254780761

254780761

probable FAD-dependent oxidoreductase protein

GeneID in NCBI database:8209767Locus tag:CLIBASIA_03240
Protein GI in NCBI database:254780761Protein Accession:YP_003065174.1
Gene range:-(504260, 505681)Protein Length:473aa
Gene description:probable FAD-dependent oxidoreductase protein
COG prediction:[C] FAD/FMN-containing dehydrogenases
KEGG prediction:probable FAD-dependent oxidoreductase protein
SEED prediction:D-2-hydroxyglutarate dehydrogenase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MNQLSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNPGKFL
ccccHHHHHHHHHHHcccccEEccHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHHccccEEEEcccccccccccccccccEEEEEccccccEEEEEccccEEEEEccccHHHHHHHHHHcccEEcccccccccccccHHHHcccccccccccHHHHHHEEEEEEEcccccEEEcccccccccccHHHHHHHcccccHHHEEEEEEEEEEEccccEEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHcccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHccccccccEEEcccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccc
cccccHHHHHHHHHHHccccccccHHHHHHccccccccccccccEEEccccHHHHHHHHHHHHHccccEEEccccccccccccccccccEEEEEEHHccccccccccccEEEEcccHHHHHHHHHHHHcccccccccccccccEEccccccccccHHEEEEcccHHHccccEEEcccccEHHcccccccccccccHHHHcccccccHEEEEHHHHHcccccHHHEEEEEccccHHHHHHHHHHHHHHcccccHHHHHccHHHHHHHHHHHccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEccccccHccHHHHHHcccHHHHHHHHHHHHHHcccccccccccc
MNQLSLDLIQRFISIvgsegilddqklispylteerkiyhgtsplvllpscthEVSQILKLATetntsitpqggntglvggqiprknrKDIILSIKRMnrirdidlrsntiaVDAGINLFNVQKIAeknhrlfplslpsekychiggnlatnaggtaVLSYGNIRHLCLGIeavlptgdiwNGMHKlikdnsrydirdlligsegtlgIITGAVLRllpyrtgkqVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKhipntfsplsdtspwyILLEISSTETLERAQNIANTILAtgfnkkiltewilpsldeeKNAIWCLRnniplaqkregrsikhdisvpigqiPSFLQEVKKSvssifpktriglfghigdgnihfnvfpptdenqdEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEifdpagimnpgkfl
MNQLSLDLIQRFIsivgsegilddQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLATetntsitpqggntglvggqiprknRKDIILSikrmnrirdidlrsntiaVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTfsplsdtspWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKeifdpagimnpgkfl
MNQLSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIggnlatnaggtaVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNsleqalqllqlsqKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTeikimkkikeiFDPAGIMNPGKFL
****SLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNPGKFL
MNQLSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNPGKFL
*NQLSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQLSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNPGKFL
MNQLSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNPGKFL
MNQLSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNPGKFL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target473 probable FAD-dependent oxidoreductase protein [Candidat
315121976475 probable FAD-dependent oxidoreductase protein [Candidat 1 0.0
190890610478 FAD-dependent oxidoreductase [Rhizobium etli CIAT 652] 1 1e-142
86356544477 FAD-dependent oxidoreductase protein [Rhizobium etli CF 1 1e-140
327188121478 putative FAD-dependent oxidoreductase protein [Rhizobiu 1 1e-140
209548152478 FAD linked oxidase [Rhizobium leguminosarum bv. trifoli 1 1e-139
325292108477 FAD dependent oxidoreductase [Agrobacterium sp. H13-3] 1 1e-139
15888067478 FAD dependent oxidoreductase [Agrobacterium tumefaciens 1 1e-138
241203340475 FAD linked oxidase domain protein [Rhizobium leguminosa 1 1e-138
116250733476 FAD binding oxidoreductase [Rhizobium leguminosarum bv. 1 1e-138
222085081476 FAD-dependent oxidoreductase protein [Agrobacterium rad 1 1e-137
>gi|315121976|ref|YP_004062465.1| probable FAD-dependent oxidoreductase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 475 Back     alignment and organism information
 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/475 (78%), Positives = 418/475 (88%), Gaps = 2/475 (0%)

Query: 1   MNQLSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILK 60
           MN+LS DL+Q+F SIVG EGIL DQ+LISPYL EER +YHGTSPLVLLPSCT+EVSQILK
Sbjct: 1   MNKLSPDLVQKFTSIVGQEGILQDQQLISPYLKEERNLYHGTSPLVLLPSCTNEVSQILK 60

Query: 61  LATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLF 120
           LAT T T ITPQGGNTGLVGGQIPR+N+KDIILS++RMNRIRDIDL SNTI+VDAGINL 
Sbjct: 61  LATATRTPITPQGGNTGLVGGQIPRRNKKDIILSLERMNRIRDIDLISNTISVDAGINLL 120

Query: 121 NVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDI 180
           NV+K+AEK HRLFPLSLPSE++C IGGNLATNAGGTAVLSYGNIR LCLGIEAVLPTG+ 
Sbjct: 121 NVRKLAEKYHRLFPLSLPSEQFCQIGGNLATNAGGTAVLSYGNIRDLCLGIEAVLPTGET 180

Query: 181 WNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQL 240
           WNGM KLIKDNS YD+RDLLIGSEGTLGIITGAVL+L PY TGKQVA IAVNSLE+ALQL
Sbjct: 181 WNGMRKLIKDNSCYDVRDLLIGSEGTLGIITGAVLKLFPYPTGKQVALIAVNSLEKALQL 240

Query: 241 LQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQN 300
           LQLSQK + + LTAFELIS+ IL+LV+KHIP  F  L  +SPWYILLEIS+T   E+A  
Sbjct: 241 LQLSQKISDNTLTAFELISDSILELVIKHIPYNFPTLKQSSPWYILLEISTTAIKEKAYE 300

Query: 301 IANTILATGFNKKILTEWILPS--LDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQ 358
           I +TIL+ GF K+I+TEWIL S   DE +N+IW LRNN+PLAQK+EGRSIKHDIS+PI  
Sbjct: 301 IIDTILSEGFKKEIVTEWILSSSDTDERENSIWYLRNNVPLAQKKEGRSIKHDISIPIKD 360

Query: 359 IPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVY 418
           IPSFL+EV  +V S+FP TRIGLFGHIGDGNIHFNVFPPT++N +EFLS +WN INNIVY
Sbjct: 361 IPSFLKEVTNAVLSVFPTTRIGLFGHIGDGNIHFNVFPPTNDNPEEFLSQNWNEINNIVY 420

Query: 419 SVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNPGKFL 473
           SVVLSYGGSIAAEHGIGQLHK+RL  IL+PTE+ +MKKIKE FDPAGIMNPGKFL
Sbjct: 421 SVVLSYGGSIAAEHGIGQLHKERLGRILDPTEMMLMKKIKETFDPAGIMNPGKFL 475


