254780757

254780757

glycyl-tRNA synthetase subunit alpha

GeneID in NCBI database:8209762Locus tag:CLIBASIA_03220
Protein GI in NCBI database:254780757Protein Accession:YP_003065170.1
Gene range:-(509284, 510207)Protein Length:307aa
Gene description:glycyl-tRNA synthetase subunit alpha
COG prediction:none
KEGG prediction:glyQ; glycyl-tRNA synthetase subunit alpha (EC:6.1.1.14); K01878 glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
SEED prediction:Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Gly
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH
ccccccccccccHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHcccccccEEccccccccccccccccHHHHHEEEEEEEEccccccHHHHHHHHHHHHcccHHHccEEEEEcccccccccccccccEEEEcccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccc
ccccccccccHHHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHcccccccEEEEccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccEEEEEEcccEEcEEEEEEEcccccccccccEEcHHHHHHHHHHcccccEEEEEEcccccccEEEccccccccEEEcEEccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccc
mapihnkkndlsFQNIILTLTQYWAQqgctilqpydmevgagtfhpsttlralgplswkaayvqpsrrpldgryaenpnrlqhYYQFQViikpnplnlqNLYIESLkavgidplihdvrfvednwesptlgawglgwecwcdgmeisqfTYFQQvcgiecspisgeiTYGLERLAMYVQNVNSVYDIVFNAIegqnvlygdifaqseQEYSRynfeyanpeilhnhfiDSEKECLDLLkkgipnehhrhhlcvfpaydqcIKASHIFNLldargvistTERQRYILRIRSLAKACGeaflmtpnggh
mapihnkkndlsFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACgeaflmtpnggh
MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH
*************QNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP****
MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH
*****NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH
MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH
MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target307 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi
315121920308 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi 1 1e-168
222085062319 glycyl-tRNA synthetase [Agrobacterium radiobacter K84] 1 1e-140
307309350320 glycyl-tRNA synthetase, alpha subunit [Sinorhizobium me 1 1e-139
15964604311 glycyl-tRNA synthetase subunit alpha [Sinorhizobium mel 1 1e-139
227821042320 glycyl-tRNA synthetase subunit alpha [Sinorhizobium fre 1 1e-139
150395688320 glycyl-tRNA synthetase subunit alpha [Sinorhizobium med 1 1e-139
325292021320 glycyl-tRNA synthetase alpha chain [Agrobacterium sp. H 1 1e-139
159184400310 glycyl-tRNA synthetase subunit alpha [Agrobacterium tum 1 1e-138
86356527318 glycyl-tRNA synthetase subunit alpha [Rhizobium etli CF 1 1e-138
218682936318 glycyl-tRNA synthetase subunit alpha [Rhizobium etli CI 1 1e-138
>gi|315121920|ref|YP_004062409.1| glycyl-tRNA synthetase subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 308 Back     alignment and organism information
 Score =  593 bits (1530), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 277/307 (90%), Positives = 292/307 (95%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           MAPIH+KKN  SFQNI+L LT+YWA+QGCTILQPYDMEVGAGTFHPSTTLRALGPL WKA
Sbjct: 1   MAPIHDKKNKTSFQNIVLILTEYWAKQGCTILQPYDMEVGAGTFHPSTTLRALGPLPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRPLDGRYA+NPNRLQHYYQFQVIIKPNPL+LQ LYIESL+AVGIDPL+HD+RF
Sbjct: 61  AYVQPSRRPLDGRYAQNPNRLQHYYQFQVIIKPNPLDLQKLYIESLQAVGIDPLVHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN
Sbjct: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           VNSV+DIVFN IEG+NVLYGDIFAQSEQEYSRYNFEYAN  ILHNHFID EKEC  LL+ 
Sbjct: 181 VNSVFDIVFNTIEGKNVLYGDIFAQSEQEYSRYNFEYANTNILHNHFIDHEKECQKLLEA 240

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
           G PN+HH HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL
Sbjct: 241 GAPNKHHNHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300

Query: 301 MTPNGGH 307
           MT +GG+
Sbjct: 301 MTSSGGY 307


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085062|ref|YP_002543592.1| glycyl-tRNA synthetase [Agrobacterium radiobacter K84] Length = 319 Back     alignment and organism information
>gi|307309350|ref|ZP_07589013.1| glycyl-tRNA synthetase, alpha subunit [Sinorhizobium meliloti BL225C] Length = 320 Back     alignment and organism information
>gi|15964604|ref|NP_384957.1| glycyl-tRNA synthetase subunit alpha [Sinorhizobium meliloti 1021] Length = 311 Back     alignment and organism information
>gi|227821042|ref|YP_002825012.1| glycyl-tRNA synthetase subunit alpha [Sinorhizobium fredii NGR234] Length = 320 Back     alignment and organism information
>gi|150395688|ref|YP_001326155.1| glycyl-tRNA synthetase subunit alpha [Sinorhizobium medicae WSM419] Length = 320 Back     alignment and organism information
>gi|325292021|ref|YP_004277885.1| glycyl-tRNA synthetase alpha chain [Agrobacterium sp. H13-3] Length = 320 Back     alignment and organism information
>gi|159184400|ref|NP_353661.2| glycyl-tRNA synthetase subunit alpha [Agrobacterium tumefaciens str. C58] Length = 310 Back     alignment and organism information
>gi|86356527|ref|YP_468419.1| glycyl-tRNA synthetase subunit alpha [Rhizobium etli CFN 42] Length = 318 Back     alignment and organism information
>gi|218682936|ref|ZP_03530537.1| glycyl-tRNA synthetase subunit alpha [Rhizobium etli CIAT 894] Length = 318 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target307 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi
PRK09348283 PRK09348, glyQ, glycyl-tRNA synthetase subunit alpha; V 1e-173
pfam02091284 pfam02091, tRNA-synt_2e, Glycyl-tRNA synthetase alpha s 1e-136
cd00733279 cd00733, GlyRS_alpha_core, Class II Glycyl-tRNA synthet 1e-134
PRK14908 1000 PRK14908, PRK14908, glycyl-tRNA synthetase; Provisional 1e-131
TIGR00388293 TIGR00388, glyQ, glycyl-tRNA synthetase, tetrameric typ 1e-128
COG0752298 COG0752, GlyQ, Glycyl-tRNA synthetase, alpha subunit [T 1e-147
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA amino-a 7e-08
>gnl|CDD|181790 PRK09348, glyQ, glycyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|111033 pfam02091, tRNA-synt_2e, Glycyl-tRNA synthetase alpha subunit Back     alignment and domain information
>gnl|CDD|29812 cd00733, GlyRS_alpha_core, Class II Glycyl-tRNA synthetase (GlyRS) alpha subunit core catalytic domain Back     alignment and domain information
>gnl|CDD|184901 PRK14908, PRK14908, glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|129483 TIGR00388, glyQ, glycyl-tRNA synthetase, tetrameric type, alpha subunit Back     alignment and domain information
>gnl|CDD|31095 COG0752, GlyQ, Glycyl-tRNA synthetase, alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29813 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 307 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi
PRK09348291 glyQ glycyl-tRNA synthetase subunit alpha; Validated 100.0
cd00733279 GlyRS_alpha_core Class II Glycyl-tRNA synthetase (GlyRS 100.0
pfam02091284 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit. 100.0
COG0752298 GlyQ Glycyl-tRNA synthetase, alpha subunit [Translation 100.0
TIGR00388295 glyQ glycyl-tRNA synthetase, alpha subunit; InterPro: I 100.0
PRK13902 898 alaS lanyl-tRNA synthetase; Provisional 98.14
PRK01584 593 alanyl-tRNA synthetase; Provisional 97.77
PRK00252 864 alaS alanyl-tRNA synthetase; Reviewed 97.48
COG0013 879 AlaS Alanyl-tRNA synthetase [Translation, ribosomal str 96.96
cd00673232 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core 96.65
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 97.15
PRK10748238 flavin mononucleotide phosphatase; Provisional 94.39
PRK09449225 nucleotidase; Provisional 91.34
>PRK09348 glyQ glycyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>cd00733 GlyRS_alpha_core Class II Glycyl-tRNA synthetase (GlyRS) alpha subunit core catalytic domain Back     alignment and domain information
>pfam02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit Back     alignment and domain information
>COG0752 GlyQ Glycyl-tRNA synthetase, alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00388 glyQ glycyl-tRNA synthetase, alpha subunit; InterPro: IPR002310 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK13902 alaS lanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK01584 alanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00252 alaS alanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0013 AlaS Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00673 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PRK09449 nucleotidase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target307 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi
1j5w_A298 Crystal Structure Of Glycyl-Trna Synthetase Alpha C 1e-138
3rf1_A311 The Crystal Structure Of Glycyl-Trna Synthetase Sub 1e-138
>gi|22218825|pdb|1J5W|A Chain A, Crystal Structure Of Glycyl-Trna Synthetase Alpha Chain (Tm0216) From Thermotoga Maritima At 1.95 A Resolution Length = 298 Back     alignment and structure
 Score =  496 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 160/293 (54%), Positives = 204/293 (69%), Gaps = 14/293 (4%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
             Q++I  L  +WA +GC + QPYD EVGAGTFHP+T   +L    WK AYVQPSRRP D
Sbjct: 14  YLQDVIXKLNDFWASKGCLLEQPYDXEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTD 73

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQ Y+Q+QVIIKP+P N Q LY+ESL+ +GI+   HD+RFVEDNWESPTLG
Sbjct: 74  GRYGENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLG 133

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWG+GWE W DG EI+QFTYFQQ+ GI    I  EITYGLER+A Y+Q V++VY++ +N 
Sbjct: 134 AWGVGWEVWLDGXEITQFTYFQQIGGISLKDIPLEITYGLERIAXYLQGVDNVYEVQWN- 192

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
              +NV YGD+F ++E+E+S +NFE AN  +L  HF + EKE   L++K +         
Sbjct: 193 ---ENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNL--------- 240

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAYD  +K SH FNLLDARG IS ++RQ Y+ RI++ A+     FL    
Sbjct: 241 -YLPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAXARKAARVFLEVQA 292


>gi|329666299|pdb|3RF1|A Chain A, The Crystal Structure Of Glycyl-Trna Synthetase Subunit Alpha From Campylobacter Jejuni Subsp. Jejuni Nctc 11168 Length = 311 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target307 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi
1j5w_A298 Glycyl-tRNA synthetase alpha chain; structural genomics 1e-148
2ztg_A 739 Alanyl-tRNA synthetase; class-II aminoacyl-tRNA synthet 3e-05
>1j5w_A Glycyl-tRNA synthetase alpha chain; structural genomics, TM0216, JCSG, PSI, protein structure initiative; 1.95A {Thermotoga maritima} SCOP: d.104.1.1 Length = 298 Back     alignment and structure
 Score =  519 bits (1338), Expect = e-148
 Identities = 163/292 (55%), Positives = 210/292 (71%), Gaps = 14/292 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           +  Q++I+ L  +WA +GC + QPYDMEVGAGTFHP+T   +L    WK AYVQPSRRP 
Sbjct: 13  MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPT 72

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQ Y+Q+QVIIKP+P N Q LY+ESL+ +GI+   HD+RFVEDNWESPTL
Sbjct: 73  DGRYGENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTL 132

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWG+GWE W DGMEI+QFTYFQQ+ GI    I  EITYGLER+AMY+Q V++VY++ +N
Sbjct: 133 GAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWN 192

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               +NV YGD+F ++E+E+S +NFE AN  +L  HF + EKE   L++K +        
Sbjct: 193 ----ENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLY------- 241

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
               PAYD  +K SH FNLLDARG IS ++RQ Y+ RI+++A+     FL  
Sbjct: 242 ---LPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEV 290


>2ztg_A Alanyl-tRNA synthetase; class-II aminoacyl-tRNA synthetase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: A5A; 2.20A {Archaeoglobus fulgidus} Length = 739 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target307 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi
1j5w_A298 Glycyl-tRNA synthetase alpha chain; structural genomics 100.0
2ztg_A 739 Alanyl-tRNA synthetase; class-II aminoacyl-tRNA synthet 98.84
2zze_A 752 Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2. 98.56
1yfs_A 465 Alanyl-tRNA synthetase; alpha-beta fold, helix-loop-hel 98.25
3hy0_A441 Alanyl-tRNA synthetase; aminoacyl-tRNA synthetase, liga 98.13
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA s 94.71
2zin_A291 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 93.49
3ib6_A189 Uncharacterized protein; structural genomics, unknown f 93.28
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacylatio 91.24
2du7_A549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 90.58
>1j5w_A Glycyl-tRNA synthetase alpha chain; structural genomics, TM0216, JCSG, PSI, protein structure initiative; 1.95A {Thermotoga maritima} SCOP: d.104.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=1221.61  Aligned_cols=290  Identities=57%  Similarity=1.021  Sum_probs=284.0

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCE
Q ss_conf             43356777799999999999986695896116754333224857898744834401676415578876554667750011
Q gi|254780757|r    4 IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQH   83 (307)
Q Consensus         4 ~~~~~~~~~fq~ii~~L~~fW~~~GC~i~qpyd~e~GAgT~hp~T~lr~lg~~pw~~aYvqPsrRP~DgRYGeNPNRlq~   83 (307)
                      +....+.|+||+||++||+||+++||+|+||||+|||||||||+|||||||||||++|||||||||+|||||+|||||||
T Consensus         6 ~~~~~~~m~fq~~i~~L~~fW~~~GC~i~qpyd~evGAgT~~P~T~lr~lgp~pw~~aYvqPsrRP~DgRYGeNPNRLq~   85 (298)
T 1j5w_A            6 IHHHHHHMYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTDGRYGENPNRLQR   85 (298)
T ss_dssp             -------CCHHHHHHHHHHHHHHTTCEECCCCSSCCSSGGGSHHHHTGGGCSSCEEEEEEEEEECCC-----CCTTCCSE
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCHHCE
T ss_conf             33210322299999999999987796887675542464668889998631987632664246779998876789323110


Q ss_pred             EEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHCCCCEEEEECCEEEHHHHHHHHHCCCCCCCC
Q ss_conf             44445575798335899999999981999621717988328887001101232176887874147778998668257751
Q gi|254780757|r   84 YYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPI  163 (307)
Q Consensus        84 y~QfQVilKPsp~niq~lYl~SL~~iGid~~~hDIrFveDnWEsPtLGAwGlGWEvwldGMEItQFTYFQQvGGi~c~pv  163 (307)
                      ||||||||||||+|+|+|||+||++||||+++||||||||||||||||||||||||||||||||||||||||||++|+||
T Consensus        86 y~QfQVilKPsp~n~q~lYL~SL~~igid~~~hDIrFveDnWEsPtLGAwGlGWEVwldGMEItQFTYFQQvGGi~c~pv  165 (298)
T 1j5w_A           86 YFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKDI  165 (298)
T ss_dssp             EEEEEEEEESCCSSHHHHHHHHHHHTTCCTTTSCEEEEEECCEEGGGTEEEEEEEEEETTEEEEEEEEEEEBTTBCCSSC
T ss_pred             EEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCEEEEEEEEECCEEEEEEEEEEEECCEECCCC
T ss_conf             03458997789466899999999983999202144786227778761211200599988768752440311277533442


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             45678789999999869982113320688878831106244746997776350179899999999999999999850066
Q gi|254780757|r  164 SGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP  243 (307)
Q Consensus       164 ~~EiTYGLERiaMylQ~vdnvyDl~wn~~~~~~vtYGdif~q~E~E~S~YNFE~Ad~~~L~~~F~~yE~Ea~rLle~~LP  243 (307)
                      ++||||||||||||||+|||||||+||    +++||||||+|+|+|||+||||+||+++|+++|++||+||++||+++||
T Consensus       166 ~~EiTYGLERiaMylQ~vdnv~Dl~w~----~~vtYGDif~q~E~E~S~YNFe~ad~~~L~~~F~~~E~Ea~rLle~~L~  241 (298)
T 1j5w_A          166 PLEITYGLERIAMYLQGVDNVYEVQWN----ENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLY  241 (298)
T ss_dssp             CEEEEEEHHHHHHHHHTCSSGGGCEEE----TTEEHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHTTCH
T ss_pred             CHHHHHHHHHHHHHHHCCCHHHCCCCC----CCCCHHHHHHHHHHHHHHHCHHHCCHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             201002499999998487335030057----9974327753558999885535339999999999999999999866999


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CC
Q ss_conf             53233553013828999999999878883875017889999999999999999999854516-89
Q gi|254780757|r  244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG-GH  307 (307)
Q Consensus       244 ~~~~~~~~lvlPAYD~~LKaSH~FNLLDARGaISVTERq~YI~RIR~Lak~~A~ayl~~re~-g~  307 (307)
                                +||||+||||||+||||||||||||||||+||+|||+|||+||++|+++|+. |+
T Consensus       242 ----------lPAYD~~LKaSH~FNLLDARGaISVtER~~YI~RVR~LAk~~A~~y~e~r~~lgf  296 (298)
T 1j5w_A          242 ----------LPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQANENS  296 (298)
T ss_dssp             ----------HHHHHHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC---
T ss_pred             ----------CCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             ----------6669999999888888763478758999999999999999999999998875599



>2ztg_A Alanyl-tRNA synthetase; class-II aminoacyl-tRNA synthetase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: A5A; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>2zze_A Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2.16A {Pyrococcus horikoshii} PDB: 2zzf_A 2zzg_A* Back     alignment and structure
>1yfs_A Alanyl-tRNA synthetase; alpha-beta fold, helix-loop-helix motif, amino acid binding, ligase; 2.08A {Aquifex aeolicus} SCOP: a.203.1.1 d.104.1.1 PDB: 1yfr_A* 1riq_A 1yft_A 1ygb_A 3htz_A Back     alignment and structure
>3hy0_A Alanyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, protein biosynthesis, nucleotide-binding, amino acid-binding, acetylation; HET: G5A EPE; 1.90A {Escherichia coli} PDB: 3hxz_A* 3hy1_A* 3hxv_A* 3hxu_A* 3hxw_A* 3hxx_A* 3hxy_A* Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure
>2zin_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, pyrrolysine, ATP analogue, non-natural amino acid, unnatural amino acid, ATP-binding; HET: ANP LBY; 1.79A {Methanosarcina mazei} PDB: 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.20A {Listeria monocytogenes CLIP81459} Back     alignment and structure
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 307 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi
d1j5wa_281 d.104.1.1 (A:) Glycyl-tRNA synthetase (GlyRS) alpha cha 1e-139
>d1j5wa_ d.104.1.1 (A:) Glycyl-tRNA synthetase (GlyRS) alpha chain {Thermotoga maritima [TaxId: 2336]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Glycyl-tRNA synthetase (GlyRS) alpha chain
species: Thermotoga maritima [TaxId: 2336]
 Score =  488 bits (1258), Expect = e-139
 Identities = 163/292 (55%), Positives = 210/292 (71%), Gaps = 14/292 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           +  Q++I+ L  +WA +GC + QPYDMEVGAGTFHP+T   +L    WK AYVQPSRRP 
Sbjct: 1   MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQ Y+Q+QVIIKP+P N Q LY+ESL+ +GI+   HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWG+GWE W DGMEI+QFTYFQQ+ GI    I  EITYGLER+AMY+Q V++VY++ +N
Sbjct: 121 GAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               +NV YGD+F ++E+E+S +NFE AN  +L  HF + EKE   L++K +        
Sbjct: 181 ----ENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLY------- 229

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
               PAYD  +K SH FNLLDARG IS ++RQ Y+ RI+++A+     FL  
Sbjct: 230 ---LPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEV 278


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target307 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi
d1j5wa_281 Glycyl-tRNA synthetase (GlyRS) alpha chain {Thermotoga 100.0
d1riqa2236 Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId 98.02
>d1j5wa_ d.104.1.1 (A:) Glycyl-tRNA synthetase (GlyRS) alpha chain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Glycyl-tRNA synthetase (GlyRS) alpha chain
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=0  Score=1223.22  Aligned_cols=281  Identities=58%  Similarity=1.037  Sum_probs=278.6

Q ss_pred             CCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             77999999999999866958961167543332248578987448344016764155788765546677500114444557
Q gi|254780757|r   11 LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVI   90 (307)
Q Consensus        11 ~~fq~ii~~L~~fW~~~GC~i~qpyd~e~GAgT~hp~T~lr~lg~~pw~~aYvqPsrRP~DgRYGeNPNRlq~y~QfQVi   90 (307)
                      |+|||||++||+||+++||+|+||||+|||||||||+||||+||||||++|||||||||+|||||+||||||||||||||
T Consensus         1 m~fq~~i~~L~~~W~~~gC~i~qpyd~evGAgT~~p~T~lr~lgp~pw~~ayvqpsrRP~DgRYg~NPNRlq~y~QfQVi   80 (281)
T d1j5wa_           1 MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTDGRYGENPNRLQRYFQYQVI   80 (281)
T ss_dssp             CCHHHHHHHHHHHHHHTTCEECCCCSSCCSSGGGSHHHHTGGGCSSCEEEEEEEEEECCC-----CCTTCCSEEEEEEEE
T ss_pred             CCHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHEEEE
T ss_conf             96899999999999878978977765544646687588874049987532343556688654335892044345530235


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHCCCCEEEEECCEEEHHHHHHHHHCCCCCCCCHHHHHHH
Q ss_conf             57983358999999999819996217179883288870011012321768878741477789986682577514567878
Q gi|254780757|r   91 IKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYG  170 (307)
Q Consensus        91 lKPsp~niq~lYl~SL~~iGid~~~hDIrFveDnWEsPtLGAwGlGWEvwldGMEItQFTYFQQvGGi~c~pv~~EiTYG  170 (307)
                      |||||+|+|+|||+||++||||+++||||||||||||||||||||||||||||||||||||||||||++|+||++|||||
T Consensus        81 ~KPsp~n~q~lyL~SL~~igid~~~hDIrfvEDnWEsPtlGAwGlGWEVwldGMEItQFTYFQQvGg~~c~pv~~EiTYG  160 (281)
T d1j5wa_          81 IKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYG  160 (281)
T ss_dssp             EESCCSSHHHHHHHHHHHTTCCTTTSCEEEEEECCEEGGGTEEEEEEEEEETTEEEEEEEEEEEBTTBCCSSCCEEEEEE
T ss_pred             ECCCCCCHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCEEEEEEEEECCEEEEEEEHHHHHCCCCCCCCCHHHHHH
T ss_conf             05894128999999999819993214257873167687602102224788767366532163563683256530554432


Q ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             99999998699821133206888788311062447469977763501798999999999999999998500665323355
Q gi|254780757|r  171 LERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH  250 (307)
Q Consensus       171 LERiaMylQ~vdnvyDl~wn~~~~~~vtYGdif~q~E~E~S~YNFE~Ad~~~L~~~F~~yE~Ea~rLle~~LP~~~~~~~  250 (307)
                      |||||||||+|||||||.||    +++||||||+|+|+|||+||||+||+++|+++|++||+||++|++++||       
T Consensus       161 LERiaMylQ~vd~v~Dl~wn----~~vtYgDvf~q~E~E~S~YNFE~Ad~~~L~~~F~~yE~Ea~~Lle~~L~-------  229 (281)
T d1j5wa_         161 LERIAMYLQGVDNVYEVQWN----ENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLY-------  229 (281)
T ss_dssp             HHHHHHHHHTCSSGGGCEEE----TTEEHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHTTCH-------
T ss_pred             HHHHHHHHHCCCHHEEEECC----CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-------
T ss_conf             89999998486404032224----8944679887769999998698731999999999999999999865998-------


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             3013828999999999878883875017889999999999999999999854516
Q gi|254780757|r  251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG  305 (307)
Q Consensus       251 ~lvlPAYD~~LKaSH~FNLLDARGaISVTERq~YI~RIR~Lak~~A~ayl~~re~  305 (307)
                         +||||+||||||+||||||||||||||||+||+|||+|||+||++|+++|+.
T Consensus       230 ---lPAYD~~LKaSH~FNLLDARGaISVTERa~YI~RIR~LAk~~a~~yle~r~n  281 (281)
T d1j5wa_         230 ---LPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQAN  281 (281)
T ss_dssp             ---HHHHHHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             ---CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             ---5279999998878764611688548998999999999999999999986459



>d1riqa2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 307 glycyl-tRNA synthetase subunit alpha [Candidatus L
1j5w_A_1-199199 (A:1-199) Glycyl-tRNA synthetase alpha chain; stru 1e-100
1j5w_A_200-29899 (A:200-298) Glycyl-tRNA synthetase alpha chain; st 2e-35
>1j5w_A (A:1-199) Glycyl-tRNA synthetase alpha chain; structural genomics, TM0216, JCSG, PSI, protein structure initiative; 1.95A {Thermotoga maritima}Length = 199 Back     alignment and structure
 Score =  357 bits (919), Expect = e-100
 Identities = 120/198 (60%), Positives = 148/198 (74%), Gaps = 4/198 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           IH+  +    Q++I  L  +WA +GC + QPYD EVGAGTFHP+T   +L    WK AYV
Sbjct: 6   IHHHHHHXYLQDVIXKLNDFWASKGCLLEQPYDXEVGAGTFHPATFFGSLRKGPWKVAYV 65

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQ Y+Q+QVIIKP+P N Q LY+ESL+ +GI+   HD+RFVED
Sbjct: 66  QPSRRPTDGRYGENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVED 125

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWG+GWE W DG EI+QFTYFQQ+ GI    I  EITYGLER+A Y+Q V++
Sbjct: 126 NWESPTLGAWGVGWEVWLDGXEITQFTYFQQIGGISLKDIPLEITYGLERIAXYLQGVDN 185

Query: 184 VYDIVFNAIEGQNVLYGD 201
           VY++ +N    +NV YGD
Sbjct: 186 VYEVQWN----ENVKYGD 199


>1j5w_A (A:200-298) Glycyl-tRNA synthetase alpha chain; structural genomics, TM0216, JCSG, PSI, protein structure initiative; 1.95A {Thermotoga maritima}Length = 99 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target307 glycyl-tRNA synthetase subunit alpha [Candidatus Liberi
1j5w_A_1-199199 Glycyl-tRNA synthetase alpha chain; structural gen 100.0
2ztg_A_1-260260 Alanyl-tRNA synthetase; class-II aminoacyl-tRNA sy 98.01
2zze_A_1-266266 Alanyl-tRNA synthetase; ligase, hydrolase; HET: ML 97.97
1c0a_A_129-271_422-557279 Aspartyl tRNA synthetase; protein-RNA complex; HET 97.25
1yfs_A_1-237237 Alanyl-tRNA synthetase; alpha-beta fold, helix-loo 96.93
3hy0_A_1-252252 Alanyl-tRNA synthetase; aminoacyl-tRNA synthetase, 96.69
1l0w_A_135-278_415-546276 Aspartyl-tRNA synthetase; space-grown crystal, dim 95.69
1j5w_A_200-29899 Glycyl-tRNA synthetase alpha chain; structural gen 100.0
>1j5w_A (A:1-199) Glycyl-tRNA synthetase alpha chain; structural genomics, TM0216, JCSG, PSI, protein structure initiative; 1.95A {Thermotoga maritima} Back     alignment and structure
Probab=100.00  E-value=0  Score=856.45  Aligned_cols=195  Identities=62%  Similarity=1.127  Sum_probs=191.5

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             64335677779999999999998669589611675433322485789874483440167641557887655466775001
Q gi|254780757|r    3 PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQ   82 (307)
Q Consensus         3 ~~~~~~~~~~fq~ii~~L~~fW~~~GC~i~qpyd~e~GAgT~hp~T~lr~lg~~pw~~aYvqPsrRP~DgRYGeNPNRlq   82 (307)
                      .+..++++++||+||++||+||+++||+|+||||+|||||||||+|||||||||||++|||||||||+||||||||||||
T Consensus         5 ~~~~~~~~~~fq~~I~~Lq~fW~~~GC~i~qpyd~evGAGT~hpaTflralgpepw~~aYVqPsrRP~DgRYGeNPNRLq   84 (199)
T 1j5w_A            5 KIHHHHHHXYLQDVIXKLNDFWASKGCLLEQPYDXEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTDGRYGENPNRLQ   84 (199)
T ss_dssp             --------CCHHHHHHHHHHHHHHTTCEECCCCSSCCSSGGGSHHHHTGGGCSSCEEEEEEEEEECCC-----CCTTCCS
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCHHC
T ss_conf             23321021329999999999997779688777654336465888999864198763255424677999887678930320


Q ss_pred             EEEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHCCCCEEEEECCEEEHHHHHHHHHCCCCCCC
Q ss_conf             14444557579833589999999998199962171798832888700110123217688787414777899866825775
Q gi|254780757|r   83 HYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSP  162 (307)
Q Consensus        83 ~y~QfQVilKPsp~niq~lYl~SL~~iGid~~~hDIrFveDnWEsPtLGAwGlGWEvwldGMEItQFTYFQQvGGi~c~p  162 (307)
                      |||||||||||||+|||+|||+||++||||+++|||||||||||||||||||||||||||||||||||||||||||+|+|
T Consensus        85 ~yyQfQViiKPsP~niq~lYL~SL~~lGid~~~hDIRFvEDnWEsPtLGAwGlGWEvwldGMEitQfTYFQqvGgi~~~p  164 (199)
T 1j5w_A           85 RYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGXEITQFTYFQQIGGISLKD  164 (199)
T ss_dssp             EEEEEEEEEESCCSSHHHHHHHHHHHTTCCTTTSCEEEEEECCEEGGGTEEEEEEEEEETTEEEEEEEEEEEBTTBCCSS
T ss_pred             EEEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCEEEEEEEEECCEEEEEEEEEEEECCEECCC
T ss_conf             01245789778947689999999998099910214478622777877011120059998876875344031027743344


Q ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCH
Q ss_conf             145678789999999869982113320688878831106
Q gi|254780757|r  163 ISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGD  201 (307)
Q Consensus       163 v~~EiTYGLERiaMylQ~vdnvyDl~wn~~~~~~vtYGd  201 (307)
                      |++||||||||||||||+|||||||.||    +++||||
T Consensus       165 v~~EiTYGLERiamylQ~vd~v~dl~w~----~~~tYgd  199 (199)
T 1j5w_A          165 IPLEITYGLERIAXYLQGVDNVYEVQWN----ENVKYGD  199 (199)
T ss_dssp             CCEEEEEEHHHHHHHHHTCSSGGGCEEE----TTEEHHH
T ss_pred             CCHHHHHHHHHHHHHHHCCCHHHCCCCC----CCCCHHH
T ss_conf             2200001499999998387246222167----9974669



>2ztg_A (A:1-260) Alanyl-tRNA synthetase; class-II aminoacyl-tRNA synthetase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: A5A; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>2zze_A (A:1-266) Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2.16A {Pyrococcus horikoshii} PDB: 2zzf_A 2zzg_A* Back     alignment and structure
>1c0a_A (A:129-271,A:422-557) Aspartyl tRNA synthetase; protein-RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} Back     alignment and structure
>1yfs_A (A:1-237) Alanyl-tRNA synthetase; alpha-beta fold, helix-loop-helix motif, amino acid binding, ligase; 2.08A {Aquifex aeolicus} Back     alignment and structure
>3hy0_A (A:1-252) Alanyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, protein biosynthesis, nucleotide-binding, amino acid-binding, acetylation; HET: G5A EPE; 1.90A {Escherichia coli} PDB: 3hxz_A* 3hy1_A* 3hxv_A* 3hxu_A* 3hxw_A* 3hxx_A* 3hxy_A* Back     alignment and structure
>1l0w_A (A:135-278,A:415-546) Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} Back     alignment and structure
>1j5w_A (A:200-298) Glycyl-tRNA synthetase alpha chain; structural genomics, TM0216, JCSG, PSI, protein structure initiative; 1.95A {Thermotoga maritima} Back     alignment and structure