254780753

254780753

peptide chain release factor 2

GeneID in NCBI database:8209758Locus tag:CLIBASIA_03200
Protein GI in NCBI database:254780753Protein Accession:YP_003065166.1
Gene range:-(513525, 514592)Protein Length:355aa
Gene description:peptide chain release factor 2
COG prediction:[J] Protein chain release factor B
KEGG prediction:prfB; peptide chain release factor 2; K02836 peptide chain release factor RF-2
SEED prediction:Peptide chain release factor 2; programmed frameshift-containing
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Translation termination factors bacterial;
Programmed frameshift;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MKLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIKK
ccHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEEEEEcccHHHHHHHccccEEEEEccccccccccccEEEEEEEcccccccccccccHHHcEEEEEEcccccccccccccEEEEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHccccccccHHHHcccHHHHHHHHHHHcc
ccHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccEEEEEEEEEcccccEHEHcccccEEEEEEccccccccccccEEEEEEcccccccEEEEEcHHHcEEEEEEEccccccEEcccccEEEEEEccccEEEEccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHEEEEccHHHHHHcccccccccccEEcccccHHHHHHHHHHcc
mklsrqlnclgglfdwdnAVQRLSFlntktedphLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLlsgeadsndaylevhagaggtesQDWANMLLRMYTRWAEKRKFKTEaleihdgeeagIKSATLLikgpnaygwlkgeqgvhrlvrispydsnsrrhtsfssiwvypvvddsieieisesdcridtyrasgaggqhvnttdsavrithiptgvVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANigesskteigwgrqirsyvlqPYQMVKDLRTniektspsdvldgdLDDFMKATLAIKK
MKLSRQLNCLGGLFDWDNAVQRLSFlntktedphLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAgaggtesqdWANMLLRMYTRWAEKRKFKTEAleihdgeeagiksaTLLIKGPNAYGWLKGEQGVHRLVRISpydsnsrrhtsfssiwvypvVDDSIEIEISESDCRIDTyrasgaggqhvnttdSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIAnigesskteigwgrqIRSYVLQPYQMVKDLRTNiektspsdvldgdlDDFMKATLAIKK
MKLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRlcdnlillelaleeddCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVddsieieisesdCRIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIKK
********CLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIE***********DNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVQCQQERSQ*KNKAQAWNMLRAKLYE********************GWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIK*
MKLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVQ************QAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIKK
MKLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIKK
MKLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIKK
MKLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target355 peptide chain release factor 2 [Candidatus Liberibacter
254780874357 peptide chain release factor 1 [Candidatus Liberib 1e-44
>gi|254780874|ref|YP_003065287.1| peptide chain release factor 1 [Candidatus Liberibacter asiaticus str. psy62] Length = 357 Back     alignment
 Score =  171 bits (434), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 145/243 (59%), Gaps = 10/243 (4%)

Query: 113 DSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLI 172
           D     LE+ AG GG+E+  +   L RMY R+A  RK+K E L   D ++ G K     I
Sbjct: 108 DDKSCILEIRAGTGGSEAALFVGDLFRMYERYAALRKWKVEVLSSSDNDDGGYKEIVATI 167

Query: 173 KGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDT 232
            G   +  +K E GVHR+ R+   +++ R HTS +++ V P   + I+++I   D RIDT
Sbjct: 168 SGRGVFSRMKFESGVHRVQRVPATEASGRVHTSAATVAVLPEAAE-IDVDIPLEDIRIDT 226

Query: 233 YRASGAGGQHVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKR 292
            RASG+GGQHVNTTDSAVRITHIPTG++V    E+SQH+N+ +A  +LRA+LY++E   R
Sbjct: 227 MRASGSGGQHVNTTDSAVRITHIPTGIMV-TSSEKSQHQNRLRAMKVLRARLYDVE---R 282

Query: 293 EEIANIGESS-KTEIGWG---RQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMK 348
           + +AN   ++ K +IG G    +IR+Y     + + D R N+       VL G +DD + 
Sbjct: 283 KRMANERSANRKLQIGSGDRSERIRTYNFSQGR-ITDHRINLTLYKLEYVLQGYIDDIIN 341

Query: 349 ATL 351
             L
Sbjct: 342 PLL 344

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target355 peptide chain release factor 2 [Candidatus Liberibacter
315121916354 peptide chain release factor 2 [Candidatus Liberibacter 1 1e-179
241204131376 peptide chain release factor 2 [Rhizobium leguminosarum 1 1e-143
319783261376 hypothetical protein Mesci_3567 [Mesorhizobium ciceri b 1 1e-142
327190272342 peptide chain release factor 2 [Rhizobium etli CNPAF512 1 1e-141
218660225350 peptide chain release factor 2 [Rhizobium etli IE4771] 1 1e-140
15888668342 peptide chain release factor 2 [Agrobacterium tumefacie 1 1e-140
209548908376 peptide chain release factor 2 [Rhizobium leguminosarum 1 1e-140
325292702342 peptide chain release factor 2 [Agrobacterium sp. H13-3 1 1e-140
116251510342 peptide chain release factor 2 [Rhizobium leguminosarum 1 1e-138
222085647345 peptide chain release factor 2 [Agrobacterium radiobact 1 1e-137
>gi|315121916|ref|YP_004062405.1| peptide chain release factor 2 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 354 Back     alignment and organism information
 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 296/349 (84%), Positives = 329/349 (94%)

Query: 7   LNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRL 66
           +NCLGGLFDWDNA++RL FLN K E+P+LW+ V EAK+LMRERQHLDNA+S +K +QDRL
Sbjct: 1   MNCLGGLFDWDNALKRLHFLNDKAENPNLWEKVEEAKILMRERQHLDNAVSSLKALQDRL 60

Query: 67  CDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAG 126
            DN+ LL+LA+EE++ S+LQE+ DNL+++KL+ EYKQFESL SGEADSND YLEVHAGAG
Sbjct: 61  DDNIALLDLAVEENNSSVLQESLDNLKQLKLDTEYKQFESLFSGEADSNDVYLEVHAGAG 120

Query: 127 GTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQG 186
           GTESQDWANML+RMY RW+E+RKFK + LE+HDGEEAGIKSATLLIKGPNAYGWLK EQG
Sbjct: 121 GTESQDWANMLVRMYIRWSERRKFKIDLLEVHDGEEAGIKSATLLIKGPNAYGWLKEEQG 180

Query: 187 VHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQHVNTT 246
           VHRLVRISPYDSNSRRHTSFSS+WVYPVVD+SIEIEI+ESDCRIDTYRASGAGGQHVNTT
Sbjct: 181 VHRLVRISPYDSNSRRHTSFSSVWVYPVVDESIEIEINESDCRIDTYRASGAGGQHVNTT 240

Query: 247 DSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEI 306
           DSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLY+LELQKREEIANIGESSKTEI
Sbjct: 241 DSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYDLELQKREEIANIGESSKTEI 300

Query: 307 GWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIKK 355
           GWGRQIRSYVLQPYQMVKDLRTNIEK+SP DVL+GDLDDFMKA LA+KK
Sbjct: 301 GWGRQIRSYVLQPYQMVKDLRTNIEKSSPLDVLNGDLDDFMKAALALKK 349