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190890610|ref|YP_001977152.1| FAD-dependent oxidoreductase [Rhizobium etli CIAT 652] Length = 478 Back     alignment and organism information
>gi|86356544|ref|YP_468436.1| FAD-dependent oxidoreductase protein [Rhizobium etli CFN 42] Length = 477 Back     alignment and organism information
>gi|327188121|gb|EGE55343.1| putative FAD-dependent oxidoreductase protein [Rhizobium etli CNPAF512] Length = 478 Back     alignment and organism information
>gi|209548152|ref|YP_002280069.1| FAD linked oxidase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 478 Back     alignment and organism information
>gi|325292108|ref|YP_004277972.1| FAD dependent oxidoreductase [Agrobacterium sp. H13-3] Length = 477 Back     alignment and organism information
>gi|15888067|ref|NP_353748.1| FAD dependent oxidoreductase [Agrobacterium tumefaciens str. C58] Length = 478 Back     alignment and organism information
>gi|241203340|ref|YP_002974436.1| FAD linked oxidase domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 475 Back     alignment and organism information
>gi|116250733|ref|YP_766571.1| FAD binding oxidoreductase [Rhizobium leguminosarum bv. viciae 3841] Length = 476 Back     alignment and organism information
>gi|222085081|ref|YP_002543611.1| FAD-dependent oxidoreductase protein [Agrobacterium radiobacter K84] Length = 476 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target473 probable FAD-dependent oxidoreductase protein [Candidat
COG0277459 COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energ 8e-85
PRK11230499 PRK11230, PRK11230, glycolate oxidase subunit GlcD; Pro 2e-31
KOG1231505 KOG1231, KOG1231, KOG1231, Proteins containing the FAD 6e-24
KOG1232511 KOG1232, KOG1232, KOG1232, Proteins containing the FAD 1e-93
TIGR00387413 TIGR00387, glcD, glycolate oxidase, subunit GlcD 3e-58
PLN02805555 PLN02805, PLN02805, D-lactate dehydrogenase [cytochrome 6e-33
pfam02913247 pfam02913, FAD-oxidase_C, FAD linked oxidases, C-termin 2e-38
pfam01565138 pfam01565, FAD_binding_4, FAD binding domain 2e-26
KOG1233613 KOG1233, KOG1233, KOG1233, Alkyl-dihydroxyacetonephosph 2e-18
TIGR01678438 TIGR01678, FAD_lactone_ox, sugar 1,4-lactone oxidases 1e-05
KOG4730518 KOG4730, KOG4730, KOG4730, D-arabinono-1, 4-lactone oxi 8e-05
TIGR01677557 TIGR01677, pln_FAD_oxido, plant-specific FAD-dependent 4e-04
PRK11183564 PRK11183, PRK11183, D-lactate dehydrogenase; Provisiona 2e-07
KOG1262543 KOG1262, KOG1262, KOG1262, FAD-binding protein DIMINUTO 2e-04
KOG1233613 KOG1233, KOG1233, KOG1233, Alkyl-dihydroxyacetonephosph 0.002
>gnl|CDD|30625 COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183043 PRK11230, PRK11230, glycolate oxidase subunit GlcD; Provisional Back     alignment and domain information
>gnl|CDD|36445 KOG1231, KOG1231, KOG1231, Proteins containing the FAD binding domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|36446 KOG1232, KOG1232, KOG1232, Proteins containing the FAD binding domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|129482 TIGR00387, glcD, glycolate oxidase, subunit GlcD Back     alignment and domain information
>gnl|CDD|178402 PLN02805, PLN02805, D-lactate dehydrogenase [cytochrome] Back     alignment and domain information
>gnl|CDD|145852 pfam02913, FAD-oxidase_C, FAD linked oxidases, C-terminal domain Back     alignment and domain information
>gnl|CDD|144965 pfam01565, FAD_binding_4, FAD binding domain Back     alignment and domain information
>gnl|CDD|36447 KOG1233, KOG1233, KOG1233, Alkyl-dihydroxyacetonephosphate synthase [General function prediction only] Back     alignment and domain information
>gnl|CDD|162481 TIGR01678, FAD_lactone_ox, sugar 1,4-lactone oxidases Back     alignment and domain information
>gnl|CDD|39928 KOG4730, KOG4730, KOG4730, D-arabinono-1, 4-lactone oxidase [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|162480 TIGR01677, pln_FAD_oxido, plant-specific FAD-dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|183022 PRK11183, PRK11183, D-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36476 KOG1262, KOG1262, KOG1262, FAD-binding protein DIMINUTO [General function prediction only] Back     alignment and domain information
>gnl|CDD|36447 KOG1233, KOG1233, KOG1233, Alkyl-dihydroxyacetonephosphate synthase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 473 probable FAD-dependent oxidoreductase protein [Candidat
PRK11230499 glycolate oxidase subunit GlcD; Provisional 100.0
KOG1232511 consensus 100.0
COG0277459 GlcD FAD/FMN-containing dehydrogenases [Energy producti 100.0
KOG1233613 consensus 100.0
KOG1231505 consensus 100.0
PRK11183565 D-lactate dehydrogenase; Provisional 100.0
TIGR00387437 glcD glycolate oxidase, subunit GlcD; InterPro: IPR0044 100.0
PRK11282351 glcE glycolate oxidase FAD binding subunit; Provisional 100.0
TIGR01677577 pln_FAD_oxido plant-specific FAD-dependent oxidoreducta 99.97
TIGR01679426 bact_FAD_ox FAD-linked oxidoreductase; InterPro: IPR010 99.94
pfam02913247 FAD-oxidase_C FAD linked oxidases, C-terminal domain. T 100.0
pfam01565138 FAD_binding_4 FAD binding domain. This family consists 100.0
TIGR02963515 xanthine_xdhA xanthine dehydrogenase, small subunit; In 97.31
TIGR00179327 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Int 96.85
COG4630493 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FA 95.28
KOG4730518 consensus 99.93
TIGR01678505 FAD_lactone_ox sugar 1,4-lactone oxidases; InterPro: IP 99.91
PRK13905298 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.59
COG0812291 MurB UDP-N-acetylmuramate dehydrogenase [Cell envelope 99.59
TIGR01676541 GLDHase galactonolactone dehydrogenase; InterPro: IPR01 99.53
PRK00046348 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.51
PRK13904257 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 98.56
PRK09971292 xanthine dehydrogenase subunit XdhB; Provisional 97.74
PRK09799258 putative selenate reductase subunit YgfM; Provisional 97.72
TIGR03312257 Se_sel_red_FAD probable selenate reductase, FAD-binding 97.7
PRK13906307 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.78
PRK12436305 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisio 99.67
PRK13903359 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.56
KOG1262543 consensus 99.72
pfam09330291 Lact-deh-memb D-lactate dehydrogenase, membrane binding 98.43
TIGR03195321 4hydrxCoA_B 4-hydroxybenzoyl-CoA reductase, beta subuni 97.79
pfam00941171 FAD_binding_5 FAD binding domain in molybdopterin dehyd 97.48
TIGR03199264 pucC xanthine dehydrogenase C subunit. This gene has be 97.07
COG1319284 CoxM Aerobic-type carbon monoxide dehydrogenase, middle 95.27
pfam04030258 ALO D-arabinono-1,4-lactone oxidase. This domain is spe 97.76
pfam09265280 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokin 96.15
pfam0803145 BBE Berberine and berberine like. This domain is found 92.36
>PRK11230 glycolate oxidase subunit GlcD; Provisional Back     alignment and domain information
>KOG1232 consensus Back     alignment and domain information
>COG0277 GlcD FAD/FMN-containing dehydrogenases [Energy production and conversion] Back     alignment and domain information
>KOG1233 consensus Back     alignment and domain information
>KOG1231 consensus Back     alignment and domain information
>PRK11183 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00387 glcD glycolate oxidase, subunit GlcD; InterPro: IPR004490 The glc locus of Escherichia coli encodes the subunits of glycolate oxidase and the glc regulator protein Back     alignment and domain information
>PRK11282 glcE glycolate oxidase FAD binding subunit; Provisional Back     alignment and domain information
>TIGR01677 pln_FAD_oxido plant-specific FAD-dependent oxidoreductase; InterPro: IPR010030 This entry identifies a family of uncharacterised plant-specific FAD-dependent oxidoreductases Back     alignment and domain information
>TIGR01679 bact_FAD_ox FAD-linked oxidoreductase; InterPro: IPR010032 This entry identifies a family of bacterial oxidoreductases with covalently linked FAD, closely related to two different eukaryotic oxidases, L-gulonolactone oxidase (1 Back     alignment and domain information
>pfam02913 FAD-oxidase_C FAD linked oxidases, C-terminal domain Back     alignment and domain information
>pfam01565 FAD_binding_4 FAD binding domain Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit; InterPro: IPR014307 Members of this protein are the small subunit (or, in eukaryotes, the N-terminal domain) of xanthine dehydrogenase, an enzyme of purine catabolism via urate Back     alignment and domain information
>TIGR00179 murB UDP-N-acetylenolpyruvoylglucosamine reductase; InterPro: IPR003170 Members of this family are UDP-N-acetylenolpyruvoylglucosamine reductase enzymes, which are also called UDP-N-acetylmuramate dehydrogenases Back     alignment and domain information
>COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4730 consensus Back     alignment and domain information
>TIGR01678 FAD_lactone_ox sugar 1,4-lactone oxidases; InterPro: IPR010031 This entry identifies a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesising ascorbic acid or a derivative Back     alignment and domain information
>PRK13905 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>COG0812 MurB UDP-N-acetylmuramate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01676 GLDHase galactonolactone dehydrogenase; InterPro: IPR010029 This entry identifies L-galactono-gamma-lactone dehydrogenase 1 Back     alignment and domain information
>PRK00046 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK13904 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK09971 xanthine dehydrogenase subunit XdhB; Provisional Back     alignment and domain information
>PRK09799 putative selenate reductase subunit YgfM; Provisional Back     alignment and domain information
>TIGR03312 Se_sel_red_FAD probable selenate reductase, FAD-binding subunit Back     alignment and domain information
>PRK13906 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK12436 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK13903 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>KOG1262 consensus Back     alignment and domain information
>pfam09330 Lact-deh-memb D-lactate dehydrogenase, membrane binding Back     alignment and domain information
>TIGR03195 4hydrxCoA_B 4-hydroxybenzoyl-CoA reductase, beta subunit Back     alignment and domain information
>pfam00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase Back     alignment and domain information
>TIGR03199 pucC xanthine dehydrogenase C subunit Back     alignment and domain information
>COG1319 CoxM Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM homologs [Energy production and conversion] Back     alignment and domain information
>pfam04030 ALO D-arabinono-1,4-lactone oxidase Back     alignment and domain information
>pfam09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding Back     alignment and domain information
>pfam08031 BBE Berberine and berberine like Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target473 probable FAD-dependent oxidoreductase protein [Candidat
3pm9_A476 Crystal Structure Of A Putative Dehydrogenase (Rpa1 3e-69
2uuu_A584 Alkyldihydroxyacetonephosphate Synthase In P212121 5e-34
1wve_A520 P-Cresol Methylhydroxylase: Alteration Of The Struc 6e-21
1dii_A521 Crystal Structure Of P-Cresol Methylhydroxylase At 8e-21
1e8f_A560 Structure Of The H61t Mutant Of The Flavoenzyme Van 1e-12
1w1k_A560 Structure Of The Octameric Flavoenzyme Vanillyl-Alc 4e-12
1w1l_A560 Structure Of The Octameric Flavoenzyme Vanillyl-Alc 4e-12
2vao_A560 Structure Of The Octameric Flavoenzyme Vanillyl-Alc 4e-12
1w1j_A560 Structure Of The Octameric Flavoenzyme Vanillyl-Alc 5e-12
1dzn_A560 Asp170ser Mutant Of Vanillyl-Alcohol Oxidase Length 6e-12
1qlt_A560 Structure Of The H422a Mutant Of The Flavoenzyme Va 6e-12
1e0y_A560 Structure Of The D170sT457E DOUBLE MUTANT OF VANILL 1e-11
2bvf_A459 Crystal Structure Of 6-Hydoxy-D-Nicotine Oxidase Fr 4e-05
1f0x_A571 Crystal Structure Of D-Lactate Dehydrogenase, A Per 1e-10
1hsk_A326 Crystal Structure Of S. Aureus Murb Length = 326 3e-07
1w1m_A560 Structure Of The Octameric Flavoenzyme Vanillyl-Alc 1e-10
2exr_A524 X-Ray Structure Of Cytokinin OxidaseDEHYDROGENASE ( 4e-06
2qpm_A516 Leu492ala Mutant Of Maize Cytokinin OxidaseDEHYDROG 7e-09
2qkn_A516 Crystal Structure Of Maize Cytokinin OxidaseDEHYDRO 7e-09
1w1o_A534 Native Cytokinin Dehydrogenase Length = 534 2e-08
>gi|315113780|pdb|3PM9|A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution Length = 476 Back     alignment and structure
 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 219/470 (46%), Positives = 296/470 (62%), Gaps = 6/470 (1%)

