254780763

254780763

hypothetical protein CLIBASIA_03260

GeneID in NCBI database:8209769Locus tag:CLIBASIA_03260
Protein GI in NCBI database:254780763Protein Accession:YP_003065176.1
Gene range:+(501182, 501505)Protein Length:107aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein; K09747 hypothetical protein
SEED prediction:FIG000557: hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF
ccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEccccEEEEEEEccccEEEEEEcHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
cccHHHHHHccccHHHHHHHHHHHHHHcEEEEEEccccEEEEEEccccEEEEEEcHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINgknmltgvkidrsllfedNVEILEDLIIAAHSDAHKKIEDLVATKTQeiteglpippglkfpf
MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTqeiteglpippglkfpf
MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF
***************************LEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDA********************IPPGLKFPF
MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF
*SNIMKMVGQ*K**QGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNIMKMVGQxxxxxxxxxxxxxxxxxxxxxGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF
MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF
MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target107 hypothetical protein CLIBASIA_03260 [Candidatus Liberib
315121978106 hypothetical protein CKC_01140 [Candidatus Liberibacter 1 5e-38
325291539107 hypothetical protein AGROH133_02945 [Agrobacterium sp. 1 8e-31
222147107107 hypothetical protein Avi_0111 [Agrobacterium vitis S4] 1 3e-29
163757648107 hypothetical protein HPDFL43_19597 [Hoeflea phototrophi 1 3e-29
222084335107 hypothetical protein Arad_0185 [Agrobacterium radiobact 1 6e-29
150398619107 hypothetical protein Smed_3433 [Sinorhizobium medicae W 1 1e-28
15963984107 hypothetical protein SMc02906 [Sinorhizobium meliloti 1 1 1e-28
227824062107 hypothetical protein NGR_c35590 [Sinorhizobium fredii N 1 2e-28
241207077107 hypothetical protein Rleg_4396 [Rhizobium leguminosarum 1 3e-28
86355785107 hypothetical protein RHE_CH00125 [Rhizobium etli CFN 42 1 3e-28
>gi|315121978|ref|YP_004062467.1| hypothetical protein CKC_01140 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 106 Back     alignment and organism information
 Score =  160 bits (405), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 89/105 (84%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NIMKM+GQFKEIQGKMEKMK SI +LE EGNAGGGMV VR+NGK+ML  VKI+ SLL ++
Sbjct: 2   NIMKMMGQFKEIQGKMEKMKSSIMALEVEGNAGGGMVRVRLNGKHMLLEVKIEDSLLCKE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           N EILEDLI+AAH+DAHKKIEDLVA KTQE T GL +PPGL  P 
Sbjct: 62  NSEILEDLIVAAHNDAHKKIEDLVAEKTQEATAGLSLPPGLNLPL 106


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325291539|ref|YP_004277403.1| hypothetical protein AGROH133_02945 [Agrobacterium sp. H13-3] Length = 107 Back     alignment and organism information
>gi|222147107|ref|YP_002548064.1| hypothetical protein Avi_0111 [Agrobacterium vitis S4] Length = 107 Back     alignment and organism information
>gi|163757648|ref|ZP_02164737.1| hypothetical protein HPDFL43_19597 [Hoeflea phototrophica DFL-43] Length = 107 Back     alignment and organism information
>gi|222084335|ref|YP_002542864.1| hypothetical protein Arad_0185 [Agrobacterium radiobacter K84] Length = 107 Back     alignment and organism information
>gi|150398619|ref|YP_001329086.1| hypothetical protein Smed_3433 [Sinorhizobium medicae WSM419] Length = 107 Back     alignment and organism information
>gi|15963984|ref|NP_384337.1| hypothetical protein SMc02906 [Sinorhizobium meliloti 1021] Length = 107 Back     alignment and organism information
>gi|227824062|ref|YP_002828035.1| hypothetical protein NGR_c35590 [Sinorhizobium fredii NGR234] Length = 107 Back     alignment and organism information
>gi|241207077|ref|YP_002978173.1| hypothetical protein Rleg_4396 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 107 Back     alignment and organism information
>gi|86355785|ref|YP_467677.1| hypothetical protein RHE_CH00125 [Rhizobium etli CFN 42] Length = 107 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target107 hypothetical protein CLIBASIA_03260 [Candidatus Liberib
PRK00153104 PRK00153, PRK00153, hypothetical protein; Validated 1e-24
COG0718105 COG0718, COG0718, Uncharacterized protein conserved in 2e-17
TIGR00103102 TIGR00103, DNA_YbaB_EbfC, DNA-binding protein, YbaB/Ebf 1e-12
PRK14625109 PRK14625, PRK14625, hypothetical protein; Provisional 4e-11
PRK14626110 PRK14626, PRK14626, hypothetical protein; Provisional 4e-11
PRK14624115 PRK14624, PRK14624, hypothetical protein; Provisional 2e-10
PRK14621111 PRK14621, PRK14621, hypothetical protein; Provisional 2e-09
PRK14627100 PRK14627, PRK14627, hypothetical protein; Provisional 5e-09
PRK03762103 PRK03762, PRK03762, hypothetical protein; Provisional 3e-08
PRK14622103 PRK14622, PRK14622, hypothetical protein; Provisional 1e-06
PRK14628118 PRK14628, PRK14628, hypothetical protein; Provisional 6e-06
PRK14623106 PRK14623, PRK14623, hypothetical protein; Provisional 3e-04
pfam0257592 pfam02575, DUF149, Uncharacterized BCR, YbaB family COG 1e-20
>gnl|CDD|178904 PRK00153, PRK00153, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|31062 COG0718, COG0718, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|161709 TIGR00103, DNA_YbaB_EbfC, DNA-binding protein, YbaB/EbfC family Back     alignment and domain information
>gnl|CDD|184772 PRK14625, PRK14625, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173089 PRK14626, PRK14626, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173087 PRK14624, PRK14624, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173084 PRK14621, PRK14621, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173090 PRK14627, PRK14627, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179646 PRK03762, PRK03762, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173085 PRK14622, PRK14622, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173091 PRK14628, PRK14628, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184771 PRK14623, PRK14623, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|145618 pfam02575, DUF149, Uncharacterized BCR, YbaB family COG0718 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 107 hypothetical protein CLIBASIA_03260 [Candidatus Liberib
PRK00153107 hypothetical protein; Validated 100.0
COG0718105 Uncharacterized protein conserved in bacteria [Function 99.97
PRK0376297 hypothetical protein; Provisional 99.96
PRK0058799 hypothetical protein; Provisional 99.94
TIGR00103112 TIGR00103 conserved hypothetical protein TIGR00103; Int 99.94
pfam0257592 DUF149 Uncharacterized BCR, YbaB family COG0718. 99.92
PRK0058799 hypothetical protein; Provisional 94.92
PRK00153107 hypothetical protein; Validated 90.95
>PRK00153 hypothetical protein; Validated Back     alignment and domain information
>COG0718 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK03762 hypothetical protein; Provisional Back     alignment and domain information
>PRK00587 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00103 TIGR00103 conserved hypothetical protein TIGR00103; InterPro: IPR004401 The function of this protein is unknown Back     alignment and domain information
>pfam02575 DUF149 Uncharacterized BCR, YbaB family COG0718 Back     alignment and domain information
>PRK00587 hypothetical protein; Provisional Back     alignment and domain information
>PRK00153 hypothetical protein; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target107 hypothetical protein CLIBASIA_03260 [Candidatus Liberib
1pug_A109 Structure Of E. Coli Ybab Length = 109 5e-27
1ybx_A143 Conserved Hypothetical Protein Cth-383 From Clostri 1e-26
1j8b_A112 Structure Of Ybab From Haemophilus Influenzae (Hi04 2e-22
3f42_A99 Crystal Structure Of Uncharacterized Protein Hp0035 5e-04
gi|33358150|pdb|1PUG|A Chain A, Structure Of E. Coli Ybab Length = 109 Back     alignment and structure
 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (0%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
             +  ++ Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL E
Sbjct: 5   GGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL-E 63