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241204131|ref|YP_002975227.1| peptide chain release factor 2 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 376 Back     alignment and organism information
>gi|319783261|ref|YP_004142737.1| hypothetical protein Mesci_3567 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 376 Back     alignment and organism information
>gi|327190272|gb|EGE57372.1| peptide chain release factor 2 [Rhizobium etli CNPAF512] Length = 342 Back     alignment and organism information
>gi|218660225|ref|ZP_03516155.1| peptide chain release factor 2 [Rhizobium etli IE4771] Length = 350 Back     alignment and organism information
>gi|15888668|ref|NP_354349.1| peptide chain release factor 2 [Agrobacterium tumefaciens str. C58] Length = 342 Back     alignment and organism information
>gi|209548908|ref|YP_002280825.1| peptide chain release factor 2 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 376 Back     alignment and organism information
>gi|325292702|ref|YP_004278566.1| peptide chain release factor 2 [Agrobacterium sp. H13-3] Length = 342 Back     alignment and organism information
>gi|116251510|ref|YP_767348.1| peptide chain release factor 2 [Rhizobium leguminosarum bv. viciae 3841] Length = 342 Back     alignment and organism information
>gi|222085647|ref|YP_002544177.1| peptide chain release factor 2 [Agrobacterium radiobacter K84] Length = 345 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 peptide chain release factor 2 [Candidatus Liberibacter
PRK00578367 PRK00578, prfB, peptide chain release factor 2; Validat 1e-159
PRK07342339 PRK07342, PRK07342, peptide chain release factor 2; Pro 1e-157
TIGR00020364 TIGR00020, prfB, peptide chain release factor 2 1e-130
PRK05589325 PRK05589, PRK05589, peptide chain release factor 2; Pro 1e-100
PRK00591359 PRK00591, prfA, peptide chain release factor 1; Validat 3e-73
COG0216363 COG0216, PrfA, Protein chain release factor A [Translat 5e-70
TIGR00019360 TIGR00019, prfA, peptide chain release factor 1 2e-69
PRK08787313 PRK08787, PRK08787, peptide chain release factor 2; Pro 1e-93
PRK06746326 PRK06746, PRK06746, peptide chain release factor 2; Pro 5e-85
KOG2726386 KOG2726, KOG2726, KOG2726, Mitochondrial polypeptide ch 1e-73
pfam00472114 pfam00472, RF-1, RF-1 domain 2e-43
pfam03462115 pfam03462, PCRF, PCRF domain 2e-36
TIGR03072200 TIGR03072, release_prfH, putative peptide chain release 4e-26
PRK08179200 PRK08179, prfH, peptide chain release factor-like prote 2e-23
PRK09256138 PRK09256, PRK09256, hypothetical protein; Provisional 3e-08
COG1186239 COG1186, PrfB, Protein chain release factor B [Translat 1e-104
>gnl|CDD|179072 PRK00578, prfB, peptide chain release factor 2; Validated Back     alignment and domain information
>gnl|CDD|168914 PRK07342, PRK07342, peptide chain release factor 2; Provisional Back     alignment and domain information
>gnl|CDD|161667 TIGR00020, prfB, peptide chain release factor 2 Back     alignment and domain information
>gnl|CDD|180152 PRK05589, PRK05589, peptide chain release factor 2; Provisional Back     alignment and domain information
>gnl|CDD|179074 PRK00591, prfA, peptide chain release factor 1; Validated Back     alignment and domain information
>gnl|CDD|30565 COG0216, PrfA, Protein chain release factor A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129130 TIGR00019, prfA, peptide chain release factor 1 Back     alignment and domain information
>gnl|CDD|136970 PRK08787, PRK08787, peptide chain release factor 2; Provisional Back     alignment and domain information
>gnl|CDD|75726 PRK06746, PRK06746, peptide chain release factor 2; Provisional Back     alignment and domain information
>gnl|CDD|37937 KOG2726, KOG2726, KOG2726, Mitochondrial polypeptide chain release factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144168 pfam00472, RF-1, RF-1 domain Back     alignment and domain information
>gnl|CDD|146218 pfam03462, PCRF, PCRF domain Back     alignment and domain information
>gnl|CDD|132116 TIGR03072, release_prfH, putative peptide chain release factor H Back     alignment and domain information
>gnl|CDD|181271 PRK08179, prfH, peptide chain release factor-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|181730 PRK09256, PRK09256, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|31379 COG1186, PrfB, Protein chain release factor B [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 355 peptide chain release factor 2 [Candidatus Liberibacter
TIGR00020373 prfB peptide chain release factor 2; InterPro: IPR00437 100.0
TIGR00019373 prfA peptide chain release factor 1; InterPro: IPR00437 100.0
PRK00578367 prfB peptide chain release factor 2; Validated 100.0
PRK07245337 consensus 100.0
PRK00591360 prfA peptide chain release factor 1; Validated 100.0
COG0216363 PrfA Protein chain release factor A [Translation, ribos 100.0
KOG2726386 consensus 100.0
PRK05589325 peptide chain release factor 2; Provisional 100.0
PRK06746326 peptide chain release factor 2; Provisional 100.0
PRK07342322 peptide chain release factor 2; Provisional 100.0
PRK08787313 peptide chain release factor 2; Provisional 100.0
COG1186239 PrfB Protein chain release factor B [Translation, ribos 100.0
TIGR03072200 release_prfH putative peptide chain release factor H. M 100.0
PRK08179204 prfH peptide chain release factor-like protein; Reviewe 100.0
pfam00472114 RF-1 RF-1 domain. This domain is found in peptide chain 100.0
pfam03462115 PCRF PCRF domain. This domain is found in peptide chain 100.0
PRK09256138 hypothetical protein; Provisional 99.64
KOG3429172 consensus 98.89
PRK11147 632 ABC transporter ATPase component; Reviewed 95.63
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 94.82
TIGR00019373 prfA peptide chain release factor 1; InterPro: IPR00437 92.81
>TIGR00020 prfB peptide chain release factor 2; InterPro: IPR004374 In many but not all taxa, there is a conserved real translational frameshift at a TGA codon Back     alignment and domain information
>TIGR00019 prfA peptide chain release factor 1; InterPro: IPR004373 This family describes peptide chain release factor 1 (PrfA, RF-1), and excludes the related peptide chain release factor 2 (PrfB, RF-2) Back     alignment and domain information
>PRK00578 prfB peptide chain release factor 2; Validated Back     alignment and domain information
>PRK07245 consensus Back     alignment and domain information
>PRK00591 prfA peptide chain release factor 1; Validated Back     alignment and domain information
>COG0216 PrfA Protein chain release factor A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2726 consensus Back     alignment and domain information
>PRK05589 peptide chain release factor 2; Provisional Back     alignment and domain information
>PRK06746 peptide chain release factor 2; Provisional Back     alignment and domain information
>PRK07342 peptide chain release factor 2; Provisional Back     alignment and domain information
>PRK08787 peptide chain release factor 2; Provisional Back     alignment and domain information
>COG1186 PrfB Protein chain release factor B [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03072 release_prfH putative peptide chain release factor H Back     alignment and domain information
>PRK08179 prfH peptide chain release factor-like protein; Reviewed Back     alignment and domain information
>pfam00472 RF-1 RF-1 domain Back     alignment and domain information
>pfam03462 PCRF PCRF domain Back     alignment and domain information
>PRK09256 hypothetical protein; Provisional Back     alignment and domain information
>KOG3429 consensus Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00019 prfA peptide chain release factor 1; InterPro: IPR004373 This family describes peptide chain release factor 1 (PrfA, RF-1), and excludes the related peptide chain release factor 2 (PrfB, RF-2) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target355 peptide chain release factor 2 [Candidatus Liberibacter
1ml5_Z365 Structure Of The E. Coli Ribosomal Termination Comp 8e-76
1mi6_A365 Docking Of The Modified Rf2 X-Ray Structure Into Th 2e-75
1gqe_A365 Polypeptide Chain Release Factor 2 (Rf2) From Esche 1e-74
2ihr_1365 Rf2 Of Thermus Thermophilus Length = 365 3e-62
2x9r_Y351 Structure Of The 70s Ribosome Bound To Release Fact 5e-62
2jl7_Y351 Insights Into Translational Termination From The St 7e-62
2b9m_Y365 30s Ribosomal Subunit, Trnas, Mrna And Release Fact 2e-61
3f1e_X378 Crystal Structure Of A Translation Termination Comp 3e-60
2b3t_B360 Molecular Basis For Bacterial Class 1 Release Facto 8e-57
2b64_Y354 30s Ribosomal Subunit, Trnas, Mrna And Release Fact 5e-53
1zbt_A371 Crystal Structure Of Peptide Chain Release Factor 1 4e-51
1rq0_A342 Crystal Structure Of Peptide Releasing Factor 1 Len 1e-46
2fvo_A333 Docking Of The Modified Rf1 X-Ray Structure Into Th 2e-46
gi|28373696|pdb|1ML5|Z Chain Z, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 Length = 365 Back     alignment and structure
 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 184/351 (52%), Positives = 237/351 (67%), Gaps = 1/351 (0%)