Query: 4   LSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVSQILKLAT 63
           LS +LI RF +IVG +  L D   +  Y+TEER +Y G SPLVL P  T EV  I KLA 
Sbjct: 13  LSPELIARFTAIVGDKHALTDPLELEAYITEERNLYRGHSPLVLRPGSTEEVVAICKLAN 72

Query: 64  ETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQ 123
           E   ++ PQGGNTGLVGGQ P      +++S+KR ++IR+ID  SNTI V+AG  L  VQ
Sbjct: 73  EARVALVPQGGNTGLVGGQTPHNGE--VVISLKRXDKIREIDTSSNTITVEAGAILQRVQ 130

Query: 124 KIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNG 183
           + A +  RLFPLSL ++  C IGGNL+TNAGGTA L+YG  R   LG+E VL  G + N 
Sbjct: 131 EKAAEVDRLFPLSLGAQGSCTIGGNLSTNAGGTAALAYGLARDXALGVEVVLADGRVXNL 190

Query: 184 MHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQL 243
           + KL KDN+ YD+RDL IG+EGTLGIIT A L+L P     + AF+ + S + AL+LL +
Sbjct: 191 LSKLKKDNTGYDLRDLFIGAEGTLGIITAATLKLFPKPRAVETAFVGLQSPDDALKLLGI 250

Query: 244 SQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTSPWYILLEISSTETLERAQNIAN 303
           +Q  A   LT+FELI+   L   V+H  N   PL    PWY+L+E+SS     R      
Sbjct: 251 AQGEAAGNLTSFELIAETPLDFSVRHA-NNRDPLEARYPWYVLIELSSPRDDAR--AALE 307

Query: 304 TILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFL 363
           +IL  GF   I+ +  + +  +++ A W LR  I  AQK EG SIKHDISVP+  +P F+
Sbjct: 308 SILERGFEDGIVVDAAIANSVQQQQAFWKLREEISPAQKPEGGSIKHDISVPVAAVPQFI 367

Query: 364 QEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLS 423
           ++   +V ++ P  R   FGH+GDGNIH+NV  P   ++ EFL+  W+ ++ +V+ VVL 
Sbjct: 368 EQANAAVVALIPGARPVPFGHLGDGNIHYNVSQPVGADKAEFLA-RWHDVSQVVFEVVLR 426

Query: 424 YGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNPGKFL 473
            GGSI+AEHGIG   +  L  + + T I++ + IK + DP GI NPGK +
Sbjct: 427 LGGSISAEHGIGVXKRDELAEVKDKTAIELXRSIKALLDPHGIXNPGKVV 476


