255764482

255764482

methyltransferase protein

GeneID in NCBI database:8209761Locus tag:CLIBASIA_03215
Protein GI in NCBI database:255764482Protein Accession:YP_003065169.2
Gene range:-(510535, 511212)Protein Length:225aa
Gene description:methyltransferase protein
COG prediction:[R] Predicted O-methyltransferase
KEGG prediction:methyltransferase protein
SEED prediction:Predicted O-methyltransferase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Heat shock dnaK gene cluster extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL
cccccccccccccEEEEEcccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHccccccccEEEEEccHHHccccccccccccccEEEEEEcccccccccccccHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEEEcccccEEEcccEEEEEccccccHHHHHHHHHccccEEcc
ccHHHccccccccEEEEccccccHHHHHHHccccccEEEEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHcccccccccEEEEccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHccccEEEEEcccccccHcEEEEEEEcccccccEEcccEEEEccccccccHHHHHHHHcHHHHHcc
MILASLVNAtgsfhladlgagaGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVgenrnlaglknnfydhvimnppfnerigtmtpdKIKEEAHVMLEDSFEKWIRTACAIMRSsgqlsliarPQSLIQIVNACARRigsleitplhpregecaSRILVtgrkgmrgqlrfrypivlhkpngqpysRFVTDLingkrsltrl
MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSleitplhpregeCASRilvtgrkgmrgqLRFRYPIVlhkpngqpysrfvtdlingkrsltrl
MILASLVNATGSFHladlgagagaaglavaSRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL
MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN***************HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLT**
MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL
MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL
MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL
MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target225 methyltransferase protein [Candidatus Liberibacter asia
315121919262 methyltransferase protein [Candidatus Liberibacter sola 1 1e-99
307309347256 methyltransferase small [Sinorhizobium meliloti BL225C] 1 2e-54
222085055258 methyltransferase protein [Agrobacterium radiobacter K8 1 2e-54
15964601278 hypothetical protein SMc00858 [Sinorhizobium meliloti 1 1 2e-54
116250713256 hypothetical protein RL0939 [Rhizobium leguminosarum bv 1 3e-54
327192816264 putative methyltransferase protein [Rhizobium etli CNPA 1 1e-53
190890588265 methyltransferase [Rhizobium etli CIAT 652] Length = 26 1 1e-53
15887977236 hypothetical protein Atu0636 [Agrobacterium tumefaciens 1 3e-53
86356523235 putative methyltransferase protein [Rhizobium etli CFN 1 5e-53
209548131258 methyltransferase small [Rhizobium leguminosarum bv. tr 1 1e-52
>gi|315121919|ref|YP_004062408.1| methyltransferase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Back     alignment and organism information
 Score =  366 bits (939), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 193/225 (85%), Positives = 209/225 (92%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           MILASLV+A G FHLADLGAGAGAAGLA+ASRLHEAQILL E SPLMA+YARKTLALPAN
Sbjct: 36  MILASLVDAKGLFHLADLGAGAGAAGLAIASRLHEAQILLVELSPLMANYARKTLALPAN 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           AQISKR+SLIEVDVTL G+ R+LAGLKNNFYDHVIMNPPFNERIGT+TPDK+KEEAHVML
Sbjct: 96  AQISKRVSLIEVDVTLTGKKRSLAGLKNNFYDHVIMNPPFNERIGTLTPDKVKEEAHVML 155

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E SFEKWIRTACAIMR SGQLSLIARPQSLI++VNACARRIGSLEITPL+PR+GECA RI
Sbjct: 156 EGSFEKWIRTACAIMRPSGQLSLIARPQSLIEVVNACARRIGSLEITPLYPRKGECAIRI 215

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           LVTGRKGMRG+L FR PI LH+PNGQ YS FVTDLINGK ++ RL
Sbjct: 216 LVTGRKGMRGKLNFRSPIFLHEPNGQSYSHFVTDLINGKATIKRL 260


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307309347|ref|ZP_07589010.1| methyltransferase small [Sinorhizobium meliloti BL225C] Length = 256 Back     alignment and organism information
>gi|222085055|ref|YP_002543584.1| methyltransferase protein [Agrobacterium radiobacter K84] Length = 258 Back     alignment and organism information
>gi|15964601|ref|NP_384954.1| hypothetical protein SMc00858 [Sinorhizobium meliloti 1021] Length = 278 Back     alignment and organism information
>gi|116250713|ref|YP_766551.1| hypothetical protein RL0939 [Rhizobium leguminosarum bv. viciae 3841] Length = 256 Back     alignment and organism information
>gi|327192816|gb|EGE59743.1| putative methyltransferase protein [Rhizobium etli CNPAF512] Length = 264 Back     alignment and organism information
>gi|190890588|ref|YP_001977130.1| methyltransferase [Rhizobium etli CIAT 652] Length = 265 Back     alignment and organism information
>gi|15887977|ref|NP_353658.1| hypothetical protein Atu0636 [Agrobacterium tumefaciens str. C58] Length = 236 Back     alignment and organism information
>gi|86356523|ref|YP_468415.1| putative methyltransferase protein [Rhizobium etli CFN 42] Length = 235 Back     alignment and organism information
>gi|209548131|ref|YP_002280048.1| methyltransferase small [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 258 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target225 methyltransferase protein [Candidatus Liberibacter asia
pfam05175170 pfam05175, MTS, Methyltransferase small domain 7e-07
