coli Length = 751 Back     alignment and structure
>gi|238828188|pdb|3FWL|A Chain A, Crystal Structure Of The Full-Length Transglycosylase Pbp1b From Escherichia Coli Length = 751 Back     alignment and structure
>gi|85544361|pdb|2C5W|B Chain B, Penicillin-Binding Protein 1a (Pbp-1a) Acyl-Enzyme Complex (Cefotaxime) From Streptococcus Pneumoniae Length = 385 Back     alignment and structure
>gi|85544374|pdb|2C6W|B Chain B, Penicillin-Binding Protein 1a (Pbp-1a) From Streptococcus Pneumoniae Length = 384 Back     alignment and structure
>gi|178847453|pdb|2ZC5|B Chain B, Penicillin-Binding Protein 1a (Pbp 1a) Acyl-Enzyme Complex (Biapenem) From Streptococcus Pneumoniae Length = 390 Back     alignment and structure
>gi|163931068|pdb|2V2F|F Chain F, Crystal Structure Of Pbp1a From Drug-Resistant Strain 5204 From Streptococcus Pneumoniae Length = 390 Back     alignment and structure
>gi|311772227|pdb|3OC2|A Chain A, Crystal Structure Of Penicillin-Binding Protein 3 From Pseudomonas Aeruginosa Length = 564 Back     alignment and structure
>gi|315364688|pdb|3PBN|A Chain A, Crystal Structure Of Apo Pbp3 From Pseudomonas Aeruginosa Length = 538 Back     alignment and structure
>gi|110591396|pdb|2FFF|B Chain B, Open Form Of A Class A Transpeptidase Domain Length = 453 Back     alignment and structure
>gi|62738935|pdb|2BG1|A Chain A, Active Site Restructuring Regulates Ligand Recognition In Classa Penicillin-Binding Proteins (Pbps) Length = 494 Back     alignment and structure
>gi|291463677|pdb|3LO7|A Chain A, Crystal Structure Of Pbpa From Mycobacterium Tuberculosis Length = 483 Back     alignment and structure
>gi|208435656|pdb|3DWK|A Chain A, Identification Of Dynamic Structural Motifs Involved In Peptidoglycan Glycosyltransfer Length = 625 Back     alignment and structure
>gi|145580077|pdb|2OLU|A Chain A, Structural Insight Into The Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme Length = 669 Back     alignment and structure
>gi|209870568|pdb|3EQV|A Chain A, Crystal Structure Of Penicillin-Binding Protein 2 From Neisseria Gonorrhoeae Containing Four Mutations Associated With Penicillin Resistance Length = 542 Back     alignment and structure
>gi|209870566|pdb|3EQU|A Chain A, Crystal Structure Of Penicillin-Binding Protein 2 From Neisseria Gonorrhoeae Length = 542 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target817 penicillin binding peptidoglycan synthetase protein [Ca
2jch_A720 Penicillin-binding protein 1B; peptidoglycan synthesis 1e-100
3fwm_A751 Penicillin-binding protein 1B; bacterial cell WALL synt 3e-59
2olv_A669 Penicillin-binding protein 2; transpeptidase fold, glyc 4e-40
2bg1_A494 PBP1B, penicillin-binding protein 1B; peptidoglycan, pe 3e-48
3fwm_A751 Penicillin-binding protein 1B; bacterial cell WALL synt 6e-58
2olv_A669 Penicillin-binding protein 2; transpeptidase fold, glyc 9e-57
3hzs_A209 Monofunctional glycosyltransferase; transglycosylase, p 5e-54
2oqo_A200 Penicillin-binding protein 1A (PBP-1A) (PBP1A); transfe 4e-52
2bg1_A494 PBP1B, penicillin-binding protein 1B; peptidoglycan, pe 3e-16
3lo7_A483 PBPA, penicillin-binding protein A; transpeptidase doma 1e-04
3lo7_A483 PBPA, penicillin-binding protein A; transpeptidase doma 7e-42
2wuq_A318 BLAB, beta-lactamase regulatory protein BLAB; class A b 1e-32
1k38_A254 Penicillinase, beta-lactamase OXA-2; serine beta-lactam 1e-28
1k55_A246 Beta lactamase OXA-10; antibiotic resistance, carbamyla 2e-24
3hbr_A265 OXA-48; class D beta-lactamase, antibiotic, dimer, hydr 1e-23
3g4p_A244 Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme me 2e-23
3equ_A542 PBP-2, penicillin-binding protein 2; class B transpepti 6e-23
1nrf_A262 Regulatory protein BLAR1; penicillin-receptor, beta-lac 1e-22
1xkz_A255 Regulatory protein BLAR1; beta-lactam receptor, signal 1e-19
2wad_A680 Penicillin-binding protein 2B; peptidoglycan synthesis, 5e-19
2iwb_A246 Methicillin resistance MECR1 protein; antibiotic resist 1e-17
3isg_A251 Penicillinase, beta-lactamase OXA-1; hydrolase, lysine 8e-17
2v2f_F390 Penicillin binding protein 1A; transpeptidase activity, 3e-41
3oc2_A564 Penicillin-binding protein 3; structu genomics, oxford 4e-34
1qme_A702 Penicillin-binding protein 2X; peptidoglycan synthesis, 8e-24
2v2f_F390 Penicillin binding protein 1A; transpeptidase activity, 1e-07
1vqq_A646 Saupbp2A, penicillin-binding protein MECA, low-affinity 2e-25
3d0f_A106 Penicillin-binding 1 transmembrane protein MRCA; BIG_11 5e-17
>2jch_A Penicillin-binding protein 1B; peptidoglycan synthesis multifunctional enzyme, cell WALL, peptidoglycan, gamma lactam antibiotics; HET: PL7; 2.4A {Streptococcus pneumoniae} PDB: 2jci_A* 2je5_A* Length = 720 Back     alignment and structure
 Score =  360 bits (924), Expect = e-100
 Identities = 157/794 (19%), Positives = 266/794 (33%), Gaps = 141/794 (17%)

Query: 22  GAILGASIYIAKISQNLPDYAALNSYSP--AVTTRIHAGNGALMAEYARE-NRLFLPIQI 78
           G  LG  + +    + +P    L +     +  + I   +G ++A    +  R  +  + 
Sbjct: 3   GIALGYGVALFDKVR-VPQTEELVNQVKDISSISEITYSDGTVIASIESDMLRTSISSEQ 61

Query: 79  IPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHGRRPEGASTITQQVAKNFL 138
           I  ++K A ++ ED++F  H GV    ++ A L             G ST+TQQ+ K  +
Sbjct: 62  ISENLKKAIIATEDEHFKEHKGVVPNAVIPATLGKFV---GLGSSSGGSTLTQQLIKQQV 118

Query: 139 LTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFNSY-----GIASAALTYFN 193
           +    T+ RK  EI+ +  LE+A +K++IL  YLN   FG N+      G   AA   F 
Sbjct: 119 VGDAPTLARKAAEIVDALALERAMNKDEILTTYLNVAPFGRNNKGQNIAGARQAAEGIFG 178

Query: 194 KSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAIAR---------RNWVIDRMEENGYIS 244
              S+LT+ +AA+LA LP+ P  Y P+       +             V+  M   G +S
Sbjct: 179 VDASQLTVPQAAFLAGLPQSPITYSPYENTGELKSDEDLEIGLRRAKAVLYSMYRTGALS 238

Query: 245 QEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYEDGLSIRTSLDPQ 304
           +++    K                        +++  +       + +D L   T  + Q
Sbjct: 239 KDEYSQYKDYD---------------------LKQDFLPSGTVTGISQDYLYFTTLAEAQ 277

Query: 305 LQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVS 364
            ++Y   A              R  +   +LK +            ++            
Sbjct: 278 ERMYDYLA-------------QRDNVSAKELKNEATQKFYRDLAAKEIENGGY------- 317

Query: 365 NSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWVYNKEQTTEETSENRNVLSLGDVIYV 424
                           K+TT   + I  A                               
Sbjct: 318 ----------------KITTTIDQKIHSAMQSAVADYGY--------------------- 340

Query: 425 EHINEGWRLRQIPKVQGGLIAMDPRTGRILATIGGFSYSQSEFNRSTQAMRQPGSCFKPI 484
                        +V+ G + MD +TG IL  +GG +Y +++ N +    R P S  KP+
Sbjct: 341 ------LLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPL 394

Query: 485 -VYAAALDSGYTPASVIMDAPIEVVSRGKIWKPENYSKNFSGASTLRFGLEKSRNLMTVR 543
             Y  A+D G   +  I+       + G      N                 +       
Sbjct: 395 LAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTY 454

Query: 544 LAHNMGMTVVADYAENFGIYDKMLPVLPMSLGAG-ETTVLRMVSAYAVFANGGKQIRPSF 602
                    V  Y E  G       +  + +G G E TV +  + Y   AN G   +   
Sbjct: 455 RMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHV 514

Query: 603 IDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVI 662
           I +I+   G+ ++  +                     DK  QV    TA  +  +L  V+
Sbjct: 515 ISKIEAADGRVVYEYQ---------------------DKPVQVYSKATATIMQGLLREVL 553

Query: 663 KHGTAT---------GKVRLNRPVAGKTGTTSSYRDTWFIGYTPTLVVGVYVGYDIPAPL 713
                T              N    GKTGTT+   + W +  TP L +G ++G+D    L
Sbjct: 554 SSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSL 613

Query: 714 NNHATGST---LTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKKGDPDTI 770
           +  A  S      A + NA  + +     + RF   P +    + K TG    K   +  
Sbjct: 614 SQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEG- 672

Query: 771 IEAFKPGTGPAETY 784
            E    G+     +
Sbjct: 673 KEVEVTGSTVTSYW 686


>3fwm_A Penicillin-binding protein 1B; bacterial cell WALL synthesis, antibiotics design, transferase, hydrolase; HET: M0E; 2.16A {Escherichia coli} PDB: 3fwl_A* Length = 751 Back     alignment and structure
>2olv_A Penicillin-binding protein 2; transpeptidase fold, glycosyltransferase family 51, lysozyme fold; HET: M0E; 2.80A {Staphylococcus aureus} SCOP: d.2.1.10 e.3.1.1 PDB: 2olu_A* 3dwk_A* Length = 669 Back     alignment and structure
>2bg1_A PBP1B, penicillin-binding protein 1B; peptidoglycan, peptidoglycan synthesis multifunctional enzyme, cell WALL; 1.9A {Streptococcus pneumoniae} SCOP: e.3.1.1 PDB: 2uwy_A* 2uwx_A* 2fff_B Length = 494 Back     alignment and structure
>3fwm_A Penicillin-binding protein 1B; bacterial cell WALL synthesis, antibiotics design, transferase, hydrolase; HET: M0E; 2.16A {Escherichia coli} PDB: 3fwl_A* Length = 751 Back     alignment and structure
>2olv_A Penicillin-binding protein 2; transpeptidase fold, glycosyltransferase family 51, lysozyme fold; HET: M0E; 2.80A {Staphylococcus aureus} SCOP: d.2.1.10 e.3.1.1 PDB: 2olu_A* 3dwk_A* Length = 669 Back     alignment and structure
>3hzs_A Monofunctional glycosyltransferase; transglycosylase, peptidoglycan, moenomycin, cell membrane, cell shape; HET: M0E; 2.10A {Staphylococcus aureus subsp} Length = 209 Back     alignment and structure
>2oqo_A Penicillin-binding protein 1A (PBP-1A) (PBP1A); transferase; HET: EPE CPS; 2.10A {Aquifex aeolicus VF5} SCOP: d.2.1.10 PDB: 3d3h_A* Length = 200 Back     alignment and structure
>2bg1_A PBP1B, penicillin-binding protein 1B; peptidoglycan, peptidoglycan synthesis multifunctional enzyme, cell WALL; 1.9A {Streptococcus pneumoniae} SCOP: e.3.1.1 PDB: 2uwy_A* 2uwx_A* 2fff_B Length = 494 Back     alignment and structure
>3lo7_A PBPA, penicillin-binding protein A; transpeptidase domain, cell membrane, cell shape, cell WALL biogenesis/degradation, membrane; 2.05A {Mycobacterium tuberculosis} Length = 483 Back     alignment and structure
>3lo7_A PBPA, penicillin-binding protein A; transpeptidase domain, cell membrane, cell shape, cell WALL biogenesis/degradation, membrane; 2.05A {Mycobacterium tuberculosis} Length = 483 Back     alignment and structure
>2wuq_A BLAB, beta-lactamase regulatory protein BLAB; class A beta-lactamase fold, transcription regulation, beta-lactamase induction, transcription; 1.80A {Streptomyces cacaoi} Length = 318 Back     alignment and structure
>1k38_A Penicillinase, beta-lactamase OXA-2; serine beta-lactamase, hydrolase, antibiotic resistance, carbamylated lysine; HET: KCX; 1.50A {Salmonella typhimurium} SCOP: e.3.1.1 Length = 254 Back     alignment and structure
>1k55_A Beta lactamase OXA-10; antibiotic resistance, carbamylation, hydrolase; HET: KCX SO4; 1.39A {Pseudomonas aeruginosa} SCOP: e.3.1.1 PDB: 1e4d_A* 1ewz_A 1k54_A* 1e3u_A* 1k56_A* 1k57_A* 1k4f_A* 1k4e_A* 1k6r_A* 1k6s_A* 1fof_A 1e3u_D 2hpb_A 2hp9_A 2hp6_A 2wgi_A* 2rl3_A* 2hp5_A 1h8z_A 1h8y_A* ... Length = 246 Back     alignment and structure
>3hbr_A OXA-48; class D beta-lactamase, antibiotic, dimer, hydrolase; HET: KCX; 1.90A {Klebsiella pneumoniae} Length = 265 Back     alignment and structure
>3g4p_A Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme mechanism, carbapenem, resistance, hydrolase; HET: KCX; 1.97A {Acinetobacter baumannii} PDB: 2jc7_A* 3fyz_A* 3fzc_A* 3fv7_A* Length = 244 Back     alignment and structure
>3equ_A PBP-2, penicillin-binding protein 2; class B transpeptidase, cell division, cell inner membrane, cell membrane, cell shape; HET: SEP; 2.40A {Neisseria gonorrhoeae} PDB: 3eqv_A* Length = 542 Back     alignment and structure
>1nrf_A Regulatory protein BLAR1; penicillin-receptor, beta-lactamase induction, penicillin-binding protein, membrane protein; 2.50A {Bacillus licheniformis} SCOP: e.3.1.1 Length = 262 Back     alignment and structure
>1xkz_A Regulatory protein BLAR1; beta-lactam receptor, signal transduction, signaling protein; HET: CAZ EPE; 1.75A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1xa1_A* 1xa7_A* Length = 255 Back     alignment and structure
>2wad_A Penicillin-binding protein 2B; peptidoglycan synthesis, transmembrane, antibiotic resistance, cell shape, peptidoglycan, cell membrane; 2.18A {Streptococcus pneumoniae} PDB: 2wae_A 2waf_A Length = 680 Back     alignment and structure
>2iwb_A Methicillin resistance MECR1 protein; antibiotic resistance, bacterial antibiotic resistance, methicillin resistance, beta-lactamic antibiotics, MRSA; 1.8A {Staphylococcus aureus} PDB: 2iwc_A* 2iwd_A* Length = 246 Back     alignment and structure
>3isg_A Penicillinase, beta-lactamase OXA-1; hydrolase, lysine carboxylation, antibiotic resistance, plasmid, transposable element; HET: KCX DRW; 1.40A {Escherichia coli} PDB: 1m6k_A* Length = 251 Back     alignment and structure
>2v2f_F Penicillin binding protein 1A; transpeptidase activity, peptidoglycan synthesis, transferase, hydrolase; HET: MES; 1.9A {Streptococcus pneumoniae} PDB: 2zc6_B* 2zc5_B* 2c6w_B 2c5w_B* Length = 390 Back     alignment and structure
>3oc2_A Penicillin-binding protein 3; structu genomics, oxford protein production facility, OPPF, transpe cell WALL biosynthesis; 1.97A {Pseudomonas aeruginosa} PDB: 3ocl_A* 3ocn_A* Length = 564 Back     alignment and structure
>1qme_A Penicillin-binding protein 2X; peptidoglycan synthesis, resistance, cell WALL, transmembrane; 2.4A {Streptococcus pneumoniae} SCOP: d.11.1.1 d.11.1.1 d.175.1.1 e.3.1.1 PDB: 1qmf_A* 1pyy_A* 1rp5_A 1pmd_A 1k25_A 2zc3_B* 2z2l_B* 2z2m_B* 2zc4_B* 2zc3_A* 2z2l_A* 2z2m_A* 2zc4_A* 2zc3_C* 2z2l_C* 2z2m_C* 2zc4_C* Length = 702 Back     alignment and structure
>2v2f_F Penicillin binding protein 1A; transpeptidase activity, peptidoglycan synthesis, transferase, hydrolase; HET: MES; 1.9A {Streptococcus pneumoniae} PDB: 2zc6_B* 2zc5_B* 2c6w_B 2c5w_B* Length = 390 Back     alignment and structure
>1vqq_A Saupbp2A, penicillin-binding protein MECA, low-affinity; beta-lactam, D- transpeptidase, D-carboxypeptidase, biosynthetic protein; 1.80A {Staphylococcus aureus} SCOP: d.17.4.5 d.175.1.1 e.3.1.1 PDB: 1mwr_A 1mws_A* 1mwt_A* 1mwu_A* Length = 646 Back     alignment and structure
>3d0f_A Penicillin-binding 1 transmembrane protein MRCA; BIG_1156.2, structural genomics, PSI-2, protein structure initiative; 1.64A {Nitrosomonas europaea atcc 19718} Length = 106 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target817 penicillin binding peptidoglycan synthetase protein [Ca
3fwm_A751 Penicillin-binding protein 1B; bacterial cell WALL synt 100.0
2jch_A720 Penicillin-binding protein 1B; peptidoglycan synthesis 100.0
2olv_A669 Penicillin-binding protein 2; transpeptidase fold, glyc 100.0
2bg1_A494 PBP1B, penicillin-binding protein 1B; peptidoglycan, pe 100.0
2v2f_F390 Penicillin binding protein 1A; transpeptidase activity, 100.0
2wad_A680 Penicillin-binding protein 2B; peptidoglycan synthesis, 100.0
1qme_A702 Penicillin-binding protein 2X; peptidoglycan synthesis, 100.0
3lo7_A483 PBPA, penicillin-binding protein A; transpeptidase doma 100.0
2oqo_A200 Penicillin-binding protein 1A (PBP-1A) (PBP1A); transfe 100.0
3hzs_A209 Monofunctional glycosyltransferase; transglycosylase, p 100.0
3oc2_A564 Penicillin-binding protein 3; structu genomics, oxford 100.0
3equ_A542 PBP-2, penicillin-binding protein 2; class B transpepti 100.0
1vqq_A646 Saupbp2A, penicillin-binding protein MECA, low-affinity 100.0
1k38_A254 Penicillinase, beta-lactamase OXA-2; serine beta-lactam 100.0
1xkz_A255 Regulatory protein BLAR1; beta-lactam receptor, signal 100.0
2iwb_A246 Methicillin resistance MECR1 protein; antibiotic resist 100.0
1nrf_A262 Regulatory protein BLAR1; penicillin-receptor, beta-lac 100.0
3hbr_A265 OXA-48; class D beta-lactamase, antibiotic, dimer, hydr 100.0
3isg_A251 Penicillinase, beta-lactamase OXA-1; hydrolase, lysine 100.0
1ghp_A258 Beta-lactamase, penicillinase; hydrolase, antibiotic re 99.17
2cc1_A262 Beta-lactamase, penicillinase; hydrolase, antibiotic re 98.93
3dw0_A294 Class A carbapenemase KPC-2; beta-lactamase, antibiotic 98.63
1k55_A246 Beta lactamase OXA-10; antibiotic resistance, carbamyla 100.0
3g4p_A244 Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme me 100.0
3lez_A260 Beta-lactamase; antibiotic resistance, halotolerant, DE 98.97
2wk0_A265 Beta-lactamase; hydrolase, iodopenicillanate, antibioti 98.63
1w7f_A307 Beta-lactamase; hydrolase, isocitrate, bacillus licheni 98.54
2wuq_A318 BLAB, beta-lactamase regulatory protein BLAB; class A b 99.93
2j9o_A298 TLL2115 protein; penicillin-binding protein, hydrolase, 99.23
1m40_A263 TEM-1, beta-lactamase TEM; acylation mechanism, ultra- 99.13
2p74_A263 Beta-lactamase CTX-M-9A; ultra-high resolution, acylati 98.9
1g6a_A271 Beta-lactamase PSE-4; class A beta-lactamase, carbenici 98.88
1alq_A266 CP254 beta-lactamase; hydrolase, circular permuted, ant 98.83
1n9b_A265 Penicillinase, beta-lactamase SHV-2; beta-lactam hydrol 98.8
2qpn_A287 Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1 98.78
3p09_A290 Beta-lactamase; structural genomics, center for structu 98.74
1hzo_A271 Beta-lactamase; mixed alpha/beta, cephalosporinase, hyd 98.66
1bue_A265 Protein (imipenem-hydrolysing beta-lactamase); hydrolas 98.66
1o7e_A276 L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrop 98.63
3c5a_A264 Class A carbapenemase KPC-2; beta-lactamase, C-terminal 98.62
3m6b_A265 Beta-lactamase, penicillinase; alpha-beta structure, an 98.58
1bsg_A266 Beta lactamase, penicillinase; hydrolase, antibiotic re 98.46
3cjm_A282 Putative beta-lactamase; NP_815223.1, structural genomi 98.31
1e25_A282 Extended-spectrum beta-lactamase PER-1; hydrolase, anti 98.08
3d0f_A106 Penicillin-binding 1 transmembrane protein MRCA; BIG_11 98.09
3mfd_A334 D-alanyl-D-alanine carboxypeptidase DACB; penicillin-bi 97.26
1es5_A262 DD-transpeptidase; penicillin-binding, serine peptidase 96.83
2bcf_A276 Probable D-alanyl-D-alanine carboxypeptidase DACB2; pen 96.26
1z6f_A363 Penicillin-binding protein 5; peptidoglycan synthesis, 95.79
3ita_A352 D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-b 95.45
3a3j_A344 PBP5; penicillin binding protein 5, DACA, hydrolase; 2. 95.05
2wad_A680 Penicillin-binding protein 2B; peptidoglycan synthesis, 95.52
2pby_A308 Glutaminase; secsg, riken, structural genomics, PSI, pr 95.36
3ih8_A456 Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcu 95.19
3czd_A315 Glutaminase kidney isoform; glutamine, glutamate, K-glu 95.09
1mki_A330 Probable glutaminase YBGJ; structural genomics, PSI, pr 95.04
1u60_A310 Probable glutaminase YBAS; structural genomics, APC5046 93.84
1xp4_A379 D-alanyl-D-alanine carboxypeptidase; five-stranded anti 95.27
3hun_A453 Penicillin-binding protein 4; ampicillin, beta-lactamas 95.18
1tvf_A369 PBP4, penicillin binding protein 4; structural genomics 94.35
3a3d_A453 PBP4, penicillin-binding protein 4; DACB, hydrolase; 1. 91.84
>3fwm_A Penicillin-binding protein 1B; bacterial cell WALL synthesis, antibiotics design, transferase, hydrolase; HET: M0E; 2.16A {Escherichia coli} PDB: 3fwl_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=1262.40  Aligned_cols=586  Identities=29%  Similarity=0.457  Sum_probs=536.6

Q ss_pred             CCEEEEEE---CCCEEEECHHHCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
Q ss_conf             94966661---256046417996978885454332146113387379999999999863204788677611479998888
Q gi|254780752|r   60 GALMAEYA---RENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIFGIMRAVLHNIRNISHGRRPEGASTITQQVAKN  136 (817)
Q Consensus        60 G~~i~~~~---~~~R~~v~~~~ip~~l~~A~iA~ED~rFy~H~GvD~~gi~RA~~~ni~~~~~g~~~qGgSTITQQlaKn  136 (817)
                      ..+|+.++   .|+|++|++++||++|++||||+||+|||+|+|||++||+||++.||+   +|+.+|||||||||||||
T Consensus       146 p~~i~~~~~~~~e~R~~v~~~~iP~~l~~A~la~ED~~Fy~H~Gvd~~~i~RA~~~nl~---~g~~~qGgSTiTQQl~Kn  222 (751)
T 3fwm_A          146 PRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLT---AGRTVQGASTLTQQLVKN  222 (751)
T ss_dssp             CCEEEEECCTTSEECCCCCSTTSCHHHHHHHTTTC------------------------------------CHHHHHHHH
T ss_pred             CHHEEEECCCCCCCEEECCHHHCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCC---CCCCCCCCCCHHHHHHHH
T ss_conf             23505642688873567176996999985502052574135798099999999999711---788477714099999876


Q ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCC----CCCHHHHHHHHHCCCHHHCCCCCEEEEEEECC
Q ss_conf             77088832999999999999998660799999997201426743----31099999987354234403027125444015
Q gi|254780752|r  137 FLLTSNQTMDRKIKEILLSFRLEKAYDKEKILEFYLNEIFFGFN----SYGIASAALTYFNKSVSELTIEEAAYLAALPK  212 (817)
Q Consensus       137 ~~l~~e~t~~RK~~E~~lA~~lE~~~sK~eILe~YLN~v~~G~~----~yGv~aAA~~YF~K~~~dLtl~EaA~LAgi~~  212 (817)
                      +|+++|||+.||++|+++|++||++||||||||+|||.||||++    +|||++||++||||+++|||++|||+||||+|
T Consensus       223 ~~l~~ert~~RK~~E~~~A~~lE~~ysK~eILe~YLN~vy~G~~~~~~i~Gi~~Aa~~YFgk~~~~L~l~e~A~Lagl~k  302 (751)
T 3fwm_A          223 LFLSSERSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVK  302 (751)
T ss_dssp             HHCCSCCHHHHHHHHHHHHHHHHHHSCHHHHHHHHTTTCEEEEETTEEEESHHHHHHHHTSSCGGGCCHHHHHHHHHHTT
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHEEECCCCCCCCCHHHHHHHHHHCCCCHHHHCCHHHHHHEEECC
T ss_conf             11689888899999999999999986999999997632636789767404299999988299978948315377653267


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHCC
Q ss_conf             76433211111466789988876665420111256888753011124454322234571567998853110012433125
Q gi|254780752|r  213 GPSNYDPFRKNKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQLIDRYGEKALYE  292 (817)
Q Consensus       213 ~Ps~y~P~~np~~a~~Rr~~VL~~M~~~g~It~~e~~~a~~~~i~~~~~~~~~~~~~a~yf~e~V~~~l~~~~ge~~l~~  292 (817)
                      +||.|||++||+++++|||+||++|+++|+||++||++|+++|+.+...  ......+|||+++|++||.+.++++.++.
T Consensus       303 ~Ps~y~P~~~p~~a~~Rr~~VL~~m~~~g~It~~~~~~a~~~pl~~~~~--~~~~~~~p~f~~~v~~el~~~~~~~~~~~  380 (751)
T 3fwm_A          303 GASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPR--GGVISPQPAFMQLVRQELQAKLGDKVKDL  380 (751)
T ss_dssp             CTTTSCTTTCSHHHHHHHHHHHTC-----------------------------CCSSSHHHHHHHHHHHHHHHTTSSTTS
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCC--CCCCCCCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             8876786547899999889999888861556699999997373324555--55566566899999999987515531246


Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCEEEEE
Q ss_conf             73289852488898999999998767654443210000001211248877863332013355541047652144026765
Q gi|254780752|r  293 DGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWGNTLASIPTLYDVPEWDIAVVLEVSNSHITIGI  372 (817)
Q Consensus       293 ~Gl~I~TTiD~~lQ~~Ae~ai~~~l~~~d~~~g~rg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~  372 (817)
                      +|++||||||+++|++||+++.+.+..++.+..                                               
T Consensus       381 ~Gl~I~TTLD~~lQ~~ae~al~~~l~~~~~~~~-----------------------------------------------  413 (751)
T 3fwm_A          381 SGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRK-----------------------------------------------  413 (751)
T ss_dssp             SSCEEEECCCHHHHHHHHHHHHHHHHHHHHHHT-----------------------------------------------
T ss_pred             CCCEEEECCCHHHHHHHHHHHHHCCCCCCCCCC-----------------------------------------------
T ss_conf             882798216889999999988740432122345-----------------------------------------------