>gi|151568017|pdb|2UUU|A Chain A, Alkyldihydroxyacetonephosphate Synthase In P212121 Length = 584 Back     alignment and structure
>gi|62738319|pdb|1WVE|A Chain A, P-Cresol Methylhydroxylase: Alteration Of The Structure Of The Flavoprotein Subunit Upon Its Binding To The Cytochrome Subunit Length = 520 Back     alignment and structure
gi|6730359|pdb|1DII|A Chain A, Crystal Structure Of P-Cresol Methylhydroxylase At 2.5 A Resolution Length = 521 Back     alignment and structure
>gi|10835625|pdb|1E8F|A Chain A, Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl-Alcohol Oxidase In The Apo Form Length = 560 Back     alignment and structure
>gi|51247987|pdb|1W1K|A Chain A, Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase: Ile238thr Mutant Length = 560 Back     alignment and structure
>gi|51247989|pdb|1W1L|A Chain A, Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase: Phe454tyr Mutant Length = 560 Back     alignment and structure
gi|2624685|pdb|2VAO|A Chain A, Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol Length = 560 Back     alignment and structure
>gi|51247985|pdb|1W1J|A Chain A, Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase: The505ser Mutant Length = 560 Back     alignment and structure
>gi|9955357|pdb|1DZN|A Chain A, Asp170ser Mutant Of Vanillyl-Alcohol Oxidase Length = 560 Back     alignment and structure
>gi|6137466|pdb|1QLT|A Chain A, Structure Of The H422a Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase Length = 560 Back     alignment and structure
>gi|9955361|pdb|1E0Y|A Chain A, Structure Of The D170sT457E DOUBLE MUTANT OF VANILLYL- Alcohol Oxidase Length = 560 Back     alignment and structure
>gi|75766387|pdb|2BVF|A Chain A, Crystal Structure Of 6-Hydoxy-D-Nicotine Oxidase From Arthrobacter Nicotinovorans. Crystal Form 3 (P1) Length = 459 Back     alignment and structure
gi|10120788|pdb|1F0X|A Chain A, Crystal Structure Of D-Lactate Dehydrogenase, A Peripheral Membrane Respiratory Enzyme. Length = 571 Back     alignment and structure
>gi|13787122|pdb|1HSK|A Chain A, Crystal Structure Of S. Aureus Murb Length = 326 Back     alignment and structure
>gi|51247991|pdb|1W1M|A Chain A, Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase: Glu502gly Mutant Length = 560 Back     alignment and structure
>gi|83755013|pdb|2EXR|A Chain A, X-Ray Structure Of Cytokinin OxidaseDEHYDROGENASE (CKX) From Arabidopsis Thaliana At5g21482 Length = 524 Back     alignment and structure
>gi|193506544|pdb|2QPM|A Chain A, Leu492ala Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With Benzylurea Inhibitor Cpbu Length = 516 Back     alignment and structure
>gi|193506540|pdb|2QKN|A Chain A, Crystal Structure Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With Phenylurea Inhibitor Cppu Length = 516 Back     alignment and structure
>gi|52696247|pdb|1W1O|A Chain A, Native Cytokinin Dehydrogenase Length = 534 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target473 probable FAD-dependent oxidoreductase protein [Candidat
1f0x_A571 DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD 5e-83
1e8g_A560 Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, 7e-75
2uuu_A584 Alkyldihydroxyacetonephosphate synthase; rhizomelic cho 7e-64
1wvf_A520 4-cresol dehydrogenase [hydroxylating] flavoprotein sub 2e-54
1w1o_A534 Cytokinin dehydrogenase 1; flavin, oxidoreductase, flav 2e-46
2exr_A524 Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxida 1e-40
2vfr_A422 Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, f 7e-26
2bvf_A459 6-hydroxy-D-nicotine oxidase; autoflavinylation, enanti 6e-24
2ipi_A521 Aclacinomycin oxidoreductase (aknox); anthracycline, fl 2e-35
2wdx_A523 Putative hexose oxidase; oxidoreductase-antibiotic comp 6e-33
3js8_A540 Cholesterol oxidase; cholsterol, organic solvent stabil 2e-27
3fw9_A495 Reticuline oxidase; BI-covalent flavinylation, N-glycos 2e-24
2i0k_A561 Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzy 2e-26
1zr6_A503 Glucooligosaccharide oxidase; alpha + beta, flavoenzyme 6e-20
2yvs_A219 Glycolate oxidase subunit GLCE; oxidoreductase; 2.00A { 4e-18
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 0.002
>1f0x_A DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: d.58.32.2 d.145.1.1 Length = 571 Back     alignment and structure
 Score =  303 bits (777), Expect = 5e-83
 Identities = 86/582 (14%), Positives = 163/582 (28%), Gaps = 137/582 (23%)

Query: 1   MNQLSL----DLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPLVLLPSCTHEVS 56
           M+ ++       +     +VGS  +L D    + Y    R    G +  V+ P    E+ 
Sbjct: 1   MSSMTTTDNKAFLNELARLVGSSHLLTDPAKTARYRKGFRS-GQGDALAVVFPGSLLELW 59

Query: 57  QILKLATETNTSITPQGGNTGLVGGQIPRKN---RKDIILSIKRMNRIRDIDLRSNTIAV 113
           ++LK     +  I  Q  NTGL  G  P  N   R  +I+S  R++++  +  +   +  
Sbjct: 60  RVLKACVTADKIILMQAANTGLTEGSTPNGNDYDRDVVIISTLRLDKLHVLG-KGEQVLA 118

Query: 114 DAGINLFNVQKIAEKNHRLFPLSLPSE-KYCHIGGNLATNAGGTAVLSYGNIRHLCLGIE 172
             G  L++++K  +   R     + S      + G +  N+GG+ V        + L   
Sbjct: 119 YPGTTLYSLEKALKPLGREPHSVIGSSCIGASVIGGICNNSGGSLVQRGPAYTEMSLF-A 177

Query: 173 AVLPTGDIWNGMH-----------------------------KLIKDNSRY--------- 194
            +   G +    H                                  +  Y         
Sbjct: 178 RINEDGKLTLVNHLGIDLGETPEQILSKLDDDRIKDDDVRHDGRHAHDYDYVHRVRDIEA 237

Query: 195 --------DIRDL--LIGSEGTLGIITGAVLRLLPYRTGKQVAFIAVNSLEQALQLLQLS 244
                   D   L    G  G L +     L        +QV +I  N  E   ++ +  
Sbjct: 238 DTPARYNADPDRLFESSGCAGKLAVFA-VRLDTFEAEKNQQVFYIGTNQPEVLTEIRRHI 296

Query: 245 QKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDT------------SPWYILLEISST 292
                ++  A E +   I  +  K+  +TF  +                    +LE    
Sbjct: 297 LANFENLPVAGEYMHRDIYDIAEKYGKDTFLMIDKLGTDKMPFFFNLKGRTDAMLEKVKF 356

Query: 293 ---ETLERAQNIANTILATGFNKK-----------ILTEWILPSLDE------------- 325
                 +RA      +  +    +           +L +     + E             
Sbjct: 357 FRPHFTDRAMQKFGHLFPSHLPPRMKNWRDKYEHHLLLKMAGDGVGEAKSWLVDYFKQAE 416

Query: 326 ---------EKNAIWCLRNNI--------PLAQKREGRSIKHDISVPIGQIPSFLQEVKK 368
                    E +  +  R            +        +  DI++       +     +
Sbjct: 417 GDFFVCTPEEGSKAFLHRFAAAGAAIRYQAVHSDEVEDILALDIALRRNDTEWYEHLPPE 476

Query: 369 SVSSIFPKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSI 428
             S +        +GH      H +       +               +  ++   G   
Sbjct: 477 IDSQL---VHKLYYGHFMCYVFHQDYIVKKGVDVHAL--------KEQMLELLQQRGAQY 525

Query: 429 AAEHGIGQLHKKRLEGILEPTEIKIMKKIKEIFDPAGIMNPG 470
            AEH +G L+K            + ++K     DP   MNPG
Sbjct: 526 PAEHNVGHLYK----------APETLQKFYRENDPTNSMNPG 557