COG2813300 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translatio 9e-05
TIGR00536284 TIGR00536, hemK_fam, HemK family putative methylases 8e-04
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltr 0.004
COG2890280 COG2890, HemK, Methylase of polypeptide chain release f 2e-04
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent 0.001
PRK09328275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionin 0.002
COG4123248 COG4123, COG4123, Predicted O-methyltransferase [Genera 1e-42
>gnl|CDD|147386 pfam05175, MTS, Methyltransferase small domain Back     alignment and domain information
>gnl|CDD|32642 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129627 TIGR00536, hemK_fam, HemK family putative methylases Back     alignment and domain information
>gnl|CDD|163311 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|32715 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|181780 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|33880 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 225 methyltransferase protein [Candidatus Liberibacter asia
COG4123248 Predicted O-methyltransferase [General function predict 100.0
COG4106257 Tam Trans-aconitate methyltransferase [General function 99.76
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 99.52
KOG2899288 consensus 99.21
TIGR03438301 probable methyltransferase. This model represents a dis 97.57
TIGR03439319 methyl_EasF probable methyltransferase domain, EasF fam 97.2
KOG0024354 consensus 97.13
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 96.41
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.93
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 99.91
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.91
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 99.89
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 99.89
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 99.87
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 99.86
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 99.84
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 99.83
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 99.79
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 99.79
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 99.78
PRK08317241 hypothetical protein; Provisional 99.78
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 99.76
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 99.76
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 99.75
KOG2904328 consensus 99.74
COG1041347 Predicted DNA modification methylase [DNA replication, 99.73
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.73
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 99.72
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 99.71
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 99.7
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 99.69
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 99.69
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 99.68
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 99.67
PRK11036256 putative metallothionein SmtA; Provisional 99.65
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 99.64
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 99.63
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 99.63
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 99.63
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 99.6
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 99.6
PRK07402196 precorrin-6B methylase; Provisional 99.6
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 99.6
COG1092393 Predicted SAM-dependent methyltransferases [General fun 99.59
COG0286489 HsdM Type I restriction-modification system methyltrans 99.59
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 99.58
PRK10901428 16S rRNA methyltransferase B; Provisional 99.55
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 99.55
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 99.54
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 99.54
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.53
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 99.53
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 99.52
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 99.52
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 99.51
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 99.51
KOG3191209 consensus 99.5
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 99.49
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 99.48
PRK11207198 tellurite resistance protein TehB; Provisional 99.47
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 99.46
KOG1270282 consensus 99.42
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 99.42
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 99.42
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 99.4
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 99.4
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 99.37
COG4122219 Predicted O-methyltransferase [General function predict 99.35
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 99.33
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 99.32
COG2520341 Predicted methyltransferase [General function predictio 99.32
