254780760

254780760

hypothetical protein CLIBASIA_03235

GeneID in NCBI database:8209766Locus tag:CLIBASIA_03235
Protein GI in NCBI database:254780760Protein Accession:YP_003065173.1
Gene range:-(505678, 506670)Protein Length:330aa
Gene description:hypothetical protein
COG prediction:[J] Putative translation factor (SUA5)
KEGG prediction:hypothetical protein; K07566 putative translation factor
SEED prediction:YrdC/Sua5 family protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA modification Archaea
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MQIMSITDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELEYCVDETSTPQSPGMLKSHYAPRSQVRLRAIHVNPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAAAPRNQSQRIVP
cEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHHHcccHHccEEEEEccHHHHHHHHcccHHHHHHHHHHccccEEEEEEccccccccHHHcccccEEEEEEccHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHcccccEEEcccccccccccEEEEEcccccEEEEEcccccHHHHHHHccccccccccccccccccccccccccccccEEEEEccccccHHHHccccccccccccccEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccccccccc
ccccccccHHHHHHHHHHHHcccEEEEcccEEEccccccccHHHHHHHHHHccccccccEEEEEccHHHHHHHHHccHHHHHHHHHcccccEEEEEEcccccccccEEcccccEEEEEcccHHHHHHHHHccccEEccccccccccccccHHHHHHHHccccEEEEEcccccccEEEEEEEEccccccEEEEccccccHHHHHHHHccHHcccccccccccccccccccccccccEEEEEcccccHHHHcccccccccccccHHHEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccHHHHHHccc
mqimsitdSNALRKACEFLdaglpiaiptetvyglavdsrnpTAIRRLYEikkrpamnplichvsdismvkkhasvdplslhlaklfwpgplTLVLDLlsttdihplstanlktacfrvpcgfTKKLIEtyghplaipsanrsgqisiTNVKHILsssickeipliidggiskigLESTIVNVQCEKKvrilrpggleiETLKRAISVELEycvdetstpqspgmlkshyaprsQVRLRAIHvnprealirfgnvpiknIENAIISLnlsktgklKEAAFNLFNYMkiaddsgassiafssipnhglgiainnrleraaaprnqsqrivp
mqimsitdsNALRKACEFLDAGLPIAIPTEtvyglavdsrnpTAIRRLYeikkrpamnpLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLEStivnvqcekkvrilrpggleieTLKRAISVELEYCVDEtstpqspgmlksHYAPRSQVRLRAIHVNPREALirfgnvpikNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIPNHGLGIAINNrleraaaprnqsqrivp
MQIMSITDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPltlvldllsttdIHPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELEYCVDETSTPQSPGMLKSHYAPRSQVRLRAIHVNPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAAAPRNQSQRIVP
*******DSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISV****************MLKSHYAPRSQVRLRAIHVNPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAAAPR********
MQIMSITDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELEYCVDETSTPQSPGMLKSHYAPRSQVRLRAIHVNPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAA***********
*QIMSITDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELEYCVDETSTPQSPGMLKSHYAPRSQVRLRAIHVNPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAAAPRNQSQRIVP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQIMSITDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELEYCVDETSTPQSPGMLKSHYAPRSQVRLRAIHVNPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAAAPRNQSQRIVP
MQIMSITDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELEYCVDETSTPQSPGMLKSHYAPRSQVRLRAIHVNPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAAAPRNQSQRIVP
MQIMSITDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELEYCVDETSTPQSPGMLKSHYAPRSQVRLRAIHVNPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAAAPRNQSQRIVP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target330 hypothetical protein CLIBASIA_03235 [Candidatus Liberib
315121975320 hypothetical protein CKC_01125 [Candidatus Liberibacter 1 1e-145
159184438325 hypothetical protein Atu0724 [Agrobacterium tumefaciens 1 2e-90
325292109325 hypothetical protein AGROH133_04322 [Agrobacterium sp. 1 5e-89
222085082324 translation factor sua5 protein [Agrobacterium radiobac 1 2e-88
86356545336 translation factor sua5 protein [Rhizobium etli CFN 42] 1 1e-87
190890611334 translation factor protein [Rhizobium etli CIAT 652] Le 1 2e-87
209548153324 Sua5/YciO/YrdC/YwlC family protein [Rhizobium leguminos 1 1e-86
218682976334 probable translation factor protein [Rhizobium etli CIA 1 6e-86
241203341324 Sua5/YciO/YrdC/YwlC family protein [Rhizobium leguminos 1 3e-85
222147737323 hypothetical protein Avi_0976 [Agrobacterium vitis S4] 1 5e-85
>gi|315121975|ref|YP_004062464.1| hypothetical protein CKC_01125 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 320 Back     alignment and organism information
 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 251/319 (78%), Positives = 285/319 (89%)

Query: 4   MSITDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICH 63
           MSITDS+ L++ACEFLDAGLPI IPTETVYGLAV++R+P+AIRRLYEIK+RP  NPLICH
Sbjct: 1   MSITDSDVLQQACEFLDAGLPIVIPTETVYGLAVNARDPSAIRRLYEIKQRPPTNPLICH 60

Query: 64  VSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGF 123
           VS+ISMVKK+A +D LSLHL+KLFWPGPLTLVLDLLS  DIHPL+ +NL TACFRVP GF
Sbjct: 61  VSNISMVKKYAHIDDLSLHLSKLFWPGPLTLVLDLLSENDIHPLAISNLNTACFRVPRGF 120

Query: 124 TKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNV 183
            KKLI+TYG+PLAIPSAN SGQIS TN++HILSS ICK+IPL IDGGISKIGLESTIVNV
Sbjct: 121 AKKLIDTYGYPLAIPSANISGQISTTNIQHILSSPICKQIPLAIDGGISKIGLESTIVNV 180