>1e8g_A Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} SCOP: d.58.32.1 d.145.1.1 PDB: 1e8f_A* 1e8h_A* 1qlt_A* 1qlu_A* 1vao_A* 1ahv_A* 1ahz_A* 1ahu_A* 2vao_A* 1w1j_A* 1dzn_A* 1w1l_A* 1e0y_A* 1w1k_A* 1w1m_A* Length = 560 Back     alignment and structure
>2uuu_A Alkyldihydroxyacetonephosphate synthase; rhizomelic chondrodysplasia punctata, biosynthesis of phospholipids, flavoprotein; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Length = 584 Back     alignment and structure
>1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit; electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} SCOP: d.58.32.1 d.145.1.1 PDB: 1wve_A* 1dii_A* 1diq_A* Length = 520 Back     alignment and structure
>1w1o_A Cytokinin dehydrogenase 1; flavin, oxidoreductase, flavoprotein, FAD; HET: NAG FAD; 1.7A {Zea mays} SCOP: d.58.32.4 d.145.1.1 PDB: 1w1q_A* 1w1r_A* 1w1s_A* 3dq0_A* 2qkn_A* 3c0p_A* 3bw7_A* 2qpm_A* Length = 534 Back     alignment and structure
>2exr_A Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structural genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A* Length = 524 Back     alignment and structure
>2vfr_A Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, flavin, flavoprotein, oxidoreductase; HET: FAD; 1.1A {Streptomyces coelicolor} PDB: 2vfs_A* 2vft_A* 2vfu_A* 2vfv_A* Length = 422 Back     alignment and structure
>2bvf_A 6-hydroxy-D-nicotine oxidase; autoflavinylation, enantiomeric substrates, flavoenzymes, nicotine degradation; HET: FAD; 1.92A {Arthrobacter nicotinovorans} PDB: 2bvg_A* 2bvh_A* Length = 459 Back     alignment and structure
>2ipi_A Aclacinomycin oxidoreductase (aknox); anthracycline, flavoenzyme, twinning, MAD; HET: AKY FAD; 1.65A {Streptomyces galilaeus} Length = 521 Back     alignment and structure
>2wdx_A Putative hexose oxidase; oxidoreductase-antibiotic complex; HET: FAD GHP 3MY 3FG OMY D3P BMA NAG BDP T55; 2.30A {Nonomuraea SP} PDB: 2wdw_A* Length = 523 Back     alignment and structure
>3js8_A Cholesterol oxidase; cholsterol, organic solvent stability, oxygen channel, FAD, flavoprotein, oxidoreductase; HET: FAD SUC; 1.54A {Chromobacterium SP} Length = 540 Back     alignment and structure
>3fw9_A Reticuline oxidase; BI-covalent flavinylation, N-glycosylation, alakloid biosynthesis, oxidoreductase, alkaloid metabolism; HET: FAD SLX NAG MAN; 1.49A {Eschscholzia californica} PDB: 3d2h_A* 3d2d_A* 3d2j_A* 3gsy_A* 3fw8_A* 3fw7_A* 3fwa_A* Length = 495 Back     alignment and structure
>2i0k_A Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzyme; HET: FAD; 1.60A {Brevibacterium sterolicum} SCOP: d.58.32.3 d.145.1.1 PDB: 1i19_A* Length = 561 Back     alignment and structure
>1zr6_A Glucooligosaccharide oxidase; alpha + beta, flavoenzyme, oxidoreductase; HET: NAG FAD; 1.55A {Acremonium strictum} PDB: 2axr_A* 3e0t_A* 3hsu_A* Length = 503 Back     alignment and structure
>2yvs_A Glycolate oxidase subunit GLCE; oxidoreductase; 2.00A {Thermus thermophilus HB8} Length = 219 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target473 probable FAD-dependent oxidoreductase protein [Candidat
2uuu_A584 Alkyldihydroxyacetonephosphate synthase; rhizomelic cho 100.0
1f0x_A571 DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD 100.0
1wvf_A520 4-cresol dehydrogenase [hydroxylating] flavoprotein sub 100.0
1e8g_A560 Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, 100.0
2exr_A524 Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxida 100.0
1w1o_A534 Cytokinin dehydrogenase 1; flavin, oxidoreductase, flav 100.0
2ipi_A521 Aclacinomycin oxidoreductase (aknox); anthracycline, fl 100.0
3fw9_A495 Reticuline oxidase; BI-covalent flavinylation, N-glycos 100.0
2wdx_A523 Putative hexose oxidase; oxidoreductase-antibiotic comp 100.0
2i0k_A561 Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzy 100.0
2vfr_A422 Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, f 100.0
1zr6_A503 Glucooligosaccharide oxidase; alpha + beta, flavoenzyme 100.0
3js8_A540 Cholesterol oxidase; cholsterol, organic solvent stabil 100.0
1uxy_A340 MURB, uridine diphospho-N-acetylenolpyruvylglucosamine 99.55
3i99_A357 UDP-N-acetylenolpyruvoylglucosamine reductase; oxidored 99.5
2gqt_A268 UDP-N-acetylenolpyruvylglucosamine reductase; peptidogl 99.05
3hrd_C296 Nicotinate dehydrogenase FAD-subunit; selenium ligand, 97.93
1ffv_C287 CUTM, flavoprotein of carbon monoxide dehydrogenase; hy 97.92
2bvf_A459 6-hydroxy-D-nicotine oxidase; autoflavinylation, enanti 100.0
2yvs_A219 Glycolate oxidase subunit GLCE; oxidoreductase; 2.00A { 99.98
1hsk_A326 UDP-N-acetylenolpyruvoylglucosamine reductase; peptidog 99.68
3nrz_B305 Xanthine dehydrogenase/oxidase; xanthine oxidase, hypox 97.79
1rm6_B324 4-hydroxybenzoyl-COA reductase beta subunit; xanthine o 97.74
1t3q_C288 Quinoline 2-oxidoreductase medium subunit; QOR, molybde 97.63
1n62_C288 Carbon monoxide dehydrogenase medium chain; CODH, coppe 97.61
2w3s_A462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, ir 97.59
1v97_A 1332 XD, xanthine dehydrogenase; molybdopterin, FYX-051, rea 96.81
>2uuu_A Alkyldihydroxyacetonephosphate synthase; rhizomelic chondrodysplasia punctata, biosynthesis of phospholipids, flavoprotein; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=705.98  Aligned_cols=463  Identities=19%  Similarity=0.287  Sum_probs=364.6

Q ss_pred             CCCCHHHHHHHHHHCCCCCEECCHHHHHHHHCCCC---------CCCCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             67898999999973384418669899877313401---------367668758995499899999999998729829997
Q gi|254780761|r    2 NQLSLDLIQRFISIVGSEGILDDQKLISPYLTEER---------KIYHGTSPLVLLPSCTHEVSQILKLATETNTSITPQ   72 (473)
Q Consensus         2 ~~~~~~~~~~l~~i~g~~~v~~d~~~~~~~~~d~~---------~~~~~~p~~Vv~P~~~~ev~~iv~~a~~~~i~v~pr   72 (473)
                      ++++++++++|++++|+++|.+|+.+|..|++|.+         ..++..|++||+|+|+|||++||++|+++++||+||
T Consensus        88 ~~~~~~~~~~L~~~~~~~~v~~d~~~r~~~~~~~s~~d~~~~~~g~~~~~PdaVv~P~s~eeV~~iv~~A~~~~vpv~pr  167 (584)
T 2uuu_A           88 PKQYPEFVRELKAFFLPDQLKDDKLARITHTFGKSLRDLIRVRIGQVKNAPDLIVLPHSHEEVERLVQLAHKYNVVIIPM  167 (584)
T ss_dssp             CCCCHHHHHHHHTTSCGGGEECSHHHHHHTTCCSSHHHHHHHHTTCCCCCCSEEECCCSHHHHHHHHHHHHHHTCEEEEE
T ss_pred             CCCCHHHHHHHHHHCCCCCEECCHHHHHHHCCCCCHHHHHHHHCCCCCCCCCEEEECCCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             86799999999874685627558899987508998899999756877899857996399999999999999879829998