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 99.31
KOG1540296 consensus 99.31
COG2521287 Predicted archaeal methyltransferase [General function 99.31
pfam03848192 TehB Tellurite resistance protein TehB. 99.3
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 99.3
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 99.29
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 99.28
pfam10294171 Methyltransf_16 Putative methyltransferase. 99.28
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 99.27
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 99.25
KOG1271227 consensus 99.2
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 99.19
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 99.19
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 99.18
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 99.17
KOG2671421 consensus 99.17
KOG2187534 consensus 99.16
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 99.15
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 99.15
pfam05401201 NodS Nodulation protein S (NodS). This family consists 99.13
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.11
PRK05785225 hypothetical protein; Provisional 99.06
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 99.06
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 99.04
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 99.04
PRK06922679 hypothetical protein; Provisional 99.01
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 99.0
KOG1499346 consensus 98.99
PRK12335289 tellurite resistance protein TehB; Provisional 98.97
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 98.96
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 98.96
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 98.95
KOG1500 517 consensus 98.94
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 98.94
KOG2361264 consensus 98.9
KOG1663237 consensus 98.88
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 98.78
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 98.78
TIGR02987 603 met_A_Alw26 type II restriction m6 adenine DNA methyltr 98.76
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 98.75
KOG2198375 consensus 98.74
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 98.73
KOG4300252 consensus 98.73
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 98.72
PRK00811283 spermidine synthase; Provisional 98.69
KOG1975389 consensus 98.69
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 98.68
PRK03612516 spermidine synthase; Provisional 98.66
KOG3010261 consensus 98.63
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 98.6
COG4076252 Predicted RNA methylase [General function prediction on 98.58
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 98.55
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 98.53
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 98.53
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 98.52
pfam06080201 DUF938 Protein of unknown function (DUF938). This famil 98.49
PRK01581363 speE spermidine synthase; Validated 98.49
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 98.46
pfam00891239 Methyltransf_2 O-methyltransferase. This family include 98.35
pfam05219265 DREV DREV methyltransferase. This family contains DREV 98.28
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.27
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 98.27
pfam02005 375 TRM N2,N2-dimethylguanosine tRNA methyltransferase. Thi 98.26
KOG1661237 consensus 98.24
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 98.23
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 98.15
COG4262508 Predicted spermidine synthase with an N-terminal membra 98.1
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 98.07
pfam01861243 DUF43 Protein of unknown function DUF43. This family in 98.03
pfam11599249 AviRa RRNA methyltransferase AviRa. This family of prot 98.03
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 98.02
KOG4589232 consensus 97.99
KOG1709271 consensus 97.97
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Methylate 97.95
PRK00536262 speE spermidine synthase; Provisional 97.94
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Tr 97.94
KOG3115249 consensus 97.94
COG3897218 Predicted methyltransferase [General function predictio 97.88
pfam01739194 CheR CheR methyltransferase, SAM binding domain. CheR p 97.81
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 97.72
COG1352268 CheR Methylase of chemotaxis methyl-accepting proteins 97.65
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.59
PRK09880343 L-idonate 5-dehydrogenase; Provisional 97.54
pfam05185447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 97.54
pfam01234261 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family. 97.54
KOG1253 525 consensus 97.53
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 97.5
pfam03141 506 DUF248 Putative methyltransferase. Members of this fami 97.39
COG0500257 SmtA SAM-dependent methyltransferases [Secondary metabo 97.34
KOG1099294 consensus 97.26
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 97.26
KOG2793248 consensus 97.25
KOG2940325 consensus 97.25
TIGR00452316 TIGR00452 methyltransferase, putative; InterPro: IPR010 97.22
TIGR00497516 hsdM type I restriction-modification system, M subunit; 97.22
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.16
PRK09422338 alcohol dehydrogenase; Provisional 97.13
pfam04672268 DUF574 Protein of unknown function (DUF574). Family of 97.11
PRK10083339 putative dehydrogenase; Provisional 97.02
), spermine synthase () and putrescine N-methyltransferase () . The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00417">TIGR00417284 speE spermidine synthase; InterPro: IPR001045 Synonym(s 97.01
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 97.0
KOG3201201 consensus 96.99
KOG3178342 consensus 96.99
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 96.98
KOG1269364 consensus 96.98
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 96.89
COG1189245 Predicted rRNA methylase [Translation, ribosomal struct 96.85
pfam10354166 DUF2431 Domain of unknown function (DUF2431). This is t 96.83
COG2384226 Predicted SAM-dependent methyltransferase [General func 96.73
KOG2352 482 consensus 96.63
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 96.63
COG4798238 Predicted methyltransferase [General function predictio 96.6
pfam03059277 NAS Nicotianamine synthase protein. Nicotianamine synth 96.56
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: 96.35
PRK13771332 putative alcohol dehydrogenase; Provisional 96.31
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 96.29
COG5459 484 Predicted rRNA methylase [Translation, ribosomal struct 96.25
COG1568354 Predicted methyltransferases [General function predicti 96.2
pfam10237161 N6-adenineMlase Probable N6-adenine methyltransferase. 96.09
KOG1331293 consensus 95.96
COG4889 1518 Predicted helicase [General function prediction only] 95.44
pfam00107131 ADH_zinc_N Zinc-binding dehydrogenase. 95.01
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 94.5
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 94.33
PRK13341726 recombination factor protein RarA/unknown domain fusion 94.11
KOG0822649 consensus 93.88
KOG1098 780 consensus 93.82
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.35
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 92.46
PRK06125259 short chain dehydrogenase; Provisional 92.08
KOG4174282 consensus 91.35
PRK06101241 short chain dehydrogenase; Provisional 90.39
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 90.3
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 99.9
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.9
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.87
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 99.65
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 99.63
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 99.58
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 99.57
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 99.55
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 99.55
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 99.52
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.19
KOG1122460 consensus 99.07
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 99.04
PRK04457262 spermidine synthase; Provisional 99.02
KOG1541270 consensus 99.0
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 98.94
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 98.81
KOG2915314 consensus 98.64
PRK04338 376 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Pro 98.62
pfam05148214 Methyltransf_8 Hypothetical methyltransferase. This fam 98.07
PRK04266226 fibrillarin; Provisional 98.06
pfam01269229 Fibrillarin Fibrillarin. 97.86
PTZ00146296 fibrillarin; Provisional 97.77
KOG3045325 consensus 97.56
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, ribo 96.2
KOG1596317 consensus 94.14
PRK06139324 short chain dehydrogenase; Provisional 90.96
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 99.51
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 99.48
PRK11727326 putative SAM-dependent methyltransferase; Provisional 99.44
PRK11783 716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 99.24
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 99.23
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 99.21
KOG3420185 consensus 99.16
PTZ00338296 dimethyladenosine transferase; Provisional 99.11
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.09
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 99.01
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 98.96
PRK06202233 hypothetical protein; Provisional 98.95
KOG0820315 consensus 98.92
COG3129292 Predicted SAM-dependent methyltransferase [General func 98.92
PHA02056279 putative methyltransferase 98.91
KOG2730263 consensus 98.68
KOG2912 419 consensus 98.68
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 97.96
pfam04445235 DUF548 Protein of unknown function (DUF548). Protein of 97.74
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 97.7
PRK00050309 mraW S-adenosyl-methyltransferase MraW; Provisional 97.68
pfam00145 319 DNA_methylase C-5 cytosine-specific DNA methylase. 97.68
PRK10742250 putative methyltransferase; Provisional 97.45
pfam01795310 Methyltransf_5 MraW methylase family. Members of this f 97.4
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, recom 97.2
KOG2078495 consensus 97.12
COG0275314 Predicted S-adenosylmethionine-dependent methyltransfer 96.67
KOG2360413 consensus 96.18
KOG1227351 consensus 95.97
TIGR00006323 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: 95.91
TIGR00675 425 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 95.76
TIGR00308 462 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; In 95.39
pfam04989202 CmcI Cephalosporin hydroxylase. Members of this family 94.63
PRK11760356 putative RNA 2'-O-ribose methyltransferase; Provisional 93.75
PRK07102243 short chain dehydrogenase; Provisional 93.63
PRK05876275 short chain dehydrogenase; Provisional 91.33
KOG2782303 consensus 91.24
PRK09186255 flagellin modification protein A; Provisional 90.53
pfam06962140 rRNA_methylase Putative rRNA methylase. This family con 98.45
PRK13699227 putative methylase; Provisional 98.1
PRK11524 284 putative methyltransferase; Provisional 98.09
pfam07669106 Eco57I Eco57I restriction endonuclease. Homologues of t 97.07
pfam01555221 N6_N4_Mtase DNA methylase. Members of this family are D 96.09
COG0863 302 DNA modification methylase [DNA replication, recombinat 94.68
pfam09243275 Rsm22 Mitochondrial small ribosomal subunit Rsm22. Rsm2 97.67
KOG1501 636 consensus 97.61
PRK11524284 putative methyltransferase; Provisional 97.61
pfam07942268 N2227 N2227-like protein. This family features sequence 97.58
PRK13699227 putative methylase; Provisional 97.32
TIGR01444142 fkbM_fam methyltransferase, FkbM family; InterPro: IPR0 96.99
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 96.95
pfam04816204 DUF633 Family of unknown function (DUF633). This family 96.56
pfam07091248 FmrO Ribosomal RNA methyltransferase (FmrO). This famil 96.38
KOG2798369 consensus 95.92
KOG4058199 consensus 95.35
KOG0022375 consensus 93.93
TIGR00478240 tly hemolysin A; InterPro: IPR004538 Hemolysins are exo 93.89
KOG3987288 consensus 93.68
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class III [En 93.48
pfam03492 331 Methyltransf_7 SAM dependent carboxyl methyltransferase 92.87
KOG2651 476 consensus 92.81
pfam11899 376 DUF3419 Protein of unknown function (DUF3419). This fam 91.84
pfam07757112 AdoMet_MTase Predicted AdoMet-dependent methyltransfera 91.79
KOG2920282 consensus 91.22
PRK08507275 prephenate dehydrogenase; Validated 91.17
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>KOG0024 consensus Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L-threonine 3-dehydrogenase (1 Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573 This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family; InterPro: IPR014329 Members of this entry are the m6-adenine DNA methyltransferase protein, or a fusion protein that also carries m5 cytosine methyltransferase activity of type II restriction systems of the Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>KOG2198 consensus Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG3010 consensus Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>pfam06080 DUF938 Protein of unknown function (DUF938) Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>pfam00891 Methyltransf_2 O-methyltransferase Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: IPR011869 This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>pfam02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>pfam08123 DOT1 Histone methylation protein DOT1 Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885 This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain Back     alignment and domain information
>pfam01861 DUF43 Protein of unknown function DUF43 Back     alignment and domain information
>pfam11599 AviRa RRNA methyltransferase AviRa Back     alignment and domain information
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG4589 consensus Back     alignment and domain information
>KOG1709 consensus Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3115 consensus Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam01739 CheR CheR methyltransferase, SAM binding domain Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase Back     alignment and domain information
>pfam01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family Back     alignment and domain information
>KOG1253 consensus Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>pfam03141 DUF248 Putative methyltransferase Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG1099 consensus Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>KOG2793 consensus Back     alignment and domain information
>KOG2940 consensus Back     alignment and domain information
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00497 hsdM type I restriction-modification system, M subunit; InterPro: IPR004546 There are four classes of restriction endonucleases: types I, II,III and IV Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK09422 alcohol dehydrogenase; Provisional Back     alignment and domain information
>pfam04672 DUF574 Protein of unknown function (DUF574) Back     alignment and domain information
>PRK10083 putative dehydrogenase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>KOG3201 consensus Back     alignment and domain information