Query: 184 QCEKKVRILRPGGLEIETLKRAISVELEYCVDETSTPQSPGMLKSHYAPRSQVRLRAIHV 243
           + ++ + ILRPGGLEI+ +++AI  ++EY   ET+TP SPG L+SHYAPRSQVRLRA H+
Sbjct: 181 KHDQTIHILRPGGLEIDKIEKAIGGKIEYSTSETATPLSPGRLQSHYAPRSQVRLRATHI 240

Query: 244 NPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFSSIP 303
           NP EALIRF N PIKN +NAIISLNLSK+GKLKEAAFNLFNYMKIADDSGA SIAFS IP
Sbjct: 241 NPGEALIRFANFPIKNSKNAIISLNLSKSGKLKEAAFNLFNYMKIADDSGAISIAFSPIP 300

Query: 304 NHGLGIAINNRLERAAAPR 322
           NHGLGIAINNRLERAAAPR
Sbjct: 301 NHGLGIAINNRLERAAAPR 319


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159184438|ref|NP_353749.2| hypothetical protein Atu0724 [Agrobacterium tumefaciens str. C58] Length = 325 Back     alignment and organism information
>gi|325292109|ref|YP_004277973.1| hypothetical protein AGROH133_04322 [Agrobacterium sp. H13-3] Length = 325 Back     alignment and organism information
>gi|222085082|ref|YP_002543612.1| translation factor sua5 protein [Agrobacterium radiobacter K84] Length = 324 Back     alignment and organism information
>gi|86356545|ref|YP_468437.1| translation factor sua5 protein [Rhizobium etli CFN 42] Length = 336 Back     alignment and organism information
>gi|190890611|ref|YP_001977153.1| translation factor protein [Rhizobium etli CIAT 652] Length = 334 Back     alignment and organism information
>gi|209548153|ref|YP_002280070.1| Sua5/YciO/YrdC/YwlC family protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 324 Back     alignment and organism information
>gi|218682976|ref|ZP_03530577.1| probable translation factor protein [Rhizobium etli CIAT 894] Length = 334 Back     alignment and organism information
>gi|241203341|ref|YP_002974437.1| Sua5/YciO/YrdC/YwlC family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 324 Back     alignment and organism information
>gi|222147737|ref|YP_002548694.1| hypothetical protein Avi_0976 [Agrobacterium vitis S4] Length = 323 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target330 hypothetical protein CLIBASIA_03235 [Candidatus Liberib
pfam01300178 pfam01300, Sua5_yciO_yrdC, yrdC domain 1e-45
TIGR00057201 TIGR00057, TIGR00057, Sua5/YciO/YrdC/YwlC family protei 9e-34
PRK11630206 PRK11630, PRK11630, hypothetical protein; Provisional 3e-05
COG0009211 COG0009, SUA5, Putative translation factor (SUA5) [Tran 2e-46
KOG3051261 KOG3051, KOG3051, KOG3051, RNA binding/translational re 2e-31
pfam03481144 pfam03481, SUA5, SUA5 domain 1e-20
PRK10634190 PRK10634, PRK10634, tRNA(ANN) t(6)A37 threonylcarbamoyl 2e-10
COG0068 750 COG0068, HypF, Hydrogenase maturation factor [Posttrans 1e-05
>gnl|CDD|144776 pfam01300, Sua5_yciO_yrdC, yrdC domain Back     alignment and domain information
>gnl|CDD|161684 TIGR00057, TIGR00057, Sua5/YciO/YrdC/YwlC family protein Back     alignment and domain information
>gnl|CDD|183245 PRK11630, PRK11630, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|30359 COG0009, SUA5, Putative translation factor (SUA5) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|38261 KOG3051, KOG3051, KOG3051, RNA binding/translational regulation protein of the SUA5 family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|146234 pfam03481, SUA5, SUA5 domain Back     alignment and domain information
>gnl|CDD|182603 PRK10634, PRK10634, tRNA(ANN) t(6)A37 threonylcarbamoyladenosine modification protein; Provisional Back     alignment and domain information
>gnl|CDD|30417 COG0068, HypF, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 330 hypothetical protein CLIBASIA_03235 [Candidatus Liberib
TIGR00057215 TIGR00057 Sua5/YciO/YrdC/YwlC family protein; InterPro: 100.0
COG0009211 SUA5 Putative translation factor (SUA5) [Translation, r 100.0
PRK11630206 hypothetical protein; Provisional 100.0
PRK10634190 putative ribosome maturation factor; Provisional 100.0
pfam01300178 Sua5_yciO_yrdC yrdC domain. This domain has been shown 100.0
COG0068 750 HypF Hydrogenase maturation factor [Posttranslational m 99.75
KOG3051261 consensus 100.0
pfam03481144 SUA5 SUA5 domain. The function of this domain is unknow 99.96
TIGR00143 799 hypF [NiFe] hydrogenase maturation protein HypF; InterP 99.72
COG2192 555 Predicted carbamoyl transferase, NodU family [Posttrans 96.49
>TIGR00057 TIGR00057 Sua5/YciO/YrdC/YwlC family protein; InterPro: IPR004388 This entry includes the Sua5, YciO, YrdC and YwlC proteins Back     alignment and domain information
>COG0009 SUA5 Putative translation factor (SUA5) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11630 hypothetical protein; Provisional Back     alignment and domain information
>PRK10634 putative ribosome maturation factor; Provisional Back     alignment and domain information
>pfam01300 Sua5_yciO_yrdC yrdC domain Back     alignment and domain information
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3051 consensus Back     alignment and domain information
>pfam03481 SUA5 SUA5 domain Back     alignment and domain information
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF; InterPro: IPR004421 The large subunit of [NiFe]-hydrogenase, as well as other nickel metalloenzymes, is synthesized as a precursor devoid of the metalloenzyme active site Back     alignment and domain information
>COG2192 Predicted carbamoyl transferase, NodU family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target330 hypothetical protein CLIBASIA_03235 [Candidatus Liberib
3aje_A352 Crystal Structure Of S. Tokodaii Sua5 Complexed Wit 8e-56
2eqa_A352 Crystal Structure Of The Hypothetical Sua5 Protein 5e-54
1jcu_A208 Solution Structure Of Mth1692 Protein From Methanob 1e-23
1kk9_A221 Crystal Structure Of E. Coli Ycio Length = 221 8e-16
1k7j_A206 Structural Genomics, Protein Tf1 Length = 206 8e-16
1hru_A188 The Structure Of The Yrdc Gene Product From E.Coli 2e-18
2yv4_A105 Crystal Structure Of C-Terminal Sua5 Domain From Py 1e-14
gi|328877147|pdb|3AJE|A Chain A, Crystal Structure Of S. Tokodaii Sua5 Complexed With L-Threonine And Amppnp Length = 352 Back     alignment and structure
 Score =  221 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 99/338 (29%), Positives = 155/338 (45%), Gaps = 23/338 (6%)