Q ss_pred             CCCCCCCCCCEECCC-CCEEEEECCCCCCCCCCCCCCCEEEECCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             588777654010488-8669997630027742112373455114420022221001232223443343211131122212
Q gi|254780761|r   73 GGNTGLVGGQIPRKN-RKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLAT  151 (473)
Q Consensus        73 Gggt~~~G~~~p~~~-~~~vvld~~~mn~il~id~~~~~v~veaGv~~~~l~~~l~~~g~~~p~~p~s~~~aTvGG~ia~  151 (473)
                      |||||++||++|..+ ..+|+|||++||+|++||+++++|+||||++|.+|+++|+++|++||++|+|...|||||||||
T Consensus       168 GgGTs~~G~~~p~~~~~~~v~ldl~rMn~Il~iD~~~~~a~VeaGv~~~~L~~~L~~~Gl~~~~~p~S~~~sTiGG~iat  247 (584)
T 2uuu_A          168 GGGSNIVGAIEPVSNERFTVSIDMRRMNKVLWVDRREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEFSTLGGWLAT  247 (584)
T ss_dssp             SSCCCSSCTTSCCCCSSCEEEEECTTCCCEEEEETTTTEEEEETTCBHHHHHHHHHHTTEECCCCCTTGGGCBHHHHHHH
T ss_pred             CCCCCCCCCCEECCCCCEEEEEEHHHCCCCEEECCCCCEEEECCCCHHHHHHHHHHHCCCEECCCCCCCCCCEEEEECCC
T ss_conf             89938567813258995489998332798478848899899907844999999999809950689843455778874025


Q ss_pred             CCCCCHHHHCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCC
Q ss_conf             35640001125733344433234666530211220133223222333223465454310127994046754432100001
Q gi|254780761|r  152 NAGGTAVLSYGNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRTGKQVAFIAV  231 (473)
Q Consensus       152 ~~~G~~s~~yG~~~d~v~~~~vv~~~G~i~~~~~~~~~~~~G~dl~~l~~GseGtlGiITevtlrl~p~p~~~~~~~~~f  231 (473)
                      |++|++|.+||.++|+|+++|||||+|++.++  ..+++++||||.++|+||||||||||++||||+|+|+.+.+.++.|
T Consensus       248 ~a~G~~s~~YG~~~d~V~~l~vVl~~G~i~~~--~~~~~~~G~DL~~l~~GSeGtLGIITe~tlrl~p~P~~~~~~~~~f  325 (584)
T 2uuu_A          248 CSSGHQSDKYGDIEDMAVSFRTVTPTGTLELR--NGARSGAGINYKHIILGSEGTLGIITEAVMKVHAVPQAVEYYGFLF  325 (584)
T ss_dssp             TCCCTTHHHHCCHHHHEEEEEEEETTEEECCC---------CCCTHHHHTTCTTSSCEEEEEEEECEECCSEEEEEEEEE
T ss_pred             CCCCCCEEEECCCCCCEEEEEEECCCCCEEEC--CCCCCCCCCCHHHHHCCCCCCEEEEEEEEEEECCCCCCCEEEEECC
T ss_conf             88887414556745511026899368876631--4655688989799865776535999988887236886441345314


Q ss_pred             CCHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCC-----------------CCCCCCCCCEECCCCCCCCH
Q ss_conf             3526899999751023322222222451799999986144434-----------------11575321100111354306
Q gi|254780761|r  232 NSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTF-----------------SPLSDTSPWYILLEISSTET  294 (473)
Q Consensus       232 ~~~~~a~~~~~~~~~~~~~~~~aiel~d~~~~~~~~~~~~~~~-----------------~~~~~~~~~~lli~~~g~~~  294 (473)
                      ++++++.++++.+.+ .+..|+++|++|...........+...                 ........+.+++++.+...
T Consensus       326 ~~~~~a~~a~~~i~~-~~~~p~~~el~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~  404 (584)
T 2uuu_A          326 PTFAHAVSALQQIRS-SEVIPTMIRVYDPEETQLSFAWKPSKGAVSEFTSAMVKKYLHYIRSFDFKNVCLSIIGFEGPKK  404 (584)
T ss_dssp             SSHHHHHHHHHHHHH-HTCCCSEEEEECHHHHHHHHHTCCSCCCTTCCHHHHHHHHHHHTTTSCTTTCEEEEEEEEECHH
T ss_pred             CHHHHHHHHHHHHHH-CCCCHHHHHHHCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCHH
T ss_conf             318888888889986-4882567755177877776530344221034566778987631156562123003565428488


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCC--HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999988886313456531001588--8896443310012211222356644442100131289999999999886
Q gi|254780761|r  295 LERAQNIANTILATGFNKKILTEWILPSL--DEEKNAIWCLRNNIPLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSS  372 (473)
Q Consensus       295 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~lw~~R~~~~~~~~~~g~~~~~Dvavp~~~l~~~~~~v~~~l~~  372 (473)
                      .....  ......................  ...+..+|..|+.   ..........+|+++||+++.++++++++.+.+
T Consensus       405 ~~~~~--~~~~~~~~~~~g~~~~~~~~~~~~~~~r~~~~~~~~~---~~~~~~~~~~~e~~vp~~~l~~~~~~v~~~~~~  479 (584)
T 2uuu_A          405 VVDFH--RTSVFDILSKNAAFGLGSAPGKTWAEKRYDLPYIRDF---LLDHNMWVDVAETTVSYANLQTLWKDAKQTFVK  479 (584)
T ss_dssp             HHHHH--HHHHHHHHHTTTCEEEEEESTTHHHHGGGGHHHHHHH---HHTTTEEEEEEEEEEEHHHHHHHHHHHHHHHHH
T ss_pred             HHHHH--HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH---HHHCCCCCCEEECCCHHHHHHHHHHHHHHHHHH
T ss_conf             89999--9999999986034102344445677777778898764---320356664121034277899999999999999


Q ss_pred             HC-----CCCEEEEEEEECCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHCC
Q ss_conf             34-----8722899998449869999842778880689999999999999999998189189973555656888887317
Q gi|254780761|r  373 IF-----PKTRIGLFGHIGDGNIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILE  447 (473)
Q Consensus       373 ~~-----~~~~~~~~gH~g~g~lh~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~gG~is~eHGiG~~k~~~~~~~~~  447 (473)
                      ..     +....++++|.+++++|+.+....+...++. ...+.++++.+.++++++|||||||||||+.|++|+.++++
T Consensus       480 ~~~~~g~~~~~~~h~~h~~~~~~~l~~~~~~~~~~~~~-~~~~~~~~~~~~~~v~~~GGsiS~eHGvG~~k~~~l~~~~g  558 (584)
T 2uuu_A          480 HFKDQGIPAWICAHISHTYTNGVCLYFIFASKQNENKD-MAQYIEAKKLMTDIIFKYGGSLSHHHGVGYEHVPWMTRYAT  558 (584)
T ss_dssp             HHHTTTCCEEEEEEEEEEETTEEEEEEEEEEECCTTCC-THHHHHHHHHHHHHHHHTTCCCC------------------
T ss_pred             HHHHCCCCEEEEEEEEECCCCCEEEEEEECCCCCCHHH-HHHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHCC
T ss_conf             87654985069999844377863888840788787899-99999999999999998698699826253767999998659


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             89999999998871537778887649
Q gi|254780761|r  448 PTEIKIMKKIKEIFDPAGIMNPGKFL  473 (473)
Q Consensus       448 ~~~~~~l~~iK~~~DP~gilNPGkli  473 (473)
                      +..+++|++||++|||+|||||||||
T Consensus       559 ~~~~~~~r~iK~~~DP~gIlNPGKli  584 (584)
T 2uuu_A          559 RGWINVYRSLKETIDPKDICNPRKLI  584 (584)
T ss_dssp             CTHHHHHHHHHHHHCTTCCBSCCCC-
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99999999999984976378988789