Query: 3   LSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEI 62
           L+ + + L G  D+D   +RL  +N + E P +W     A+ L +ER  L+  +  + ++
Sbjct: 14  LTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERAQALGKERSSLEAVVDTLDQM 73

Query: 63  QDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVH 122
           +  L D   LLELA+E DD     E    L  ++ ++   +F  + SGE DS D YL++ 
Sbjct: 74  KQGLEDVSGLLELAVEADDEETFNEAVAELDALEEKLAQLEFRRMFSGEYDSADCYLDIQ 133

Query: 123 AGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLK 182
           AG+GGTE+QDWA+ML RMY RWAE R FKTE +E  +GE AGIKS T+ I G  AYGWL+
Sbjct: 134 AGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGEVAGIKSVTIKISGDYAYGWLR 193

Query: 183 GEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQH 242
            E GVHRLVR SP+DS  RRHTSFSS +VYP VDD I+IEI+ +D RID YR SGAGGQH
Sbjct: 194 TETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRTSGAGGQH 253

Query: 243 VNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESS 302
           VN T+SAVRITHIPTG+V QCQ +RSQHKNK QA   ++AKLYELE+QK+       E +
Sbjct: 254 VNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYELEMQKKNAEKQAMEDN 313

Query: 303 KTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAI 353
           K++IGWG QIRSYVL     +KDLRT +E  +   VLDG LD F++A+L  
Sbjct: 314 KSDIGWGSQIRSYVLDD-SRIKDLRTGVETRNTQAVLDGSLDQFIEASLKA 363


>gi|28373662|pdb|1MI6|A Chain A, Docking Of The Modified Rf2 X-Ray Structure Into The Low Resolution Cryo-Em Map Of Rf2 E.Coli 70s Ribosome Length = 365 Back     alignment and structure
>gi|20663625|pdb|1GQE|A Chain A, Polypeptide Chain Release Factor 2 (Rf2) From Escherichia Coli Length = 365 Back     alignment and structure
>gi|134104518|pdb|2IHR|1 Chain 1, Rf2 Of Thermus Thermophilus Length = 365 Back     alignment and structure
>gi|295982099|pdb|2X9R|Y Chain Y, Structure Of The 70s Ribosome Bound To Release Factor 2 And A Substrate Analog Provides Insights Into Catalysis Of Peptide Release Length = 351 Back     alignment and structure
>gi|88192320|pdb|2B9M|Y Chain Y, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf2 And Is Described In Remark 400 Length = 365 Back     alignment and structure
gi|218766794|pdb|3F1E|X Chain X, Crystal Structure Of A Translation Termination Complex Formed With Release Factor Rf2. This File Contains The 30s Subunit, Rf2, Two Trna, And Mrna Molecules Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes As Described In Remark 400. Length = 378 Back     alignment and structure
>gi|88192214|pdb|2B3T|B Chain B, Molecular Basis For Bacterial Class 1 Release Factor Methylation By Prmc Length = 360 Back     alignment and structure
gi|88192257|pdb|2B64|Y Chain Y, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf1 And Is Described In Remark 400. Length = 354 Back     alignment and structure
>gi|66361428|pdb|1ZBT|A Chain A, Crystal Structure Of Peptide Chain Release Factor 1 (Rf-1) (Smu.1085) From Streptococcus Mutans At 2.34 A Resolution Length = 371 Back     alignment and structure
gi|52695394|pdb|1RQ0|A Chain A, Crystal Structure Of Peptide Releasing Factor 1 Length = 342 Back     alignment and structure
>gi|93279782|pdb|2FVO|A Chain A, Docking Of The Modified Rf1 X-Ray Structure Into The Low Resolution Cryo-Em Map Of E.Coli 70s Ribosome Bound With Rf1 Length = 333 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 peptide chain release factor 2 [Candidatus Liberibacter
1gqe_A365 Release factor 2, RF2; protein synthesis, ribosome, mac 1e-108
2ihr_1365 Peptide chain release factor 2; mixed alpha-beta, trans 1e-71
1zbt_A371 RF-1, peptide chain release factor 1; peptide chain rel 2e-64
2b3t_B360 RF-1, peptide chain release factor 1; translation termi 9e-64
3d5a_X354 RF1, peptide chain release factor 1; ribosome, coiled c 6e-63
1rq0_A342 RF-1, peptide chain release factor 1; X-RAY, crystal, p 1e-55
2jy9_A148 Putative tRNA hydrolase domain; GFT protein structure, 1e-20
2jva_A108 Peptidyl-tRNA hydrolase domain protein; GFT hydrolase, 2e-17
1j26_A112 Immature colon carcinoma transcript 1; peptide chain re 5e-17
>1gqe_A Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli} SCOP: e.38.1.1 PDB: 1mi6_A 1ml5_Z* Length = 365 Back     alignment and structure
 Score =  388 bits (997), Expect = e-108
 Identities = 184/349 (52%), Positives = 239/349 (68%), Gaps = 1/349 (0%)

Query: 3   LSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEI 62
           L+ + + L G  D+D   +RL  +N + E P +W     A+ L +ER  L+  +  + ++
Sbjct: 14  LTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERAQALGKERSSLEAVVDTLDQM 73

Query: 63  QDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVH 122
           +  L D   LLELA+E DD     E    L  ++ ++   +F  + SGE DS D YL++ 
Sbjct: 74  KQGLEDVSGLLELAVEADDEETFNEAVAELDALEEKLAQLEFRRMFSGEYDSADCYLDIQ 133

Query: 123 AGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLK 182
           AG+GGTE+QDWA+ML RMY RWAE R FKTE +E  +GE AGIKS T+ I G  AYGWL+
Sbjct: 134 AGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGEVAGIKSVTIKISGDYAYGWLR 193

Query: 183 GEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQH 242
            E GVHRLVR SP+DS  RRHTSFSS +VYP VDD I+IEI+ +D RID YRASGAGGQH
Sbjct: 194 TETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQH 253