Query: 2   QIMSI----TDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAM 57
           QI+ I     + + ++ A + +  G  +A PTETVYGL  ++ +  A  ++++ K RP  
Sbjct: 3   QIIKIDPLNPEIDKIKIAADVIRNGGTVAFPTETVYGLGANAFDGNACLKIFQAKNRPVD 62

Query: 58  NPLICHVSDISMVKKHASVDPLSL-HLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTAC 116
           NPLI H++D + + + A   P  +  +A++ WPGPLT VL    T  +    TA L T  
Sbjct: 63  NPLIVHIADFNQLFEVAKDIPDKVLEIAQIVWPGPLTFVLK--KTERVPKEVTAGLDTVA 120

Query: 117 FRVP-CGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIG 175
            R+P      +LI   G P+A PSAN + + S T  + ++   +   + +IIDGG +  G
Sbjct: 121 VRMPAHPIALQLIRESGVPIAAPSANLATRPSPTKAEDVI-VDLNGRVDVIIDGGHTFFG 179

Query: 176 LESTIVNVQCEKKVRILRPGGLEIETLKRAISVEL----EYCVDETSTPQSPGMLKSHYA 231
           +ESTI+NV  E    +LRPG   IE LK+     +         E     +PGM   HYA
Sbjct: 180 VESTIINVTVE-PPVLLRPGPFTIEELKKLFGEIVIPEFAQGKKEAEIALAPGMKYKHYA 238

Query: 232 PRSQVRLRAIHVN---------PREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNL 282
           P +++ L                +  +       +      +  + L     L E A NL
Sbjct: 239 PNTRLLLVENRNIFKDVVSLLSKKYKVALLIPKELSKEFEGLQQIILGSDENLYEVARNL 298

Query: 283 FNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAAA 320
           F+  +  D            P  G+G AI NR  +A+ 
Sbjct: 299 FDSFRELDKLNVDLGIMIGFPERGIGFAIMNRARKASG 336


>gi|165760855|pdb|2EQA|A Chain A, Crystal Structure Of The Hypothetical Sua5 Protein From Sulfolobus Tokodaii Length = 352 Back     alignment and structure
gi|22218836|pdb|1JCU|A Chain A, Solution Structure Of Mth1692 Protein From Methanobacterium Thermoautotrophicum Length = 208 Back     alignment and structure
>gi|27573707|pdb|1KK9|A Chain A, Crystal Structure Of E. Coli Ycio Length = 221 Back     alignment and structure
>gi|23200231|pdb|1K7J|A Chain A, Structural Genomics, Protein Tf1 Length = 206 Back     alignment and structure
>gi|13096287|pdb|1HRU|A Chain A, The Structure Of The Yrdc Gene Product From E.Coli Length = 188 Back     alignment and structure
>gi|158431283|pdb|2YV4|A Chain A, Crystal Structure Of C-Terminal Sua5 Domain From Pyrococcus Horikoshii Hypothetical Sua5 Protein Ph0435 Length = 105 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target330 hypothetical protein CLIBASIA_03235 [Candidatus Liberib
2eqa_A352 Hypothetical protein ST1526; YRDC/RIBB fold, YRDC domai 1e-48
3l7v_A295 Putative uncharacterized protein SMU.1377C; transcripti 1e-38
1jcu_A208 Conserved protein MTH1692; mixed alpha-beta structure, 6e-33
1k7j_A206 Protein YCIO, protein TF1; structural genomics, X-RAY c 1e-30
1hru_A188 YRDC gene product; protein folding, structural genomics 3e-28
2yv4_A105 Hypothetical protein PH0435; alpha and beta proteins (A 4e-12
>2eqa_A Hypothetical protein ST1526; YRDC/RIBB fold, YRDC domain, SUA5 domain, structural genomics, NPPSFA; HET: AMP; 1.80A {Sulfolobus tokodaii} Length = 352 Back     alignment and structure
 Score =  188 bits (479), Expect = 1e-48
 Identities = 82/328 (25%), Positives = 136/328 (41%), Gaps = 15/328 (4%)

Query: 8   DSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDI 67
           + + ++ A + +  G  +A PTETVYGL  ++ +  A  ++++ K RP  NPLI H++D 
Sbjct: 13  EIDKIKIAADVIRNGGTVAFPTETVYGLGANAFDGNACLKIFQAKNRPVDNPLIVHIADF 72

Query: 68  SMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCGFTKKL 127
           + + + A   P  +              +   +      ++      A          +L
Sbjct: 73  NQLFEVAKDIPDKVLEIAQIVWPGPLTFVLKKTERVPKEVTAGLDTVAVRMPAHPIALQL 132

Query: 128 IETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQCEK 187
           I   G P+A PSAN + + S T  + ++   +   + +IIDGG +  G+ESTI+NV  E 
Sbjct: 133 IRESGVPIAAPSANLATRPSPTKAEDVI-VDLNGRVDVIIDGGHTFFGVESTIINVTVEP 191

Query: 188 KVRILRPGGLEIETLKRAI----SVELEYCVDETSTPQSPGMLKSHYAPRSQVRLRAIHV 243
              +LRPG   IE LK+        E      E     +PGM   HYAP +++ L     
Sbjct: 192 P-VLLRPGPFTIEELKKLFGEIVIPEFAQGKKEAEIALAPGMKYKHYAPNTRLLLVENRN 250

Query: 244 NPREALIRFGN---------VPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGA 294
             ++ +                +      +  + L     L E A NLF+  +  D    
Sbjct: 251 IFKDVVSLLSKKYKVALLIPKELSKEFEGLQQIILGSDENLYEVARNLFDSFRELDKLNV 310

Query: 295 SSIAFSSIPNHGLGIAINNRLERAAAPR 322
                   P  G+G AI NR  +A+   
Sbjct: 311 DLGIMIGFPERGIGFAIMNRARKASGFS 338


>3l7v_A Putative uncharacterized protein SMU.1377C; transcription; 2.26A {Streptococcus mutans} Length = 295 Back     alignment and structure
>1jcu_A Conserved protein MTH1692; mixed alpha-beta structure, structural genomics; NMR {Methanothermobacterthermautotrophicus} SCOP: d.115.1.1 Length = 208 Back     alignment and structure
>1k7j_A Protein YCIO, protein TF1; structural genomics, X-RAY crystallography, putative translation factor, PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.115.1.1 PDB: 1kk9_A Length = 206 Back     alignment and structure
>1hru_A YRDC gene product; protein folding, structural genomics, RNA, SUA5, PSI, protein structure initiative, midwest center for structural genomics; 2.00A {Escherichia coli} SCOP: d.115.1.1 Length = 188 Back     alignment and structure
>2yv4_A Hypothetical protein PH0435; alpha and beta proteins (A+B), SUA5 domain, structural genomics, NPPSFA; 2.00A {Pyrococcus horikoshii OT3} Length = 105 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target330 hypothetical protein CLIBASIA_03235 [Candidatus Liberib
2eqa_A352 Hypothetical protein ST1526; YRDC/RIBB fold, YRDC domai 100.0
3l7v_A295 Putative uncharacterized protein SMU.1377C; transcripti 100.0
1jcu_A208 Conserved protein MTH1692; mixed alpha-beta structure, 100.0
1k7j_A206 Protein YCIO, protein TF1; structural genomics, X-RAY c 100.0
1hru_A188 YRDC gene product; protein folding, structural genomics 100.0
2yv4_A105 Hypothetical protein PH0435; alpha and beta proteins (A 99.61
>2eqa_A Hypothetical protein ST1526; YRDC/RIBB fold, YRDC domain, SUA5 domain, structural genomics, NPPSFA; HET: AMP; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
Probab=100.00  E-value=0  Score=649.10  Aligned_cols=315  Identities=32%  Similarity=0.486  Sum_probs=276.9

Q ss_pred             EEECC----CCHHHHHHHHHHHHCCCEEEEECCCHHEEECCCCCHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHH-C
Q ss_conf             44317----999999999999975985999077800040279999999999997088810654999679899776420-0
Q gi|254780760|r    2 QIMSI----TDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHAS-V   76 (330)
Q Consensus         2 ~~~~~----~d~~~i~~a~~~L~~G~~v~~PTeTvYGlg~~a~~~~av~~I~~~K~Rp~~~Pli~~v~~~~~~~~~~~-~   76 (330)
                      +|+++    .|.+.|++|+++|++|++|+|||||||||||||+|++||+|||++|+||.+||||+||+|++++.+|+. +
T Consensus         3 ~i~~i~~~~p~~~~i~~Aa~~L~~G~vV~~PTeTvYGLga~a~n~~Av~kI~~~K~Rp~~kPliv~v~~~~~~~~~~~~~   82 (352)
T 2eqa_A            3 QIIKIDPLNPEIDKIKIAADVIRNGGTVAFPTETVYGLGANAFDGNACLKIFQAKNRPVDNPLIVHIADFNQLFEVAKDI   82 (352)
T ss_dssp             EEEECCSSSCCHHHHHHHHHHHHTTCCEEECCSSSCEEEEETTCHHHHHHHHHHHTCCTTSCCEEECSSHHHHHHHEESC
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCEEEECCCCHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHC
T ss_conf             07983899989899999999996799899987860057875999999999999719997898799987999999874006


Q ss_pred             CCHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHH-HHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             5204689985058871886146787811655544457633224156-676664201421212343334854330177776
Q gi|254780760|r   77 DPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCG-FTKKLIETYGHPLAIPSANRSGQISITNVKHIL  155 (330)
Q Consensus        77 ~~~~~~l~~~fwPGplT~il~~~~~~~i~~~~t~~~~tvavRiP~h-~~~~ll~~~~~Piaa~SAN~sG~~Spt~a~~v~  155 (330)
                      ++.+++|+++|||||||+|++.+  ..+++.+++|++|||||||+| ++++|++.+|.||++||||+||++|||+++||+
T Consensus        83 ~~~~~~l~~~fwPGplTlil~~~--~~~~~~~~~~~~tVgvRiP~h~~~~~Ll~~~g~PlaatSAN~sG~~s~t~~~~v~  160 (352)
T 2eqa_A           83 PDKVLEIAQIVWPGPLTFVLKKT--ERVPKEVTAGLDTVAVRMPAHPIALQLIRESGVPIAAPSANLATRPSPTKAEDVI  160 (352)
T ss_dssp             CHHHHHHHHHHCSSSEEEEEEEC--TTSCHHHHTTCSEEEEECCCCHHHHHHHHHHTSCEEECBSSCTTSCCCCSHHHHH
T ss_pred             HHHHHHHHHHCCCCCCEEEECCC--CCCCCEECCCCCEEEEECCCCHHHHHHHHCCCCCEEECCCCCCCCCCCHHHHHHH
T ss_conf             79999998750478510342057--6665200289963999924968999998515985651344666544540157999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEECCCCCHHHHHHHCCCEECC----CCCCCCCCCCCCCCCCCCC
Q ss_conf             644065542112766456676730699626982434424887888877422730013----3334433223333210012
Q gi|254780760|r  156 SSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELEY----CVDETSTPQSPGMLKSHYA  231 (330)
Q Consensus       156 ~~~~~~~i~~ildgg~~~~GieSTiid~~~~~~~~IlR~G~i~~~~i~~~l~~~v~~----~~~~~~~~~SPG~~~~HYA  231 (330)
                       ++|++++++|+|||.|..|+||||||++++ +++|||+|+|+.++|+++++..+..    ...+.+.++||||+|+|||
T Consensus       161 -~~~~~~vd~Ildgg~~~~g~eSTIVd~~~~-~~~IlR~G~is~e~I~~~l~~~~~~~~~~~~~~~~~~~sPG~~~~HYs  238 (352)
T 2eqa_A          161 -VDLNGRVDVIIDGGHTFFGVESTIINVTVE-PPVLLRPGPFTIEELKKLFGEIVIPEFAQGKKEAEIALAPGMKYKHYA  238 (352)
T ss_dssp             -HHHTTTSSEEEECCCCSSCSCCEEEECSCC-C-EEEECCSSCHHHHHHHCTTCBC-------------------CCCCS
T ss_pred             -HHHCCCCCEEEECCCCCCCCCCCEEEECCC-CCEEEECCCCCHHHHHHHHCCEEECCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             -985898759996687788999825882389-856995688999999987487153131112333355668532332558


Q ss_pred             CCCCHHHHCCCCC-----------CCCCEEEECCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             4531011101357-----------77000002022235656651799759999999999989999999997799899996
Q gi|254780760|r  232 PRSQVRLRAIHVN-----------PREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFNLFNYMKIADDSGASSIAFS  300 (330)
Q Consensus       232 P~~~V~L~~~~~~-----------~~e~ll~~~~~~~~~~~~~~~~~~Ls~~gd~~eaA~nLY~~LR~lD~~~~~~I~ve  300 (330)
                      |+++++|+.....           .+..++.+....  ........+.||..+|++|||+|||+.||++|+.+++.|+++
T Consensus       239 P~~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~--~~~~~~~~~~ls~~~d~~e~a~~Ly~~Lr~lD~~~~~~I~v~  316 (352)
T 2eqa_A          239 PNTRLLLVENRNIFKDVVSLLSKKYKVALLIPKELS--KEFEGLQQIILGSDENLYEVARNLFDSFRELDKLNVDLGIMI  316 (352)
T ss_dssp             CSSEEEEECCGGGHHHHHHHHTTTSCEEEEEEGGGT--GGGTTSEEEEEECTTCHHHHHHHHHHHHHHHHHSCCSEEEEE
T ss_pred             CCCEEEEECCCCCHHHHHHHHCCCCEEEEEECHHHC--CCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             872499943752058999985668707998410000--024775289968999999999999999999866799989998


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             3888761089998999840583
Q gi|254780760|r  301 SIPNHGLGIAINNRLERAAAPR  322 (330)
Q Consensus       301 ~ip~~glg~AI~DRL~RAA~~r  322 (330)
                      .+|++|+|.||||||+|||+++
T Consensus       317 ~~p~~glg~Ai~dRL~rAA~~~  338 (352)
T 2eqa_A          317 GFPERGIGFAIMNRARKASGFS  338 (352)
T ss_dssp             CCCCSTTHHHHHHHHHHHTTSC
T ss_pred             CCCCCCCHHHHHHHHHHHCCCC
T ss_conf             2899880899999999875999



>3l7v_A Putative uncharacterized protein SMU.1377C; transcription; 2.26A {Streptococcus mutans} Back     alignment and structure
>1jcu_A Conserved protein MTH1692; mixed alpha-beta structure, structural genomics; NMR {Methanothermobacterthermautotrophicus} SCOP: d.115.1.1 Back     alignment and structure
>1k7j_A Protein YCIO, protein TF1; structural genomics, X-RAY crystallography, putative translation factor, PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.115.1.1 PDB: 1kk9_A Back     alignment and structure
>1hru_A YRDC gene product; protein folding, structural genomics, RNA, SUA5, PSI, protein structure initiative, midwest center for structural genomics; 2.00A {Escherichia coli} SCOP: d.115.1.1 Back     alignment and structure
>2yv4_A Hypothetical protein PH0435; alpha and beta proteins (A+B), SUA5 domain, structural genomics, NPPSFA; 2.00A {Pyrococcus horikoshii OT3} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 330 hypothetical protein CLIBASIA_03235 [Candidatus Liberib
d1jcua_208 d.115.1.1 (A:) Hypothetical protein MTH1692 {Archaeon M 7e-24
d1k7ja_206 d.115.1.1 (A:) Hypothetical protein YciO {Escherichia c 9e-23
d1hrua_186 d.115.1.1 (A:) Hypothetical protein YrdC {Escherichia c 1e-20
>d1jcua_ d.115.1.1 (A:) Hypothetical protein MTH1692 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: YrdC/RibB
superfamily: YrdC/RibB
family: YrdC-like
domain: Hypothetical protein MTH1692
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
 Score =  105 bits (261), Expect = 7e-24
 Identities = 48/204 (23%), Positives = 85/204 (41%), Gaps = 10/204 (4%)