>1f0x_A DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: d.58.32.2 d.145.1.1 Back     alignment and structure
>1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit; electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} SCOP: d.58.32.1 d.145.1.1 PDB: 1wve_A* 1dii_A* 1diq_A* Back     alignment and structure
>1e8g_A Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} SCOP: d.58.32.1 d.145.1.1 PDB: 1e8f_A* 1e8h_A* 1qlt_A* 1qlu_A* 1vao_A* 1ahv_A* 1ahz_A* 1ahu_A* 2vao_A* 1w1j_A* 1dzn_A* 1w1l_A* 1e0y_A* 1w1k_A* 1w1m_A* Back     alignment and structure
>2exr_A Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structural genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A* Back     alignment and structure
>1w1o_A Cytokinin dehydrogenase 1; flavin, oxidoreductase, flavoprotein, FAD; HET: NAG FAD; 1.7A {Zea mays} SCOP: d.58.32.4 d.145.1.1 PDB: 1w1q_A* 1w1r_A* 1w1s_A* 3dq0_A* 2qkn_A* 3c0p_A* 3bw7_A* 2qpm_A* 3kjm_A* Back     alignment and structure
>2ipi_A Aclacinomycin oxidoreductase (aknox); anthracycline, flavoenzyme, twinning, MAD; HET: AKY FAD; 1.65A {Streptomyces galilaeus} Back     alignment and structure
>3fw9_A Reticuline oxidase; BI-covalent flavinylation, N-glycosylation, alakloid biosynthesis, oxidoreductase, alkaloid metabolism; HET: FAD SLX NAG MAN; 1.49A {Eschscholzia californica} PDB: 3d2h_A* 3d2d_A* 3d2j_A* 3gsy_A* 3fw8_A* 3fw7_A* 3fwa_A* Back     alignment and structure
>2wdx_A Putative hexose oxidase; oxidoreductase-antibiotic complex; HET: FAD GHP 3MY 3FG OMY D3P BMA NAG BDP T55; 2.30A {Nonomuraea SP} PDB: 2wdw_A* Back     alignment and structure
>2i0k_A Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzyme; HET: FAD; 1.60A {Brevibacterium sterolicum} SCOP: d.58.32.3 d.145.1.1 PDB: 1i19_A* Back     alignment and structure
>2vfr_A Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, flavin, flavoprotein, oxidoreductase; HET: FAD; 1.1A {Streptomyces coelicolor} PDB: 2vfs_A* 2vft_A* 2vfu_A* 2vfv_A* Back     alignment and structure
>1zr6_A Glucooligosaccharide oxidase; alpha + beta, flavoenzyme, oxidoreductase; HET: NAG FAD; 1.55A {Acremonium strictum} PDB: 2axr_A* 3e0t_A* 3hsu_A* Back     alignment and structure
>3js8_A Cholesterol oxidase; cholsterol, organic solvent stability, oxygen channel, FAD, flavoprotein, oxidoreductase; HET: FAD SUC; 1.54A {Chromobacterium SP} Back     alignment and structure
>1uxy_A MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli} SCOP: d.145.1.2 d.146.1.1 PDB: 1mbb_A* 1mbt_A* 2q85_A* 2mbr_A* Back     alignment and structure
>3i99_A UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae} Back     alignment and structure
>2gqt_A UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A* Back     alignment and structure
>3hrd_C Nicotinate dehydrogenase FAD-subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1ffv_C CUTM, flavoprotein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: d.87.2.1 d.145.1.3 PDB: 1ffu_C* Back     alignment and structure
>2bvf_A 6-hydroxy-D-nicotine oxidase; autoflavinylation, enantiomeric substrates, flavoenzymes, nicotine degradation; HET: FAD; 1.92A {Arthrobacter nicotinovorans} PDB: 2bvg_A* 2bvh_A* Back     alignment and structure
>2yvs_A Glycolate oxidase subunit GLCE; oxidoreductase; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
>1hsk_A UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus} SCOP: d.145.1.2 d.146.1.1 Back     alignment and structure
>3nrz_B Xanthine dehydrogenase/oxidase; xanthine oxidase, hypoxanthine, substrate orientation, hydro oxidoreductase; HET: FAD MTE HPA; 1.80A {Bos taurus} PDB: 3eub_B* 3etr_B* 3ns1_B* Back     alignment and structure
>1rm6_B 4-hydroxybenzoyl-COA reductase beta subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: d.87.2.1 d.145.1.3 PDB: 1sb3_B* Back     alignment and structure
>1t3q_C Quinoline 2-oxidoreductase medium subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: d.87.2.1 d.145.1.3 Back     alignment and structure
>1n62_C Carbon monoxide dehydrogenase medium chain; CODH, copper, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans OM5} SCOP: d.87.2.1 d.145.1.3 PDB: 1n5w_C* 1n61_C* 1n60_C* 1n63_C* 1zxi_C* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1v97_A XD, xanthine dehydrogenase; molybdopterin, FYX-051, reaction intermediate, oxidoreductase; HET: MTE FAD FYX; 1.94A {Bos taurus} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.87.2.1 d.133.1.1 d.145.1.3 PDB: 1fo4_A* 1vdv_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 2e3t_A* 1wyg_A* 3b9j_C* 1fiq_C* 3eub_C* 3etr_C* 1fiq_B* 3b9j_B* 3etr_B* 3eub_B* 3b9j_A* 1fiq_A* 3eub_A* 3etr_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 473 probable FAD-dependent oxidoreductase protein [Candidat
d1f0xa1294 d.58.32.2 (A:274-567) D-lactate dehydrogenase {Escheric 2e-35
d1e8ga1287 d.58.32.1 (A:274-560) Vanillyl-alcohol oxidase {Fungus 4e-35
d1w1oa2206 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize ( 2e-24
d2i0ka2216 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibacteriu 1e-22
d1e8ga2268 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (P 3e-21
d1wvfa2236 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol me 4e-19
d1hska1194 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyru 6e-07
d1f0xa2265 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Escherichi 1e-23
d1wvfa1279 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol 3e-23
>d1f0xa1 d.58.32.2 (A:274-567) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 294 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: FAD-linked oxidases, C-terminal domain
family: D-lactate dehydrogenase
domain: D-lactate dehydrogenase
species: Escherichia coli [TaxId: 562]
 Score =  144 bits (363), Expect = 2e-35
 Identities = 50/322 (15%), Positives = 96/322 (29%), Gaps = 65/322 (20%)

Query: 161 YGNIRHLCLGIEAVLPT-GDIWNGMHKL---IKDNSRYDIRDLLIGSEGTLGIITGAVLR 216
              IR   L     LP  G+    MH+    I +    D   L+I   GT  +     L+
Sbjct: 16  LTEIRRHILANFENLPVAGEY---MHRDIYDIAEKYGKDTF-LMIDKLGTDKMPFFFNLK 71

Query: 217 LLPYRTGKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSP 276
                  ++V F   +  ++A+Q                         L   H+P     
Sbjct: 72  GRTDAMLEKVKFFRPHFTDRAMQ---------------------KFGHLFPSHLPPRMKN 110

Query: 277 LSDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNN 336
             D    ++LL+++     E    + +      + K+   ++ + +  EE +  +  R  
Sbjct: 111 WRDKYEHHLLLKMAGDGVGEAKSWLVD------YFKQAEGDFFVCT-PEEGSKAFLHRFA 163

Query: 337 I--------PLAQKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDG 388
                     +        +  DI++       +     +  S          +GH    
Sbjct: 164 AAGAAIRYQAVHSDEVEDILALDIALRRNDTEWYEHLPPEIDS---QLVHKLYYGHFMCY 220