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           D+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 64  DDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|60594224|pdb|1YBX|A Chain A, Conserved Hypothetical Protein Cth-383 From Clostridium Thermocellum Length = 143 Back     alignment and structure
>gi|28373436|pdb|1J8B|A Chain A, Structure Of Ybab From Haemophilus Influenzae (Hi0442), A Protein Of Unknown Function Length = 112 Back     alignment and structure
>gi|213424688|pdb|3F42|A Chain A, Crystal Structure Of Uncharacterized Protein Hp0035 From Helicobacter Pylori Length = 99 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target107 hypothetical protein CLIBASIA_03260 [Candidatus Liberib
1j8b_A112 YBAB; hypothetical protein, structural genomics, struct 6e-25
1ybx_A143 Conserved hypothetical protein; structural genomics, PS 1e-23
3f42_A99 Protein HP0035; helicobacter pylori unknown-function, s 1e-17
>1j8b_A YBAB; hypothetical protein, structural genomics, structure 2 function project, S2F, unknown function; HET: MSE; 1.75A {Haemophilus influenzae rd KW20} SCOP: d.222.1.1 PDB: 1pug_A Length = 112 Back     alignment and structure
 Score =  107 bits (269), Expect = 6e-25
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
              +  ++ Q +++Q KM+KM+E I  LE  G +G G+V + ING +    + ID SL+ 
Sbjct: 7   KGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLME 66

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  E+LEDLI AA +DA ++ E+L   K   +T G+P+PPG+KFPF
Sbjct: 67  DD-KEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF 112


>1ybx_A Conserved hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MSE; 1.80A {Clostridium thermocellum} Length = 143 Back     alignment and structure
>3f42_A Protein HP0035; helicobacter pylori unknown-function, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.78A {Helicobacter pylori} Length = 99 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target107 hypothetical protein CLIBASIA_03260 [Candidatus Liberib
1j8b_A112 YBAB; hypothetical protein, structural genomics, struct 100.0
1ybx_A143 Conserved hypothetical protein; structural genomics, PS 99.97
3f42_A99 Protein HP0035; helicobacter pylori unknown-function, s 99.93
>1j8b_A YBAB; hypothetical protein, structural genomics, structure 2 function project, S2F, unknown function; HET: MSE; 1.75A {Haemophilus influenzae rd KW20} SCOP: d.222.1.1 PDB: 1pug_A Back     alignment and structure
Probab=100.00  E-value=7.3e-33  Score=229.13  Aligned_cols=106  Identities=42%  Similarity=0.734  Sum_probs=103.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEECCCEEEEEEECCCCEEEEEECHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             92179999999999999999999985308999976984999996483074688647882910068999999999999999
Q gi|254780763|r    1 MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHK   80 (107)
Q Consensus         1 M~nm~~llkqaq~mq~~m~~~q~eL~~~~v~g~sg~g~V~V~~~G~~~i~~i~Id~~~l~~~d~e~Ledli~~A~N~A~~   80 (107)
                      |+||++||+|||+||++++++|++|++++|+|+|++|+|+||+||+++|++|+|||++++ +|+++|+|+|++|||+|++
T Consensus         7 ~~nm~~mlkqaq~mq~~~~~~q~eL~~~~v~~~s~~g~V~V~~~G~~~v~~i~Id~~~l~-~d~e~LedlI~~A~N~A~~   85 (112)
T 1j8b_A            7 KGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLME-DDKEMLEDLIAAAFNDAVR   85 (112)
T ss_dssp             ---CCCHHHHHHHHHHHHHHHHHHHTTSEEEEEEGGGTEEEEEETTCCEEEEEECGGGGG-SCHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCEEEEEEECCCEEEEEEECHHHHC-CCHHHHHHHHHHHHHHHHH
T ss_conf             778999999999999999999999856299999879769999976947999998888841-7899999999999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             999999999999744899899999998
Q gi|254780763|r   81 KIEDLVATKTQEITEGLPIPPGLKFPF  107 (107)
Q Consensus        81 k~~~~~~~~m~~~tggl~lp~g~~lPf  107 (107)
                      ++++.++++|+++|||+++||||+|||
T Consensus        86 ka~~~~~~~m~~ltggl~lppg~~~p~  112 (112)
T 1j8b_A           86 RAEELQKEKMASVTAGMPLPPGMKFPF  112 (112)
T ss_dssp             HHHHHHHHHHHHHTCC-----------
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             999999999999857999998999997



>1ybx_A Conserved hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MSE; 1.80A {Clostridium thermocellum} Back     alignment and structure
>3f42_A Protein HP0035; helicobacter pylori unknown-function, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.78A {Helicobacter pylori} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 107 hypothetical protein CLIBASIA_03260 [Candidatus Liberib
d1j8ba_92 d.222.1.1 (A:) Hypothetical protein HI0442 {Haemophilus 1e-18
>d1j8ba_ d.222.1.1 (A:) Hypothetical protein HI0442 {Haemophilus influenzae [TaxId: 727]} Length = 92 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: YbaB-like
superfamily: YbaB-like
family: YbaB-like
domain: Hypothetical protein HI0442
species: Haemophilus influenzae [TaxId: 727]
 Score = 85.5 bits (212), Expect = 1e-18
 Identities = 39/96 (40%), Positives = 59/96 (61%), Gaps = 4/96 (4%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          +  +MK   Q +++Q KM+KM+E I  LE  G +G G+V + ING +    + ID SL+ 
Sbjct: 1  LGGLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLME 57

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEG 96
          +D  E+LEDLI AA +DA ++ E+L   K   +T G
Sbjct: 58 DD-KEMLEDLIAAAFNDAVRRAEELQKEKMASVTAG 92


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target107 hypothetical protein CLIBASIA_03260 [Candidatus Liberib
d1j8ba_92 Hypothetical protein HI0442 {Haemophilus influenzae [Ta 99.93
>d1j8ba_ d.222.1.1 (A:) Hypothetical protein HI0442 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: YbaB-like
superfamily: YbaB-like
family: YbaB-like
domain: Hypothetical protein HI0442
species: Haemophilus influenzae [TaxId: 727]
Probab=99.93  E-value=9e-26  Score=182.63  Aligned_cols=92  Identities=40%  Similarity=0.621  Sum_probs=89.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHEEEEEEECCCEEEEEEECCCCEEEEEECHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79999999999999999999985308999976984999996483074688647882910068999999999999999999
Q gi|254780763|r    4 IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIE   83 (107)
Q Consensus         4 m~~llkqaq~mq~~m~~~q~eL~~~~v~g~sg~g~V~V~~~G~~~i~~i~Id~~~l~~~d~e~Ledli~~A~N~A~~k~~   83 (107)
                      |++||+|||+||++|+++|++|++.+|+|+||+|+|+|++||+++|++|+|||++++ +|+++|||||++|||+|+++++
T Consensus         1 m~~mmkqaq~mq~~m~~~q~eL~~~~v~~~sg~g~V~V~~~G~~~v~~i~Id~~~l~-~d~e~LedlI~~A~N~A~~k~~   79 (92)
T d1j8ba_           1 LGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLME-DDKEMLEDLIAAAFNDAVRRAE   79 (92)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHTTSEEEEEEGGGTEEEEEETTCCEEEEEECGGGGG-SCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCEEEEEEECCEEEEEEEECHHHHC-CCHHHHHHHHHHHHHHHHHHHH
T ss_conf             968999999999999999999747299999879879999988867999998878702-7599999999999999999999


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             9999999997448
Q gi|254780763|r   84 DLVATKTQEITEG   96 (107)
Q Consensus        84 ~~~~~~m~~~tgg   96 (107)
                      +.++++|+++|||
T Consensus        80 ~~~~~~m~~~tGG   92 (92)
T d1j8ba_          80 ELQKEKMASVTAG   92 (92)
T ss_dssp             HHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHCCC
T ss_conf             9999998755399



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 107 hypothetical protein CLIBASIA_03260 [Candidatus Li
1ybx_A_143 (A:) Conserved hypothetical protein; structural ge 7e-23
1j8b_A_112 (A:) YBAB; hypothetical protein, structural genomi 3e-21
3f42_A_99 (A:) Protein HP0035; helicobacter pylori unknown-f 4e-20
>1ybx_A (A:) Conserved hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MSE; 1.80A {Clostridium thermocellum}Length = 143 Back     alignment and structure
 Score =  100 bits (251), Expect = 7e-23
 Identities = 35/103 (33%), Positives = 59/103 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
             NI  +V Q ++ Q   E+++E +     E +AGGG V+V   G+  +  + I   ++ 
Sbjct: 40  GGNINNLVKQAQKXQRDXERVQEELKEKTVEASAGGGAVTVVATGRKDIKEITIKPEVVD 99

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            D+VE L+DLI+AA ++A +K ++ V  +  +IT GL   PGL
Sbjct: 100 PDDVEXLQDLILAAVNEALRKADEXVTAEISKITGGLGGIPGL 142


>1j8b_A (A:) YBAB; hypothetical protein, structural genomics, structure 2 function project, S2F, unknown function; HET: MSE; 1.75A {Haemophilus influenzae rd KW20}Length = 112 Back     alignment and structure
>3f42_A (A:) Protein HP0035; helicobacter pylori unknown-function, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.78A {Helicobacter pylori}Length = 99 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target107 hypothetical protein CLIBASIA_03260 [Candidatus Liberib
1j8b_A_112 YBAB; hypothetical protein, structural genomics, s 99.95
3f42_A_99 Protein HP0035; helicobacter pylori unknown-functi 99.94
1ybx_A_143 Conserved hypothetical protein; structural genomic 99.94
1ybx_A_143 Conserved hypothetical protein; structural genomic 91.73
1j8b_A_112 YBAB; hypothetical protein, structural genomics, s 90.7
>1j8b_A (A:) YBAB; hypothetical protein, structural genomics, structure 2 function project, S2F, unknown function; HET: MSE; 1.75A {Haemophilus influenzae rd KW20} Back     alignment and structure
Probab=99.95  E-value=3.4e-27  Score=194.13  Aligned_cols=106  Identities=41%  Similarity=0.662  Sum_probs=103.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEECCCEEEEEEECCCCEEEEEECHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             92179999999999999999999985308999976984999996483074688647882910068999999999999999
Q gi|254780763|r    1 MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHK   80 (107)
Q Consensus         1 M~nm~~llkqaq~mq~~m~~~q~eL~~~~v~g~sg~g~V~V~~~G~~~i~~i~Id~~~l~~~d~e~Ledli~~A~N~A~~   80 (107)
                      |.|+++|+++||+||++++++|++|+..+|+++|++|+|+||+||+++|++|+|||+++. +|++.|+++|++|+|+|++
T Consensus         7 ~~n~~~m~~~aq~~q~~~~~~q~el~~~~~~~~s~dG~V~Vtv~g~g~v~~i~I~~~~~~-~d~e~L~~~i~~A~n~A~~   85 (112)
T 1j8b_A            7 KGGLGGLXKQAQQXQEKXQKXQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLXE-DDKEXLEDLIAAAFNDAVR   85 (112)
T ss_dssp             ---CCCHHHHHHHHHHHHHHHHHHHTTSEEEEEEGGGTEEEEEETTCCEEEEEECGGGGG-SCHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCEEEEEEECCCEEEEEEECHHHHC-CCHHHHHHHHHHHHHHHHH
T ss_conf             769999999999999999999999856099999779769999977827999998677714-7899999999999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             999999999999744899899999998
Q gi|254780763|r   81 KIEDLVATKTQEITEGLPIPPGLKFPF  107 (107)
Q Consensus        81 k~~~~~~~~m~~~tggl~lp~g~~lPf  107 (107)
                      ++++..+++|.++|||+++|++.+|||
T Consensus        86 ~a~~~~~~~~~~l~g~~~lPg~~~~~~  112 (112)
T 1j8b_A           86 RAEELQKEKXASVTAGXPLPPGXKFPF  112 (112)
T ss_dssp             HHHHHHHHHHHHHTCC-----------
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             999999999999857999998999997



>3f42_A (A:) Protein HP0035; helicobacter pylori unknown-function, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.78A {Helicobacter pylori} Back     alignment and structure
>1ybx_A (A:) Conserved hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MSE; 1.80A {Clostridium thermocellum} Back     alignment and structure
>1ybx_A (A:) Conserved hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MSE; 1.80A {Clostridium thermocellum} Back     alignment and structure
>1j8b_A (A:) YBAB; hypothetical protein, structural genomics, structure 2 function project, S2F, unknown function; HET: MSE; 1.75A {Haemophilus influenzae rd KW20} Back     alignment and structure