Query: 243 VNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESS 302
           VN T+SAVRITHIPTG+V QCQ +RSQHKNK QA   ++AKLYE+E+QK+       E +
Sbjct: 254 VNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYEVEMQKKNAEKQAMEDN 313

Query: 303 KTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATL 351
           K++IGWG QIRSYVL   + +KDLRT +E  +   VLDG LD F++A+L
Sbjct: 314 KSDIGWGSQIRSYVLDDSR-IKDLRTGVETRNTQAVLDGSLDQFIEASL 361


>2ihr_1 Peptide chain release factor 2; mixed alpha-beta, translation; 2.50A {Thermus thermophilus} PDB: 2b9m_Y* 3f1e_X 3f1g_X 2jl5_Y 2jl7_Y 2wh1_Y 2wh3_Y Length = 365 Back     alignment and structure
>1zbt_A RF-1, peptide chain release factor 1; peptide chain release factor 1 (RF-1), structural genomics, joint center for structural genomics, JCSG; 2.34A {Streptococcus mutans} Length = 371 Back     alignment and structure
>2b3t_B RF-1, peptide chain release factor 1; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: e.38.1.1 Length = 360 Back     alignment and structure
>3d5a_X RF1, peptide chain release factor 1; ribosome, coiled coil, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding; 3.21A {Thermus thermophilus HB27} PDB: 2b64_Y 3d5c_X Length = 354 Back     alignment and structure
>1rq0_A RF-1, peptide chain release factor 1; X-RAY, crystal, peptide release factor 1, ribosome, structural genomics, BSGC structure funded by NIH; 2.65A {Thermotoga maritima} SCOP: e.38.1.1 PDB: 2fvo_A Length = 342 Back     alignment and structure
>2jy9_A Putative tRNA hydrolase domain; GFT protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Length = 148 Back     alignment and structure
>2jva_A Peptidyl-tRNA hydrolase domain protein; GFT hydrolase, structural genomics, PSI-2, protein structure initiative; NMR {Pseudomonas syringae PV} Length = 108 Back     alignment and structure
>1j26_A Immature colon carcinoma transcript 1; peptide chain release factors, RF-1, the GGQ motif, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.4.1 Length = 112 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 peptide chain release factor 2 [Candidatus Liberibacter
1gqe_A365 Release factor 2, RF2; protein synthesis, ribosome, mac 100.0
2ihr_1365 Peptide chain release factor 2; mixed alpha-beta, trans 100.0
1zbt_A371 RF-1, peptide chain release factor 1; peptide chain rel 100.0
3d5a_X354 RF1, peptide chain release factor 1; ribosome, coiled c 100.0
2b3t_B360 RF-1, peptide chain release factor 1; translation termi 100.0
1rq0_A342 RF-1, peptide chain release factor 1; X-RAY, crystal, p 100.0
2jva_A108 Peptidyl-tRNA hydrolase domain protein; GFT hydrolase, 99.67
2jy9_A148 Putative tRNA hydrolase domain; GFT protein structure, 99.67
1j26_A112 Immature colon carcinoma transcript 1; peptide chain re 99.6
3err_A536 Fusion protein of microtubule binding domain from mouse 91.43
>1gqe_A Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli} SCOP: e.38.1.1 PDB: 1mi6_A 1ml5_Z* Back     alignment and structure
Probab=100.00  E-value=0  Score=992.60  Aligned_cols=352  Identities=52%  Similarity=0.847  Sum_probs=344.0

Q ss_pred             CHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             56899999886549899999999999987086600258999999999988999999999999998639999986310000
Q gi|254780753|r    2 KLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDD   81 (355)
Q Consensus         2 EL~~rl~~l~~~fDle~~~~rl~eLE~~lsdp~fW~D~~kAqkl~KE~s~L~~iV~~~~~l~~~l~Dl~eL~ELa~ee~D   81 (355)
                      +|.++++.|+++||++.++.|+.+|+.+|++|+||+||++|++++||++.|+++|+.|+.+.+.++|+.++.+|+.+++|
T Consensus        13 ~l~~~~~~l~~~ld~d~~~~rl~eLe~~l~~p~~w~D~~~a~kl~ke~~~L~~~v~~~~~l~~~~~dl~el~el~~ee~d   92 (365)
T 1gqe_A           13 DLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERAQALGKERSSLEAVVDTLDQMKQGLEDVSGLLELAVEADD   92 (365)
T ss_dssp             HHHHHHHHHHHHTTHHHHHHHHHHHHHHHHSGGGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999987679899999999999986497255499999999999999999999999999999989999988760132


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             00234566765557740158998876303457662489982177870277899999998999987753113444205454
Q gi|254780753|r   82 CSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGE  161 (355)
Q Consensus        82 ~el~eE~~~el~~l~~~le~LE~~~Lls~e~D~~nailEI~AGaGG~EA~dwA~~L~rMY~r~ae~~gwk~evi~~~~~e  161 (355)
                      .++.+++..++..+...+++|++.+||+||+|.+||||||||||||+||||||+||||||+|||+++||++++++.++|+
T Consensus        93 ~e~~~e~~~el~~l~~~l~~le~~ll~~d~~D~~nailEIrAGaGG~EA~dfA~~L~RMY~ryAE~kgwk~evid~~~~e  172 (365)
T 1gqe_A           93 EETFNEAVAELDALEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGE  172 (365)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHGGGGGCCSTTTTSCEEEEEEECSSHHHHHHHHHHHHHHHHHHHHHTTCEEEEEEEEECS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             78899999999999999999875136899665557459998479968999999999999999999859925898616777


Q ss_pred             CCCEEEEEEEEECCCCCHHHEEECCEEEEEEECCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCC
Q ss_conf             58501346885055610000010120689873046666503566887885034422211123455036998538886554
Q gi|254780753|r  162 EAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQ  241 (355)
Q Consensus       162 ~~GiK~~~~~I~G~~ayg~Lk~E~GvHRv~Ri~~~~s~gR~hTS~a~V~V~P~~~~~~~i~i~~~dl~i~~~rssg~ggq  241 (355)
                      .||||+|+|.|+|+||||+||+|+|||||||||||||+||||||||+|+|+|+++++++++|+|+||+||||||||||||
T Consensus       173 ~gGik~v~~~I~G~~aYg~Lk~EsGVHRvqRvp~tes~gR~HTS~asV~V~P~~~~~~~i~i~~~Dl~id~~rssG~GGQ  252 (365)
T 1gqe_A          173 VAGIKSVTIKISGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQ  252 (365)
T ss_dssp             SSSEEEEEEEEESTTHHHHHGGGCEEEEEEEECTTSSSCCEEEEEEEEEEEECCBTTBCCCCCGGGEEEEEECCCCSSCC
T ss_pred             CCCEEEEEEEEECCCHHHHHHHCCCCEEEEECCCCCCCCCEEEEEEEEEEECCCCCCCCEECCHHHEEEEEEECCCCCCC
T ss_conf             67327999999746725666314873036756886888847986678998257887640431657827986556888767


Q ss_pred             CCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCC
Q ss_conf             42731003588746974776655555224679999999999999999999999999987413323322210130158568
Q gi|254780753|r  242 HVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQ  321 (355)
Q Consensus       242 ~vn~t~savri~H~ptgi~v~~q~~rsq~~Nk~~a~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~g~~iRtY~~~p~~  321 (355)
                      |||||+|||||||+||||+|+||++||||+||++||++|++|||+++.++++++.+..++++.+++||+||||||| ||+
T Consensus       253 ~vNkt~saVri~H~ptgi~v~~q~ersq~~Nk~~A~~~L~~~l~~~~~~~~~~~~~~~~~~~~~~~~g~~IRtYnf-~~~  331 (365)
T 1gqe_A          253 HVNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYEVEMQKKNAEKQAMEDNKSDIGWGSQIRSYVL-DDS  331 (365)
T ss_dssp             STTSSCCEEEEEETTTCCEEEECSSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSTTCCCCCSCSEEEEEEG-GGT
T ss_pred             CCCCCCCEEEEEEECCCEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC-CCC
T ss_conf             6565343489997078649996060204778999999999999999999999999998843113557698567548-998


Q ss_pred             CCCCCCCCCEECCHHHHHCCCHHHHHHHHHHCC
Q ss_conf             331111472507977871897799999997225
Q gi|254780753|r  322 MVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIK  354 (355)
Q Consensus       322 ~v~DhR~~~~~~~~~~vl~G~ld~~i~a~l~~~  354 (355)
                      ||||||||++++|+++||+|+||+||+|||++.
T Consensus       332 rVtDhR~~~~~~~~~~vl~G~ld~~i~a~l~~~  364 (365)
T 1gqe_A          332 RIKDLRTGVETRNTQAVLDGSLDQFIEASLKAG  364 (365)
T ss_dssp             EEEETTTCCEESCHHHHHTTCCHHHHHHHHHTT
T ss_pred             CCEECCCCCEECCHHHHHCCCHHHHHHHHHHCC
T ss_conf             140306597457867876987599999999777



>2ihr_1 Peptide chain release factor 2; mixed alpha-beta, translation; 2.50A {Thermus thermophilus} PDB: 2b9m_Y* 3f1e_X 3f1g_X 2x9r_Y* 2x9t_Y* 2jl5_Y 2jl7_Y 2wh1_Y 2wh3_Y Back     alignment and structure
>1zbt_A RF-1, peptide chain release factor 1; peptide chain release factor 1 (RF-1), structural genomics, joint center for structural genomics, JCSG; 2.34A {Streptococcus mutans} Back     alignment and structure
>3d5a_X RF1, peptide chain release factor 1; ribosome, coiled coil, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding; 3.21A {Thermus thermophilus HB27} PDB: 2b64_Y 3d5c_X 3mr8_V 3ms0_V Back     alignment and structure
>2b3t_B RF-1, peptide chain release factor 1; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: e.38.1.1 Back     alignment and structure
>1rq0_A RF-1, peptide chain release factor 1; X-RAY, crystal, peptide release factor 1, ribosome, structural genomics, BSGC structure funded by NIH; 2.65A {Thermotoga maritima} SCOP: e.38.1.1 PDB: 2fvo_A Back     alignment and structure
>2jva_A Peptidyl-tRNA hydrolase domain protein; GFT hydrolase, structural genomics, PSI-2, protein structure initiative; NMR {Pseudomonas syringae PV} Back     alignment and structure
>2jy9_A Putative tRNA hydrolase domain; GFT protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1j26_A Immature colon carcinoma transcript 1; peptide chain release factors, RF-1, the GGQ motif, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.4.1 Back     alignment and structure
>3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 355 peptide chain release factor 2 [Candidatus Liberibacter
d1gqea_362 e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) 4e-87
d2b3tb1344 e.38.1.1 (B:7-354) Peptide chain release factor 1, RF1 2e-63
d1rq0a_333 e.38.1.1 (A:) Peptide chain release factor 1, RF1 {Ther 3e-55
d1j26a_112 d.50.4.1 (A:) Ict1 protein {Mouse (Mus musculus) [TaxId 1e-16
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Length = 362 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Release factor
superfamily: Release factor
family: Release factor
domain: Polypeptide chain release factor 2 (RF2)
species: Escherichia coli [TaxId: 562]
 Score =  315 bits (808), Expect = 4e-87
 Identities = 184/349 (52%), Positives = 239/349 (68%), Gaps = 1/349 (0%)

Query: 3   LSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEI 62
           L+ + + L G  D+D   +RL  +N + E P +W     A+ L +ER  L+  +  + ++
Sbjct: 11  LTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERAQALGKERSSLEAVVDTLDQM 70

Query: 63  QDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVH 122
           +  L D   LLELA+E DD     E    L  ++ ++   +F  + SGE DS D YL++ 
Sbjct: 71  KQGLEDVSGLLELAVEADDEETFNEAVAELDALEEKLAQLEFRRMFSGEYDSADCYLDIQ 130

Query: 123 AGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGWLK 182
           AG+GGTE+QDWA+ML RMY RWAE R FKTE +E  +GE AGIKS T+ I G  AYGWL+
Sbjct: 131 AGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGEVAGIKSVTIKISGDYAYGWLR 190

Query: 183 GEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQH 242
            E GVHRLVR SP+DS  RRHTSFSS +VYP VDD I+IEI+ +D RID YRASGAGGQH
Sbjct: 191 TETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQH 250

Query: 243 VNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESS 302
           VN T+SAVRITHIPTG+V QCQ +RSQHKNK QA   ++AKLYE+E+QK+       E +
Sbjct: 251 VNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYEVEMQKKNAEKQAMEDN 310

Query: 303 KTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATL 351
           K++IGWG QIRSYVL   + +KDLRT +E  +   VLDG LD F++A+L
Sbjct: 311 KSDIGWGSQIRSYVLDDSR-IKDLRTGVETRNTQAVLDGSLDQFIEASL 358


>d2b3tb1 e.38.1.1 (B:7-354) Peptide chain release factor 1, RF1 {Escherichia coli [TaxId: 562]} Length = 344 Back     information, alignment and structure
>d1rq0a_ e.38.1.1 (A:) Peptide chain release factor 1, RF1 {Thermotoga maritima [TaxId: 2336]} Length = 333 Back     information, alignment and structure
>d1j26a_ d.50.4.1 (A:) Ict1 protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 peptide chain release factor 2 [Candidatus Liberibacter
d1gqea_362 Polypeptide chain release factor 2 (RF2) {Escherichia c 100.0
d2b3tb1344 Peptide chain release factor 1, RF1 {Escherichia coli [ 100.0
d1rq0a_333 Peptide chain release factor 1, RF1 {Thermotoga maritim 100.0
d1j26a_112 Ict1 protein {Mouse (Mus musculus) [TaxId: 10090]} 99.54
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Release factor
superfamily: Release factor
family: Release factor
domain: Polypeptide chain release factor 2 (RF2)
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=992.54  Aligned_cols=352  Identities=52%  Similarity=0.847  Sum_probs=344.0

Q ss_pred             CHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             56899999886549899999999999987086600258999999999988999999999999998639999986310000
Q gi|254780753|r    2 KLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIKEIQDRLCDNLILLELALEEDD   81 (355)
Q Consensus         2 EL~~rl~~l~~~fDle~~~~rl~eLE~~lsdp~fW~D~~kAqkl~KE~s~L~~iV~~~~~l~~~l~Dl~eL~ELa~ee~D   81 (355)
                      +|++++..|+++||++.++.|+.+|+.+|++|+||+||++|++++||++.|+++|+.|+.+.+.++|+.++.+|+.+++|
T Consensus        10 eL~~rl~~Lr~~fDld~kk~Rl~ELE~~lsdP~fW~D~~kAqkl~KE~s~L~~iVe~~~~l~~~leDl~eL~Ela~ee~d   89 (362)
T d1gqea_          10 DLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERAQALGKERSSLEAVVDTLDQMKQGLEDVSGLLELAVEADD   89 (362)
T ss_dssp             HHHHHHHHHHHHTTHHHHHHHHHHHHHHHHSGGGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999997769798999999999986397144499999999999999999999999999999988877877641105