Query: 389 NIHFNVFPPTDENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEP 448
             H +       +           +   +  ++   G    AEH +G L+K         
Sbjct: 221 VFHQDYIVKKGVDVHA--------LKEQMLELLQQRGAQYPAEHNVGHLYKA-------- 264

Query: 449 TEIKIMKKIKEIFDPAGIMNPG 470
              + ++K     DP   MNPG
Sbjct: 265 --PETLQKFYRENDPTNSMNPG 284


>d1e8ga1 d.58.32.1 (A:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Length = 287 Back     information, alignment and structure
>d1w1oa2 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]} Length = 206 Back     information, alignment and structure
>d2i0ka2 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]} Length = 216 Back     information, alignment and structure
>d1e8ga2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Length = 268 Back     information, alignment and structure
>d1wvfa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Length = 236 Back     information, alignment and structure
>d1hska1 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} Length = 194 Back     information, alignment and structure
>d1f0xa2 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure
>d1wvfa1 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Length = 279 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target473 probable FAD-dependent oxidoreductase protein [Candidat
d1wvfa2236 Flavoprotein subunit of p-cresol methylhydroxylase {Pse 100.0
d1e8ga2268 Vanillyl-alcohol oxidase {Fungus (Penicillium simplicis 100.0
d1w1oa2206 Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 457 100.0
d1hska1194 Uridine diphospho-N-Acetylenolpyruvylglucosamine reduct 99.96
d1f0xa2265 D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} 100.0
d1f0xa1294 D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} 100.0
d1e8ga1287 Vanillyl-alcohol oxidase {Fungus (Penicillium simplicis 100.0
d2i0ka2216 Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 100.0
d1uxya1198 Uridine diphospho-N-Acetylenolpyruvylglucosamine reduct 99.86
d1ffvc2177 Carbon monoxide (CO) dehydrogenase flavoprotein, N-term 98.04
d1n62c2177 Carbon monoxide (CO) dehydrogenase flavoprotein, N-term 97.56
d1wvfa1279 Flavoprotein subunit of p-cresol methylhydroxylase {Pse 100.0
d1jroa4167 Xanthine dehydrogenase chain A, domain 3 {Rhodobacter c 98.12
d1rm6b2216 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-ter 98.04
d1v97a6223 Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId 97.87
d1t3qc2176 Quinoline 2-oxidoreductase medium subunit QorM {Pseudom 97.64
d1w1oa1289 Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 457 97.59
>d1wvfa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FAD-binding/transporter-associated domain-like
superfamily: FAD-binding/transporter-associated domain-like
family: FAD-linked oxidases, N-terminal domain
domain: Flavoprotein subunit of p-cresol methylhydroxylase
species: Pseudomonas putida [TaxId: 303]
Probab=100.00  E-value=0  Score=348.44  Aligned_cols=213  Identities=21%  Similarity=0.310  Sum_probs=184.7

Q ss_pred             HHHHHHHHHHCCCCCEECCHHHHHHHHCCCCCC--CCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC-
Q ss_conf             899999997338441866989987731340136--76687589954998999999999987298299975887776540-
Q gi|254780761|r    6 LDLIQRFISIVGSEGILDDQKLISPYLTEERKI--YHGTSPLVLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQ-   82 (473)
Q Consensus         6 ~~~~~~l~~i~g~~~v~~d~~~~~~~~~d~~~~--~~~~p~~Vv~P~~~~ev~~iv~~a~~~~i~v~prGggt~~~G~~-   82 (473)
                      ..++++|+++||+++|++|++++.+|++|+...  +...|.+||+|+|++||+++|++|+++++|++++|+|+|+.++. 
T Consensus        13 ~~~v~~l~~ivG~~~V~~~~~~~~~y~~d~~~~~~~~~~P~~Vv~P~s~eeV~~iv~~a~~~~~~i~~~g~G~s~~~g~~   92 (236)
T d1wvfa2          13 NKAVQKFRALLGDDNVLVESDQLVPYNKIMMPVENAAHAPSAAVTATTVEQVQGVVKICNEHKIPIWTISTGRNFGYGSA   92 (236)
T ss_dssp             HHHHHHHHHHHCGGGEECSHHHHHHHHCCCSSSCGGGGCCSEEEECCSHHHHHHHHHHHHHHTCCEEEESSCCCTTTTTT
T ss_pred             HHHHHHHHHHCCCCCEEECHHHHHHHHCCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHCCCCCEECCCCCCCCCCCCC
T ss_conf             99999999972976399889999777276320135676888899569999999999998717941100234444321112


Q ss_pred             EECCCCCEEEEECCCCCCCCCCCCCCCEEEECCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHH-HCCCCCCHHHHC
Q ss_conf             1048886699976300277421123734551144200222210012322234433432111311222-123564000112
Q gi|254780761|r   83 IPRKNRKDIILSIKRMNRIRDIDLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNL-ATNAGGTAVLSY  161 (473)
Q Consensus        83 ~p~~~~~~vvld~~~mn~il~id~~~~~v~veaGv~~~~l~~~l~~~g~~~p~~p~s~~~aTvGG~i-a~~~~G~~s~~y  161 (473)
                      .|. ..++|+|||++||+|+++|+++++|+||||++|.+|+++|+++|+.+|++|+.  .+|+||.+ +++++|+++.+|
T Consensus        93 ~~~-~~~~ividl~~mn~i~~id~~~~~v~v~aG~~~~~l~~~l~~~g~~~~~~~~~--~~~~gG~i~~~~~~G~~~~~y  169 (236)
T d1wvfa2          93 APV-QRGQVILDLKKMNKIIKIDPEMCYALVEPGVTFGQMYDYIQENNLPVMLSFSA--PSAIAGPVGNTMDRGVGYTPY  169 (236)
T ss_dssp             SCS-STTCEEEECTTCCCEEEEETTTTEEEECTTCCHHHHHHHHHHTTCSEECCCCS--SCTTCCHHHHHHTTCBCSSTT
T ss_pred             CCC-CCEEEEEECCCCCCHHHHCCCCCCEEHHHHHHHHHHHHHHHHHCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCC
T ss_conf             355-51489860110221012103331010113444332578876421242112222--232100110011122221223


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCC-------CCCCCCCCEEEEEEEECCCC
Q ss_conf             5733344433234666530211220133223222333223-------46545431012799404675
Q gi|254780761|r  162 GNIRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLI-------GSEGTLGIITGAVLRLLPYR  221 (473)
Q Consensus       162 G~~~d~v~~~~vv~~~G~i~~~~~~~~~~~~G~dl~~l~~-------GseGtlGiITevtlrl~p~p  221 (473)
                      |.+.|+|+++|+|+|||+|++++.+..++..++++.+...       ||||||||||++||||+|+|
T Consensus       170 G~~~d~v~~levVl~~G~iv~~~~~~~~~~~~~~~~~~~~G~~~~~l~SeGtlGIIt~~tlkl~P~P  236 (236)
T d1wvfa2         170 GEHFMMQCGMEVVLANGDVYRTGMGGVPGSNTWQIFKWGYGPTLDGMFTQANYGICTKMGFWLMPKP  236 (236)
T ss_dssp             CBGGGGEEEEEEECTTSCEEECGGGGSTTCSCTTTCSCCSSCCCHHHHTTSSSCEEEEEEEECEECC
T ss_pred             CCCCCCEEEEEEECCCCCEEEECCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEEEEEEEEEEEECCC
T ss_conf             3333211006999289819980896678866788974686865123656462487899999987289



>d1e8ga2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Back     information, alignment and structure
>d1w1oa2 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1hska1 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1f0xa2 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0xa1 d.58.32.2 (A:274-567) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e8ga1 d.58.32.1 (A:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Back     information, alignment and structure
>d2i0ka2 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1uxya1 d.145.1.2 (A:3-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ffvc2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1n62c2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure