peg_473

peg_473

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(500637, 501134)Protein Length:165aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTPDNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL
cccccHHHHHHHHHcEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHcHHHHHHHHHccccEEEEEEEcccc
cccEcHHHHHHHHHHHHHHHHHHcccccccccccccccccHccccccccHHHHHHHcccccccHHHHHHHHHHccccEEEEEEHccEEEEEEcccEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHccHHHHHHHHHccccEEEEEEEcccc
LHAISWKKRKKKLDalnvssfaigenalprnissdecfplaeagiteKQDVLNrlsactpdnYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLknwtgedwEIRFSlgrcceyfeidsdiKAVRTIFPTAQVVCIRTIPNL
lhaiswkkrkkkldalnvssfaigenalprniSSDECFPLAEAGITEKQDVLNRLSACTPDNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATklknwtgedWEIRFSLGRCCEYFEIDSDIKAVRTIFPtaqvvcirtipnl
LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTPDNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL
****S****K***************************************************NYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFSLGR****FEIDSDIKAVRTIFPTAQVVCIRTIP**
LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTPDNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL
*HAISWKKRKKKLDALNVSSFAIGE********SDECFPLAEAG*TEKQDVLNRLSACTPDNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTPDNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL
LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTPDNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL
LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTPDNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target165
315121979151 DNA polymerase III subunits gamma and tau [Candidatus L 1 6e-32
15963983626 DNA polymerase III subunits gamma and tau [Sinorhizobiu 1 2e-08
307306395626 DNA polymerase III, subunits gamma and tau [Sinorhizobi 1 3e-08
307319282626 DNA polymerase III, subunits gamma and tau [Sinorhizobi 1 3e-08
227824061645 DNA polymerase III subunits gamma and tau [Sinorhizobiu 1 5e-08
150398618625 DNA polymerase III subunits gamma and tau [Sinorhizobiu 1 6e-08
90419786639 DNA polymerase III, subunits gamma/tau [Aurantimonas ma 1 2e-07
241207078625 DNA polymerase III subunits gamma/tau [Rhizobium legumi 1 3e-07
116249901625 DNA polymerase III subunits gamma and tau [Rhizobium le 1 4e-07
330813511531 DNA polymerase III subunits gamma and tau [Candidatus P 1 2e-06
>gi|315121979|ref|YP_004062468.1| DNA polymerase III subunits gamma and tau [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 151 Back     alignment and organism information
 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 95/135 (70%), Gaps = 1/135 (0%)

Query: 28  LPRNISSDECFPLAEAGITEKQDVLN-RLSACTPDNYTKQLIELCEKNHDYKMVEMLQRF 86
           + ++I S++ FP  +  + EK ++L+  LS+   D+Y ++L ELCE NHD  + EM Q+F
Sbjct: 13  IQKDIPSNKSFPSGDNEVVEKPNMLSVELSSRASDDYMERLTELCENNHDDNLKEMSQKF 72

Query: 87  LHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKA 146
           L V  FE+G LEV+  K+ PE F+ENL   LKNWTG++WEIRF+L +C + F I +DI+A
Sbjct: 73  LRVFYFEIGILEVACSKDAPEGFVENLVKNLKNWTGKNWEIRFALEQCYDNFRIGADIQA 132

Query: 147 VRTIFPTAQVVCIRT 161
           VR IFP AQVV IRT
Sbjct: 133 VRAIFPNAQVVSIRT 147


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15963983|ref|NP_384336.1| DNA polymerase III subunits gamma and tau [Sinorhizobium meliloti 1021] Length = 626 Back     alignment and organism information
>gi|307306395|ref|ZP_07586139.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium meliloti BL225C] Length = 626 Back     alignment and organism information
>gi|307319282|ref|ZP_07598711.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium meliloti AK83] Length = 626 Back     alignment and organism information
>gi|227824061|ref|YP_002828034.1| DNA polymerase III subunits gamma and tau [Sinorhizobium fredii NGR234] Length = 645 Back     alignment and organism information
>gi|150398618|ref|YP_001329085.1| DNA polymerase III subunits gamma and tau [Sinorhizobium medicae WSM419] Length = 625 Back     alignment and organism information
>gi|90419786|ref|ZP_01227695.1| DNA polymerase III, subunits gamma/tau [Aurantimonas manganoxydans SI85-9A1] Length = 639 Back     alignment and organism information
>gi|241207078|ref|YP_002978174.1| DNA polymerase III subunits gamma/tau [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 625 Back     alignment and organism information
>gi|116249901|ref|YP_765739.1| DNA polymerase III subunits gamma and tau [Rhizobium leguminosarum bv. viciae 3841] Length = 625 Back     alignment and organism information
>gi|330813511|ref|YP_004357750.1| DNA polymerase III subunits gamma and tau [Candidatus Pelagibacter sp. IMCC9063] Length = 531 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target165
pfam12362117 pfam12362, DUF3646, DNA polymerase III gamma and tau su 4e-13
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits gamma a 4e-13
>gnl|CDD|152797 pfam12362, DUF3646, DNA polymerase III gamma and tau subunits C terminal Back     alignment and domain information
>gnl|CDD|181656 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 165
PRK09111600 DNA polymerase III subunits gamma and tau; Validated 100.0
pfam12362117 DUF3646 DNA polymerase III gamma and tau subunits C ter 100.0
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 99.96
PRK06674563 DNA polymerase III subunits gamma and tau; Validated 98.41
PRK08770663 DNA polymerase III subunits gamma and tau; Validated 97.82
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 97.61
PRK05648705 DNA polymerase III subunits gamma and tau; Reviewed 97.26
PRK12323721 DNA polymerase III subunits gamma and tau; Provisional 96.18
PRK06872696 DNA polymerase III subunits gamma and tau; Provisional 96.09
PRK08691704 DNA polymerase III subunits gamma and tau; Validated 95.05
PRK07994643 DNA polymerase III subunits gamma and tau; Validated 93.66
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>pfam12362 DUF3646 DNA polymerase III gamma and tau subunits C terminal Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06674 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08770 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00