Query: 1   MQIMSITDSN----ALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPA 56
           M I  IT  N     L +A   ++ G  +  PT+T+YGL V++ +  A+RRL+ +K R  
Sbjct: 1   MLIRKITRKNPSPDVLEEAISVMEGGGIVIYPTDTIYGLGVNALDEDAVRRLFRVKGRSP 60

Query: 57  MNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTAC 116
             P+   VS +  + + +        +  +    P    + L     I  + T       
Sbjct: 61  HKPVSICVSCVDEIPRFSRPSG--DAMELMERILPGPYTVVLERNELIPDVITGGSSRVG 118

Query: 117 FRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIPLIIDGGISKIGL 176
            RVP     + I     P+   SAN SG+     ++ I+       + L++D G      
Sbjct: 119 IRVPDDEICRRIAAR-FPVTATSANISGKPPSPRLEEIV--RDLDAVDLVLDAGDCLDME 175

Query: 177 ESTIVNVQCEKKVRILRPGGLEIE 200
            ST++++      R+LR G   ++
Sbjct: 176 PSTVIDL-TVNPPRVLRRGKGPLD 198


>d1k7ja_ d.115.1.1 (A:) Hypothetical protein YciO {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1hrua_ d.115.1.1 (A:) Hypothetical protein YrdC {Escherichia coli [TaxId: 562]} Length = 186 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target330 hypothetical protein CLIBASIA_03235 [Candidatus Liberib
d1jcua_208 Hypothetical protein MTH1692 {Archaeon Methanobacterium 100.0
d1k7ja_206 Hypothetical protein YciO {Escherichia coli [TaxId: 562 100.0
d1hrua_186 Hypothetical protein YrdC {Escherichia coli [TaxId: 562 100.0
>d1jcua_ d.115.1.1 (A:) Hypothetical protein MTH1692 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: YrdC/RibB
superfamily: YrdC/RibB
family: YrdC-like
domain: Hypothetical protein MTH1692
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=100.00  E-value=0  Score=374.31  Aligned_cols=196  Identities=26%  Similarity=0.425  Sum_probs=177.9

Q ss_pred             CEEECCC----CHHHHHHHHHHHHCCCEEEEECCCHHEEECCCCCHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHC
Q ss_conf             9443179----999999999999759859990778000402799999999999970888106549996798997764200
Q gi|254780760|r    1 MQIMSIT----DSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASV   76 (330)
Q Consensus         1 m~~~~~~----d~~~i~~a~~~L~~G~~v~~PTeTvYGlg~~a~~~~av~~I~~~K~Rp~~~Pli~~v~~~~~~~~~~~~   76 (330)
                      |.|.+++    +++.|++|+++|++|++|+||||||||||||++|++||+|||++|+|+.++|+++++++++++..|+.+
T Consensus         1 m~i~~i~~~n~~~~~i~~a~~~L~~Ggivi~PTdtvYgl~c~a~~~~av~~i~~lK~R~~~kp~~vl~~~~~~~~~~~~~   80 (208)
T d1jcua_           1 MLIRKITRKNPSPDVLEEAISVMEGGGIVIYPTDTIYGLGVNALDEDAVRRLFRVKGRSPHKPVSICVSCVDEIPRFSRP   80 (208)
T ss_dssp             CCSCCCCSSCCCCHHHHHHHHHHHTTCEEECCCSSSCEEEEETTSHHHHHHHHHHCCSCTTSCCEEECSCTTTSTTTEEC
T ss_pred             CEEEECCCCCCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEECCCCHHHHHHHHHHCCCCCCCHHEECCHHHHHHHHHHH
T ss_conf             97998489996999999999999769979997686303677079917899999863013333121000055532244455


Q ss_pred             CCHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHH-HHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             5204689985058871886146787811655544457633224156-676664201421212343334854330177776
Q gi|254780760|r   77 DPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCG-FTKKLIETYGHPLAIPSANRSGQISITNVKHIL  155 (330)
Q Consensus        77 ~~~~~~l~~~fwPGplT~il~~~~~~~i~~~~t~~~~tvavRiP~h-~~~~ll~~~~~Piaa~SAN~sG~~Spt~a~~v~  155 (330)
                      ++.+++++++|||||+|+|++.  +..++..++++.++||||+|+| ++++|++.  +||++||||+||++++++.+++.
T Consensus        81 ~~~~~~l~~~~~pgp~Tii~~~--~~~~~~~~~~~~~~vgiRip~~~~~~~L~~~--~Pl~~TSAN~sG~~~~~~~~ei~  156 (208)
T d1jcua_          81 SGDAMELMERILPGPYTVVLER--NELIPDVITGGSSRVGIRVPDDEICRRIAAR--FPVTATSANISGKPPSPRLEEIV  156 (208)
T ss_dssp             CHHHHHHHHHSCSSSEEEEEEE--CSCCCHHHHTTTTEEEEECCSCHHHHHHHHH--SCEEEEECCSSSCCSCSCHHHHH
T ss_pred             HHHHHHHHHCCCCCCCCEEHHH--HHHHHHHHCCCCCCEEEECCCHHHHHHHHCC--CCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             6888886401565444110111--1004565259963000325662778887507--98111124533232210368999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEECCCCCHHHHH
Q ss_conf             644065542112766456676730699626982434424887888877
Q gi|254780760|r  156 SSSICKEIPLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLK  203 (330)
Q Consensus       156 ~~~~~~~i~~ildgg~~~~GieSTiid~~~~~~~~IlR~G~i~~~~i~  203 (330)
                       ++|+ .+|+|+|+|.|..|.+||||||++ ++++|||+|+++.++|.
T Consensus       157 -~~~~-~vd~iid~g~~~~~~~STIid~~~-~~~~IlR~G~i~~~~i~  201 (208)
T d1jcua_         157 -RDLD-AVDLVLDAGDCLDMEPSTVIDLTV-NPPRVLRRGKGPLDPVL  201 (208)
T ss_dssp             -HHSS-SSEECCSSCCCSCSCCCEEECCCS-SSCCEEECCCSSCCCCC
T ss_pred             -HHHC-CCCEEEECCCCCCCCCCEEEEEEC-CCEEEEEECCCCHHHHH
T ss_conf             -9855-866899798677999998899138-93499994799778987



>d1k7ja_ d.115.1.1 (A:) Hypothetical protein YciO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hrua_ d.115.1.1 (A:) Hypothetical protein YrdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 330 hypothetical protein CLIBASIA_03235 [Candidatus Li
1k7j_A_206 (A:) Protein YCIO, protein TF1; structural genomic 4e-36
2eqa_A_1-225225 (A:1-225) Hypothetical protein ST1526; YRDC/RIBB f 5e-36
1hru_A_188 (A:) YRDC gene product; protein folding, structura 2e-33
2yv4_A_105 (A:) Hypothetical protein PH0435; alpha and beta p 1e-22
2eqa_A_226-352127 (A:226-352) Hypothetical protein ST1526; YRDC/RIBB 3e-21
1jcu_A_1-58_124-171106 (A:1-58,A:124-171) Conserved protein MTH1692; mixe 4e-12
1jcu_A_59-123_172-208102 (A:59-123,A:172-208) Conserved protein MTH1692; mi 2e-10
>1k7j_A (A:) Protein YCIO, protein TF1; structural genomics, X-RAY crystallography, putative translation factor, PSI, protein structure initiative; 1.40A {Escherichia coli}Length = 206 Back     alignment and structure
 Score =  146 bits (369), Expect = 4e-36
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 6/197 (3%)

Query: 8   DSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDI 67
               + +A E +  G  I  PT++ Y L     +  A  R+  I++ P  +       D+
Sbjct: 13  QQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAXERICRIRQLPDGHNFTLXCRDL 72

Query: 68  SMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVP-CGFTKK 126
           S +  ++ VD ++  L K   PG  T +L   +      L     KT   RVP     + 
Sbjct: 73  SELSTYSFVDNVAFRLXKNNTPGNYTFILK-GTKEVPRRLLQEKRKTIGXRVPSNPIAQA 131

Query: 127 LIETYGHPLAIPSANRSGQ-ISITNVKHILSSSICKEIPLIIDGGISKIGLESTIVNVQC 185
           L+E  G P    S    G   + ++ + I    + K++ LII GG       +T++++  
Sbjct: 132 LLEALGEPXLSTSLXLPGSEFTESDPEEIK-DRLEKQVDLIIHGGYL-GQKPTTVIDLT- 188

Query: 186 EKKVRILRPGGLEIETL 202
           +    ++R G  +++  
Sbjct: 189 DDTPVVVREGVGDVKPF 205


>2eqa_A (A:1-225) Hypothetical protein ST1526; YRDC/RIBB fold, YRDC domain, SUA5 domain, structural genomics, NPPSFA; HET: AMP; 1.80A {Sulfolobus tokodaii}Length = 225 Back     alignment and structure
>1hru_A (A:) YRDC gene product; protein folding, structural genomics, RNA, SUA5, PSI, protein structure initiative, midwest center for structural genomics; 2.00A {Escherichia coli}Length = 188 Back     alignment and structure
>2yv4_A (A:) Hypothetical protein PH0435; alpha and beta proteins (A+B), SUA5 domain, structural genomics, NPPSFA; 2.00A {Pyrococcus horikoshii OT3}Length = 105 Back     alignment and structure
>2eqa_A (A:226-352) Hypothetical protein ST1526; YRDC/RIBB fold, YRDC domain, SUA5 domain, structural genomics, NPPSFA; HET: AMP; 1.80A {Sulfolobus tokodaii}Length = 127 Back     alignment and structure
>1jcu_A (A:1-58,A:124-171) Conserved protein MTH1692; mixed alpha-beta structure, structural genomics; NMR {Methanothermobacterthermautotrophicus}Length = 106 Back     alignment and structure
>1jcu_A (A:59-123,A:172-208) Conserved protein MTH1692; mixed alpha-beta structure, structural genomics; NMR {Methanothermobacterthermautotrophicus}Length = 102 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target330 hypothetical protein CLIBASIA_03235 [Candidatus Liberib
2eqa_A_1-225225 Hypothetical protein ST1526; YRDC/RIBB fold, YRDC 100.0
1k7j_A_206 Protein YCIO, protein TF1; structural genomics, X- 100.0
1hru_A_188 YRDC gene product; protein folding, structural gen 100.0
2eqa_A_226-352127 Hypothetical protein ST1526; YRDC/RIBB fold, YRDC 99.93
2yv4_A_105 Hypothetical protein PH0435; alpha and beta protei 99.92
1jcu_A_1-58_124-171106 Conserved protein MTH1692; mixed alpha-beta struct 99.81
1jcu_A_59-123_172-208102 Conserved protein MTH1692; mixed alpha-beta struct 99.79
>2eqa_A (A:1-225) Hypothetical protein ST1526; YRDC/RIBB fold, YRDC domain, SUA5 domain, structural genomics, NPPSFA; HET: AMP; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
Probab=100.00  E-value=0  Score=378.11  Aligned_cols=201  Identities=34%  Similarity=0.563  Sum_probs=188.3

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCHHEEECCCCCHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHC-CCHHHHHHH
Q ss_conf             9999999999999759859990778000402799999999999970888106549996798997764200-520468998
Q gi|254780760|r    7 TDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAIRRLYEIKKRPAMNPLICHVSDISMVKKHASV-DPLSLHLAK   85 (330)
Q Consensus         7 ~d~~~i~~a~~~L~~G~~v~~PTeTvYGlg~~a~~~~av~~I~~~K~Rp~~~Pli~~v~~~~~~~~~~~~-~~~~~~l~~   85 (330)
                      .+.+.+++|+++|++|++|++||||||||+|+++|++||+|||++|+||.+|||+++++|++++..|+.. ++.++++++
T Consensus        12 ~~~~~i~~a~~~L~~Ggvi~~PTdtvYgl~~~~~~~~Av~ri~~~K~R~~~Kpl~ll~~~~~~~~~~~~~~~~~~~~l~~   91 (225)
T 2eqa_A           12 PEIDKIKIAADVIRNGGTVAFPTETVYGLGANAFDGNACLKIFQAKNRPVDNPLIVHIADFNQLFEVAKDIPDKVLEIAQ   91 (225)
T ss_dssp             CCHHHHHHHHHHHHTTCCEEECCSSSCEEEEETTCHHHHHHHHHHHTCCTTSCCEEECSSHHHHHHHEESCCHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCEEEECCCCHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999996799899987870046875999999999999729998898799985999999886566899999887


Q ss_pred             HCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHH-HHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             5058871886146787811655544457633224156-676664201421212343334854330177776644065542
Q gi|254780760|r   86 LFWPGPLTLVLDLLSTTDIHPLSTANLKTACFRVPCG-FTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEIP  164 (330)
Q Consensus        86 ~fwPGplT~il~~~~~~~i~~~~t~~~~tvavRiP~h-~~~~ll~~~~~Piaa~SAN~sG~~Spt~a~~v~~~~~~~~i~  164 (330)
                      +|||||+|+|+|.+  ..+++.++++.+|||||+|+| ++++|++++|.||++||||+||++++++.+++. ++|++.+|
T Consensus        92 ~~~PgPiTlI~~~~--~~~p~~l~~~~~tvgiRip~~~~~~~Ll~~~g~Pl~~TSAN~sG~~~~~~~~~i~-~~~~~~vd  168 (225)
T 2eqa_A           92 IVWPGPLTFVLKKT--ERVPKEVTAGLDTVAVRXPAHPIALQLIRESGVPIAAPSANLATRPSPTKAEDVI-VDLNGRVD  168 (225)
T ss_dssp             HHCSSSEEEEEEEC--TTSCHHHHTTCSEEEEECCCCHHHHHHHHHHTSCEEECBSSCTTSCCCCSHHHHH-HHHTTTSS
T ss_pred             HCCCCCCCEEECCC--CCCCHHHCCCCEEEEEECCCCHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHH-HHHCCCCC
T ss_conf             33887663364167--6676211599705888568988999998427982675113334444552056899-98678878


Q ss_pred             CCCCCCCCCCCCCCEEEEEECCCCEEEEECCCCCHHHHHHHCCCEEC
Q ss_conf             11276645667673069962698243442488788887742273001
Q gi|254780760|r  165 LIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELE  211 (330)
Q Consensus       165 ~ildgg~~~~GieSTiid~~~~~~~~IlR~G~i~~~~i~~~l~~~v~  211 (330)
                      +++|+|.|..|.+|||||+++ +.++|+|+|+++.++|+++++..+.
T Consensus       169 ~vid~g~~~~~~~STIvd~~~-~~~~ilR~G~~~~~~i~~~~~~~~~  214 (225)
T 2eqa_A          169 VIIDGGHTFFGVESTIINVTV-EPPVLLRPGPFTIEELKKLFGEIVI  214 (225)
T ss_dssp             EEEECCCCSSCSCCEEEECSC-CC-EEEECCSSCHHHHHHHCTTCBC
T ss_pred             EEEEECCCCCCCCCCEEEEEC-CCEEEEECCCCCHHHHHHHHHHHCC
T ss_conf             998303456688773588740-6427996377578999998762023



>1k7j_A (A:) Protein YCIO, protein TF1; structural genomics, X-RAY crystallography, putative translation factor, PSI, protein structure initiative; 1.40A {Escherichia coli} Back     alignment and structure
>1hru_A (A:) YRDC gene product; protein folding, structural genomics, RNA, SUA5, PSI, protein structure initiative, midwest center for structural genomics; 2.00A {Escherichia coli} Back     alignment and structure
>2eqa_A (A:226-352) Hypothetical protein ST1526; YRDC/RIBB fold, YRDC domain, SUA5 domain, structural genomics, NPPSFA; HET: AMP; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>2yv4_A (A:) Hypothetical protein PH0435; alpha and beta proteins (A+B), SUA5 domain, structural genomics, NPPSFA; 2.00A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1jcu_A (A:1-58,A:124-171) Conserved protein MTH1692; mixed alpha-beta structure, structural genomics; NMR {Methanothermobacterthermautotrophicus} Back     alignment and structure
>1jcu_A (A:59-123,A:172-208) Conserved protein MTH1692; mixed alpha-beta structure, structural genomics; NMR {Methanothermobacterthermautotrophicus} Back     alignment and structure