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             00234566765557740158998876303457662489982177870277899999998999987753113444205454
Q gi|254780753|r   82 CSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGE  161 (355)
Q Consensus        82 ~el~eE~~~el~~l~~~le~LE~~~Lls~e~D~~nailEI~AGaGG~EA~dwA~~L~rMY~r~ae~~gwk~evi~~~~~e  161 (355)
                      .++.+++..++..+...++++++.+||+||+|.+||||||||||||+||||||+||||||+|||+++||++++++.++|+
T Consensus        90 eel~~e~~~~l~~l~~~l~~le~~ll~~~~~D~~nailEIrAGaGG~EA~dfA~~L~RMY~r~ae~~gwk~eiid~~~~e  169 (362)
T d1gqea_          90 EETFNEAVAELDALEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGE  169 (362)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHGGGGGCCSTTTTSCEEEEEEECSSHHHHHHHHHHHHHHHHHHHHHTTCEEEEEEEEECS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCC
T ss_conf             88888899999998622467787521367545454379998257606688999999999999999759858994145677


Q ss_pred             CCCEEEEEEEEECCCCCHHHEEECCEEEEEEECCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCC
Q ss_conf             58501346885055610000010120689873046666503566887885034422211123455036998538886554
Q gi|254780753|r  162 EAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQ  241 (355)
Q Consensus       162 ~~GiK~~~~~I~G~~ayg~Lk~E~GvHRv~Ri~~~~s~gR~hTS~a~V~V~P~~~~~~~i~i~~~dl~i~~~rssg~ggq  241 (355)
                      .||||+|+|.|+|+||||+||+|+|||||||||||+++||||||||+|+|+|+++++++++|+|+||+||||||||||||
T Consensus       170 ~gG~K~v~~~I~G~~ayg~Lk~EsGvHRvqRvp~~es~gr~hTS~a~V~v~P~~~~~~~~~i~~~dl~i~~~rs~g~GGQ  249 (362)
T d1gqea_         170 VAGIKSVTIKISGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQ  249 (362)
T ss_dssp             SSSEEEEEEEEESTTHHHHHGGGCEEEEEEEECTTSSSCCEEEEEEEEEEEECCBTTBCCCCCGGGEEEEEECCCCSSCC
T ss_pred             CCCEEEEEEEEECCCHHHHHHHHCCCEEEEEECCCCCCCEEEEEEEEEEEEECCCCCCCEECCHHHEEEEEEECCCCCCC
T ss_conf             66546999999776688999872375048884046777347998778899624787631111767827997526998865


Q ss_pred             CCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCC
Q ss_conf             42731003588746974776655555224679999999999999999999999999987413323322210130158568
Q gi|254780753|r  242 HVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQ  321 (355)
Q Consensus       242 ~vn~t~savri~H~ptgi~v~~q~~rsq~~Nk~~a~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~g~~iRtY~~~p~~  321 (355)
                      |||||+|||||||+||||+|+||+|||||+||++||++|++|||+++++++.++.+..++++.+++||+||||||| ||+
T Consensus       250 ~vN~t~savri~H~ptgi~v~~q~ersq~~Nk~~A~~~L~~~l~~~~~~~~~~~~~~~~~~~~~~~~g~~iRtY~~-~~~  328 (362)
T d1gqea_         250 HVNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYEVEMQKKNAEKQAMEDNKSDIGWGSQIRSYVL-DDS  328 (362)
T ss_dssp             STTSSCCEEEEEETTTCCEEEECSSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSTTCCCCCSCSEEEEEEG-GGT
T ss_pred             CHHHHHCEEEEEECCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-CCC
T ss_conf             1203314168874473367776422101478999999999999999999999999988742312757698467658-998


Q ss_pred             CCCCCCCCCEECCHHHHHCCCHHHHHHHHHHCC
Q ss_conf             331111472507977871897799999997225
Q gi|254780753|r  322 MVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIK  354 (355)
Q Consensus       322 ~v~DhR~~~~~~~~~~vl~G~ld~~i~a~l~~~  354 (355)
                      ||||||||++++|++.||+|+||+||+|||+..
T Consensus       329 rv~DhR~~~~~~~~~~vl~G~ld~~i~a~l~~~  361 (362)
T d1gqea_         329 RIKDLRTGVETRNTQAVLDGSLDQFIEASLKAG  361 (362)
T ss_dssp             EEEETTTCCEESCHHHHHTTCCHHHHHHHHHTT
T ss_pred             CCCCCCCCCEECCHHHHHCCCHHHHHHHHHHCC
T ss_conf             150005397257846875887799999998777



>d2b3tb1 e.38.1.1 (B:7-354) Peptide chain release factor 1, RF1 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rq0a_ e.38.1.1 (A:) Peptide chain release factor 1, RF1 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j26a_ d.50.4.1 (A:) Ict1 protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 355 peptide chain release factor 2 [Candidatus Liberib
2b3t_B_84-214_295-336173 (B:84-214,B:295-336) RF-1, peptide chain release f 5e-41
1gqe_A_121-231_315-365162 (A:121-231,A:315-365) Release factor 2, RF2; prote 2e-40
1zbt_A_117-228_312-349150 (A:117-228,A:312-349) RF-1, peptide chain release 6e-40
2ihr_1_111-220_304-365172 (1:111-220,1:304-365) Peptide chain release factor 9e-40
3d5a_X_100-210_297-331146 (X:100-210,X:297-331) RF1, peptide chain release f 1e-39
1rq0_A_84-191_274-312147 (A:84-191,A:274-312) RF-1, peptide chain release f 8e-39
1gqe_A_121-231_315-365162 (A:121-231,A:315-365) Release factor 2, RF2; prote 5e-14
2ihr_1_111-220_304-365172 (1:111-220,1:304-365) Peptide chain release factor 5e-12
2jy9_A_148 (A:) Putative tRNA hydrolase domain; GFT protein s 1e-28
3d5a_X_211-29686 (X:211-296) RF1, peptide chain release factor 1; r 2e-26
2ihr_1_221-30383 (1:221-303) Peptide chain release factor 2; mixed 4e-26
1gqe_A_232-31483 (A:232-314) Release factor 2, RF2; protein synthes 6e-26
1rq0_A_192-27382 (A:192-273) RF-1, peptide chain release factor 1; 2e-25
1zbt_A_229-31183 (A:229-311) RF-1, peptide chain release factor 1; 2e-25
2b3t_B_215-29480 (B:215-294) RF-1, peptide chain release factor 1; 1e-26
1j26_A_112 (A:) Immature colon carcinoma transcript 1; peptid 1e-24
2jva_A_14-10895 (A:14-108) Peptidyl-tRNA hydrolase domain protein; 6e-21
1gqe_A_1-120120 (A:1-120) Release factor 2, RF2; protein synthesis 1e-12
2ihr_1_1-110110 (1:1-110) Peptide chain release factor 2; mixed al 7e-12
1zbt_A_1-116116 (A:1-116) RF-1, peptide chain release factor 1; pe 1e-06
3d5a_X_1-99_332-354122 (X:1-99,X:332-354) RF1, peptide chain release fact 3e-05
>2b3t_B (B:84-214,B:295-336) RF-1, peptide chain release factor 1; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli}Length = 173 Back     alignment and structure
 Score =  163 bits (413), Expect = 5e-41
 Identities = 51/143 (35%), Positives = 73/143 (51%), Gaps = 5/143 (3%)

Query: 96  KLEVEYKQFES--LLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTE 153
           K E   +Q +   L     D  +A+LEV AG GG E+  +A  L RMY+R+AE R+++ E
Sbjct: 5   KSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVE 64

Query: 154 ALEIHDGEEAGIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYP 213
            +   +GE  G K     I G   YG LK E G HR+ R+   +S  R HTS  ++ V P
Sbjct: 65  IMSASEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMP 124

Query: 214 VVDDS-IEIEISESDC--RIDTY 233
            + D+ +   +   D   R  TY
Sbjct: 125 ELPDAELRNLLGSGDRSDRNRTY 147


>1gqe_A (A:121-231,A:315-365) Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli}Length = 162 Back     alignment and structure
>1zbt_A (A:117-228,A:312-349) RF-1, peptide chain release factor 1; peptide chain release factor 1 (RF-1), structural genomics, joint center for structural genomics, JCSG; 2.34A {Streptococcus mutans}Length = 150 Back     alignment and structure
>2ihr_1 (1:111-220,1:304-365) Peptide chain release factor 2; mixed alpha-beta, translation; 2.50A {Thermus thermophilus} PDB: 2b9m_Y* 3f1e_X 3f1g_X 2jl5_Y 2jl7_Y 2wh1_Y 2wh3_YLength = 172 Back     alignment and structure
>3d5a_X (X:100-210,X:297-331) RF1, peptide chain release factor 1; ribosome, coiled coil, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding; 3.21A {Thermus thermophilus HB27} PDB: 2b64_Y 3d5c_XLength = 146 Back     alignment and structure
>1rq0_A (A:84-191,A:274-312) RF-1, peptide chain release factor 1; X-RAY, crystal, peptide release factor 1, ribosome, structural genomics, BSGC structure funded by NIH; 2.65A {Thermotoga maritima}Length = 147 Back     alignment and structure
>1gqe_A (A:121-231,A:315-365) Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli}Length = 162 Back     alignment and structure
>2ihr_1 (1:111-220,1:304-365) Peptide chain release factor 2; mixed alpha-beta, translation; 2.50A {Thermus thermophilus} PDB: 2b9m_Y* 3f1e_X 3f1g_X 2jl5_Y 2jl7_Y 2wh1_Y 2wh3_YLength = 172 Back     alignment and structure
>2jy9_A (A:) Putative tRNA hydrolase domain; GFT protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2}Length = 148 Back     alignment and structure
>3d5a_X (X:211-296) RF1, peptide chain release factor 1; ribosome, coiled coil, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding; 3.21A {Thermus thermophilus HB27} PDB: 2b64_Y 3d5c_XLength = 86 Back     alignment and structure
>2ihr_1 (1:221-303) Peptide chain release factor 2; mixed alpha-beta, translation; 2.50A {Thermus thermophilus} PDB: 2b9m_Y* 3f1e_X 3f1g_X 2jl5_Y 2jl7_Y 2wh1_Y 2wh3_YLength = 83 Back     alignment and structure
>1gqe_A (A:232-314) Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli}Length = 83 Back     alignment and structure
>1rq0_A (A:192-273) RF-1, peptide chain release factor 1; X-RAY, crystal, peptide release factor 1, ribosome, structural genomics, BSGC structure funded by NIH; 2.65A {Thermotoga maritima}Length = 82 Back     alignment and structure
>1zbt_A (A:229-311) RF-1, peptide chain release factor 1; peptide chain release factor 1 (RF-1), structural genomics, joint center for structural genomics, JCSG; 2.34A {Streptococcus mutans}Length = 83 Back     alignment and structure
>2b3t_B (B:215-294) RF-1, peptide chain release factor 1; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli}Length = 80 Back     alignment and structure
>1j26_A (A:) Immature colon carcinoma transcript 1; peptide chain release factors, RF-1, the GGQ motif, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus}Length = 112 Back     alignment and structure
>2jva_A (A:14-108) Peptidyl-tRNA hydrolase domain protein; GFT hydrolase, structural genomics, PSI-2, protein structure initiative; NMR {Pseudomonas syringae PV}Length = 95 Back     alignment and structure
>1gqe_A (A:1-120) Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli}Length = 120 Back     alignment and structure
>2ihr_1 (1:1-110) Peptide chain release factor 2; mixed alpha-beta, translation; 2.50A {Thermus thermophilus} PDB: 2b9m_Y* 3f1e_X 3f1g_X 2jl5_Y 2jl7_Y 2wh1_Y 2wh3_YLength = 110 Back     alignment and structure
>1zbt_A (A:1-116) RF-1, peptide chain release factor 1; peptide chain release factor 1 (RF-1), structural genomics, joint center for structural genomics, JCSG; 2.34A {Streptococcus mutans}Length = 116 Back     alignment and structure
>3d5a_X (X:1-99,X:332-354) RF1, peptide chain release factor 1; ribosome, coiled coil, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding; 3.21A {Thermus thermophilus HB27} PDB: 2b64_Y 3d5c_XLength = 122 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 peptide chain release factor 2 [Candidatus Liberibacter
2b3t_B_84-214_295-336173 RF-1, peptide chain release factor 1; translation 100.0
1gqe_A_121-231_315-365162 Release factor 2, RF2; protein synthesis, ribosome 100.0
2ihr_1_111-220_304-365172 Peptide chain release factor 2; mixed alpha-beta, 100.0
1zbt_A_117-228_312-349150 RF-1, peptide chain release factor 1; peptide chai 100.0
1rq0_A_84-191_274-312147 RF-1, peptide chain release factor 1; X-RAY, cryst 100.0
2jy9_A_148 Putative tRNA hydrolase domain; GFT protein struct 99.94
3d5a_X_211-29686 RF1, peptide chain release factor 1; ribosome, coi 99.91
2ihr_1_221-30383 Peptide chain release factor 2; mixed alpha-beta, 99.92
1gqe_A_232-31483 Release factor 2, RF2; protein synthesis, ribosome 99.91
1zbt_A_229-31183 RF-1, peptide chain release factor 1; peptide chai 99.9
1rq0_A_192-27382 RF-1, peptide chain release factor 1; X-RAY, cryst 99.9
2b3t_B_215-29480 RF-1, peptide chain release factor 1; translation 99.89
1j26_A_112 Immature colon carcinoma transcript 1; peptide cha 99.84
2jva_A_14-10895 Peptidyl-tRNA hydrolase domain protein; GFT hydrol 99.76
1gqe_A_1-120120 Release factor 2, RF2; protein synthesis, ribosome 99.74
2ihr_1_1-110110 Peptide chain release factor 2; mixed alpha-beta, 99.6
1zbt_A_1-116116 RF-1, peptide chain release factor 1; peptide chai 99.51
3d5a_X_1-99_332-354122 RF1, peptide chain release factor 1; ribosome, coi 99.4
1rq0_A_1-83_313-342113 RF-1, peptide chain release factor 1; X-RAY, cryst 95.47
>2b3t_B (B:84-214,B:295-336) RF-1, peptide chain release factor 1; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=458.62  Aligned_cols=168  Identities=33%  Similarity=0.481  Sum_probs=152.9

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEEC
Q ss_conf             77401589988763034576624899821778702778999999989999877531134442054545850134688505
Q gi|254780753|r   95 IKLEVEYKQFESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKG  174 (355)
Q Consensus        95 l~~~le~LE~~~Lls~e~D~~nailEI~AGaGG~EA~dwA~~L~rMY~r~ae~~gwk~evi~~~~~e~~GiK~~~~~I~G  174 (355)
                      +....++|++.+||++|+|.+||+|||+||+||+||+|||+||||||++||+++||++++++.++++.||||+|++.|+|
T Consensus         6 ~~~l~~~l~~~ll~~~~~D~~~a~leI~aG~GG~EA~~fa~~L~~MY~~~a~~~g~k~ev~~~~~~~~~G~k~~~~~I~G   85 (173)
T 2b3t_B            6 SEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSASEGEHGGYKEIIAKISG   85 (173)
T ss_dssp             ------CCCCCCCSCCSGGGSCEEEEEEECSSSHHHHHHHHHHHHHHHHHHHHTTCCCCEEEEEECTTSSEEEEEEEECS
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCEEEEEEEEEC
T ss_conf             55899999998623443554554899962677678999999999999999987498510022256567771489999976


Q ss_pred             CCCCHHHEEECCEEEEEEECCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCEEEEEEE
Q ss_conf             56100000101206898730466665035668878850344222111234550369985388865544273100358874
Q gi|254780753|r  175 PNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGGQHVNTTDSAVRITH  254 (355)
Q Consensus       175 ~~ayg~Lk~E~GvHRv~Ri~~~~s~gR~hTS~a~V~V~P~~~~~~~i~i~~~dl~i~~~rssg~ggq~vn~t~savri~H  254 (355)
                      +||||+||+|+|||||||||||+++||+|||||+|+|+|+++| +++  .                              
T Consensus        86 ~~aY~~Lk~E~GvHRvqRvp~te~~gR~hTStasV~VlP~~~d-~~~--k------------------------------  132 (173)
T 2b3t_B           86 DGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPD-AEL--R------------------------------  132 (173)
T ss_dssp             SSCHHHHGGGCEEEEEEECCTTCSSCCCEEEEEEEECCBCCCT-TTC--C------------------------------
T ss_pred             CCCCCEEEEEECCEEEEEECCCCCCCCCCEEEEEEEECCCCCC-CCC--H------------------------------
T ss_conf             7744234664123389972476434530202456621001332-123--6------------------------------


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCEECC
Q ss_conf             69747766555552246799999999999999999999999999874133233222101301585683311114725079
Q gi|254780753|r  255 IPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTS  334 (355)
Q Consensus       255 ~ptgi~v~~q~~rsq~~Nk~~a~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~g~~iRtY~~~p~~~v~DhR~~~~~~~  334 (355)
                                   |                                 +.+..+|++||||||| ||+||||||+|++++|
T Consensus       133 -------------~---------------------------------qvgs~dRsekIRTYNf-~q~rvtDHRi~~~~~~  165 (173)
T 2b3t_B          133 -------------N---------------------------------LLGSGDRSDRNRTYNF-PQGRVTDHRINLTLYR  165 (173)
T ss_dssp             -------------C----------------------------------------CCEEEEEET-TTTEEEEGGGTEEESC
T ss_pred             -------------H---------------------------------HCCCCCCCCCEEEEEC-CCCCCCEECCCCEECC
T ss_conf             -------------0---------------------------------0410014385476616-9886210045886778


Q ss_pred             HHHHHCCC
Q ss_conf             77871897
Q gi|254780753|r  335 PSDVLDGD  342 (355)
Q Consensus       335 ~~~vl~G~  342 (355)
                      |+.||+|+
T Consensus       166 l~~~l~Ge  173 (173)
T 2b3t_B          166 LDEVMEGK  173 (173)
T ss_dssp             HHHHHHTC
T ss_pred             HHHHHCCC
T ss_conf             44764987



>1gqe_A (A:121-231,A:315-365) Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli} Back     alignment and structure
>2ihr_1 (1:111-220,1:304-365) Peptide chain release factor 2; mixed alpha-beta, translation; 2.50A {Thermus thermophilus} PDB: 2b9m_Y* 3f1e_X 3f1g_X 2jl5_Y 2jl7_Y 2wh1_Y 2wh3_Y Back     alignment and structure
>1zbt_A (A:117-228,A:312-349) RF-1, peptide chain release factor 1; peptide chain release factor 1 (RF-1), structural genomics, joint center for structural genomics, JCSG; 2.34A {Streptococcus mutans} Back     alignment and structure
>1rq0_A (A:84-191,A:274-312) RF-1, peptide chain release factor 1; X-RAY, crystal, peptide release factor 1, ribosome, structural genomics, BSGC structure funded by NIH; 2.65A {Thermotoga maritima} Back     alignment and structure
>2jy9_A (A:) Putative tRNA hydrolase domain; GFT protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3d5a_X (X:211-296) RF1, peptide chain release factor 1; ribosome, coiled coil, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding; 3.21A {Thermus thermophilus HB27} PDB: 2b64_Y 3d5c_X Back     alignment and structure
>2ihr_1 (1:221-303) Peptide chain release factor 2; mixed alpha-beta, translation; 2.50A {Thermus thermophilus} PDB: 2b9m_Y* 3f1e_X 3f1g_X 2jl5_Y 2jl7_Y 2wh1_Y 2wh3_Y Back     alignment and structure
>1gqe_A (A:232-314) Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli} Back     alignment and structure
>1zbt_A (A:229-311) RF-1, peptide chain release factor 1; peptide chain release factor 1 (RF-1), structural genomics, joint center for structural genomics, JCSG; 2.34A {Streptococcus mutans} Back     alignment and structure
>1rq0_A (A:192-273) RF-1, peptide chain release factor 1; X-RAY, crystal, peptide release factor 1, ribosome, structural genomics, BSGC structure funded by NIH; 2.65A {Thermotoga maritima} Back     alignment and structure
>2b3t_B (B:215-294) RF-1, peptide chain release factor 1; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} Back     alignment and structure
>1j26_A (A:) Immature colon carcinoma transcript 1; peptide chain release factors, RF-1, the GGQ motif, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2jva_A (A:14-108) Peptidyl-tRNA hydrolase domain protein; GFT hydrolase, structural genomics, PSI-2, protein structure initiative; NMR {Pseudomonas syringae PV} Back     alignment and structure
>1gqe_A (A:1-120) Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli} Back     alignment and structure
>2ihr_1 (1:1-110) Peptide chain release factor 2; mixed alpha-beta, translation; 2.50A {Thermus thermophilus} PDB: 2b9m_Y* 3f1e_X 3f1g_X 2jl5_Y 2jl7_Y 2wh1_Y 2wh3_Y Back     alignment and structure
>1zbt_A (A:1-116) RF-1, peptide chain release factor 1; peptide chain release factor 1 (RF-1), structural genomics, joint center for structural genomics, JCSG; 2.34A {Streptococcus mutans} Back     alignment and structure
>3d5a_X (X:1-99,X:332-354) RF1, peptide chain release factor 1; ribosome, coiled coil, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding; 3.21A {Thermus thermophilus HB27} PDB: 2b64_Y 3d5c_X Back     alignment and structure
>1rq0_A (A:1-83,A:313-342) RF-1, peptide chain release factor 1; X-RAY, crystal, peptide release factor 1, ribosome, structural genomics, BSGC structure funded by NIH; 2.65A {Thermotoga maritima} Back     alignment and structure