Q ss_pred             ECCCCCCCCEECCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCEEEEECCCCCC
Q ss_conf             20334431000024442348889665200112233321000013646310123566515775225553116640656666
Q gi|254780752|r  373 RPTIDSNGKVTTERKKGIIEADSMRWVYNKEQTTEETSENRNVLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGR  452 (817)
Q Consensus       373 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~gd~i~i~~~~~~~~l~~~p~~q~a~V~id~~TG~  452 (817)
                                                                                     .+..|+|+|+|||+||+
T Consensus       414 ---------------------------------------------------------------~~~~~gA~Vv~Dp~TGe  430 (751)
T 3fwm_A          414 ---------------------------------------------------------------LSDLETAIVVVDRFSGE  430 (751)
T ss_dssp             ---------------------------------------------------------------CSCCEEEEEEEETTTCB
T ss_pred             ---------------------------------------------------------------CCCCCEEEEEEECCCCC
T ss_conf             ---------------------------------------------------------------66663589998689997


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCC--CCCCCCCCCCEEEEECC-CCEEEEEECCCC--CCCHH
Q ss_conf             11787213234443320012335665310000127887402--46654456523788037-852666412765--44225
Q gi|254780752|r  453 ILATIGGFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSG--YTPASVIMDAPIEVVSR-GKIWKPENYSKN--FSGAS  527 (817)
Q Consensus       453 IlA~vGg~d~~~~~~NrA~~~~rqpGSt~KP~vy~~Ale~G--~tp~t~~~D~p~~~~~~-~~~~~p~N~~~~--~~G~i  527 (817)
                      |+|||||++|+.+.||||+++.|||||+||||+|++||++|  +++++.+.|.|+.+..+ +..|+|+|+++.  ++|.|
T Consensus       431 IlAmvGg~~~~~~~fNra~~a~r~pGSt~KP~~y~aAL~~g~~~~~~t~~~D~p~~~~~~~g~~~~p~n~d~~~~~~G~v  510 (751)
T 3fwm_A          431 VRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRV  510 (751)
T ss_dssp             EEEEECSSSCSSCSSCHHHHCCEECGGGGHHHHHHHHHTCTTTCCTTCEEECSCCCEECSSSCEECCCCTTSCCCTTSEE
T ss_pred             EEEEECCCCCCCCCCCCHHCCCCCCCCCCCHHHHHHHHHCCCCCCCCEEECCCCEEEECCCCCCCCCCCCCCCCCCCCCE
T ss_conf             89996444234455550001344555545417899999738874453374267637757998531786677665787623


Q ss_pred             HHHHHHHHHCCHHHHHHHHHCCCCEEEEEECCCCCC-CCCCCCCCCCCCCCEEHHHHHHHHHHHCCCCCEEEEEEEEEEE
Q ss_conf             666666530440225887625972352110135565-5567665634451000037767432201574403544666764
Q gi|254780752|r  528 TLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIY-DKMLPVLPMSLGAGETTVLRMVSAYAVFANGGKQIRPSFIDRI  606 (817)
Q Consensus       528 tl~~Al~~S~N~~~v~l~~~~G~~~~~~~~~~~Gi~-~~~~~~~s~alG~~~vtpl~la~aya~~AN~G~~~~P~~i~kI  606 (817)
                      ++++||++|+|++++++++++|++++.+++++|||. ....+.++++||+.++||+|||+||++|||+|++++||+|++|
T Consensus       511 ~l~~AL~~S~N~~~v~l~~~lG~~~~~~~~~k~Gi~~~~~~~~ps~~lG~~~vTPlqmA~aYatiANgG~~~~P~~I~~I  590 (751)
T 3fwm_A          511 MLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSV  590 (751)
T ss_dssp             EHHHHHHTTCHHHHHHHHHHHCHHHHHHHHHHHTCCGGGCCCSGGGGGTCCEECHHHHHHHHHHHHTTSEECCCBSEEEE
T ss_pred             EHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHCCCEEECCEEEEEE
T ss_conf             14334340235999999886280899999998499855678980665388625788988899999749858356899999


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCHHHHHHHHHHHHHHHHCCCEEH--HCCCCCCEEEEECCC
Q ss_conf             102443013358532355666666655455467554353589999999999999873480432--105996046760467
Q gi|254780752|r  607 QNRYGKTIFNQEQRICDDCNYDTWNGQDEPEIIDKREQVLDPMTAYQITSMLEGVIKHGTATG--KVRLNRPVAGKTGTT  684 (817)
Q Consensus       607 ~d~~G~vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~s~~~a~~~~~~L~~vv~~GTg~~--a~~~~~~iaGKTGTt  684 (817)
                      +|++|++|+++.+                     ..++|+|+++|++|++||+.||++|||++  +...++++|||||||
T Consensus       591 ~d~dG~vi~~~~~---------------------~~~~vis~~tA~~v~~~M~~VV~~GTg~~~~~~~~~~~vAGKTGTT  649 (751)
T 3fwm_A          591 IAEDGKVLYQSFP---------------------QAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTT  649 (751)
T ss_dssp             ECTTSCEEEECCC---------------------CCEECSCHHHHHHHHHHHHHHHHTSTTHHHHHHSGGGCCEEEEEEC
T ss_pred             ECCCCCEEECCCC---------------------CCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHCCCCCCEEEEECCCC
T ss_conf             9899988703689---------------------7763689999999999999875556730011238997599988637


Q ss_pred             CCCCCEEEEEECCCEEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECHHHCCCCCC
Q ss_conf             89702279845698799999826689827898644212179999999999748983006797771699840322775889
Q gi|254780752|r  685 SSYRDTWFIGYTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIPINKWTGMLSKK  764 (817)
Q Consensus       685 ~~~~D~WfvG~tp~~~~~vWvG~D~~~~~~~~~~G~~~a~piw~~~m~~~~~~~p~~~f~~P~~iv~~~i~~~sG~la~~  764 (817)
                      |+++|+||+||+|+|+++||||+|+++++  +.+|++.|+|||++||+.+  ...+.+|++|+||+.+.||..+|.+   
T Consensus       650 ~~~rDaWFvG~tp~~~~~VWvG~Ddn~~~--~~tG~~~Aapiw~~~m~~~--~~~~~~~~~P~~i~~~~i~~~~g~~---  722 (751)
T 3fwm_A          650 NNNVDTWFAGIDGSTVTITWVGRDNNQPT--KLYGASGAMSIYQRYLANQ--TPTPLNLVPPEDIADMGVDYDGNFV---  722 (751)
T ss_dssp             GGGSEEEEEEECSSEEEEEEEECTTCCCC--CCCTTHHHHHHHHHHHHSS--CCCCCCCCCCTTEEEEEECTTSCEE---
T ss_pred             CCCCEEEEEECCCCEEEEEEEECCCCCCC--CCCHHHHHHHHHHHHHHCC--CCCCCCCCCCCCEEEEEECCCCCCC---
T ss_conf             99705999985899699999977899978--7844599999999999607--7888788998980588875887867---


Q ss_pred             CCCCEEEEEECCCCCCCCCCCCCCC
Q ss_conf             9976089953178999865677776
Q gi|254780752|r  765 GDPDTIIEAFKPGTGPAETYTVIDE  789 (817)
Q Consensus       765 ~~~~~~~e~f~~gt~P~~~~~~~~~  789 (817)
                       |+.+..++|+.|++|++.|..++.
T Consensus       723 -~~~~~~~~~~~~~~p~~~c~~~~~  746 (751)
T 3fwm_A          723 -CSGGMRILPVWTSDPQSLCQQSEM  746 (751)
T ss_dssp             -SSCCSEEEEEECSCTTHHHHHHTT
T ss_pred             -CCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             -999844387579998654567888



>2jch_A Penicillin-binding protein 1B; peptidoglycan synthesis multifunctional enzyme, cell WALL, peptidoglycan, gamma lactam antibiotics; HET: PL7; 2.4A {Streptococcus pneumoniae} PDB: 2jci_A* 2je5_A* Back     alignment and structure
>2olv_A Penicillin-binding protein 2; transpeptidase fold, glycosyltransferase family 51, lysozyme fold; HET: M0E; 2.80A {Staphylococcus aureus} SCOP: d.2.1.10 e.3.1.1 PDB: 2olu_A* 3dwk_A* Back     alignment and structure
>2bg1_A PBP1B, penicillin-binding protein 1B; peptidoglycan, peptidoglycan synthesis multifunctional enzyme, cell WALL; 1.9A {Streptococcus pneumoniae} SCOP: e.3.1.1 PDB: 2xd5_A* 2uwy_A* 2xd1_A* 2uwx_A* 2fff_B Back     alignment and structure
>2v2f_F Penicillin binding protein 1A; transpeptidase activity, peptidoglycan synthesis, transferase, hydrolase; HET: MES; 1.9A {Streptococcus pneumoniae} PDB: 2zc6_B* 2zc5_B* 2c6w_B 2c5w_B* Back     alignment and structure
>2wad_A Penicillin-binding protein 2B; peptidoglycan synthesis, transmembrane, antibiotic resistance, cell shape, peptidoglycan, cell membrane; 2.18A {Streptococcus pneumoniae} PDB: 2wae_A 2waf_A Back     alignment and structure
>1qme_A Penicillin-binding protein 2X; peptidoglycan synthesis, resistance, cell WALL, transmembrane; 2.4A {Streptococcus pneumoniae} SCOP: d.11.1.1 d.11.1.1 d.175.1.1 e.3.1.1 PDB: 1qmf_A* 1pyy_A* 1rp5_A 1pmd_A 1k25_A 2zc3_B* 2z2l_B* 2z2m_B* 2zc4_B* 2zc3_A* 2z2l_A* 2z2m_A* 2zc4_A* 2zc3_C* 2z2l_C* 2z2m_C* 2zc4_C* Back     alignment and structure
>3lo7_A PBPA, penicillin-binding protein A; transpeptidase domain, cell membrane, cell shape, cell WALL biogenesis/degradation, membrane; 2.05A {Mycobacterium tuberculosis} Back     alignment and structure