254780779

254780779

30S ribosomal protein S2

GeneID in NCBI database:8209785Locus tag:CLIBASIA_03350
Protein GI in NCBI database:254780779Protein Accession:YP_003065192.1
Gene range:+(483518, 484354)Protein Length:278aa
Gene description:30S ribosomal protein S2
COG prediction:[J] Ribosomal protein S2
KEGG prediction:rpsB; 30S ribosomal protein S2; K02967 small subunit ribosomal protein S2
SEED prediction:SSU ribosomal protein S2p (SAe)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSAGETVVHSKEGMQLEEDSQSSESSVLDGQEVAVVPELMS
cccccccHHHHHHccccccccccccccHHHHccccccccEEEEEHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHccccEEEEEccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccHHHcc
ccccHEcHHHHHHccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcccccEcccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHccccccEEEEEcccHHHHHHHHHHHccccEEEEEEcccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcHHHccccccccccccEEEEEcHHcc
MALPQFTIRQLLESGVqfghrnflwnpkmeryifcernnthiidlsqtVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKenqgftkkeRLNIERKRDKLKRALDGirdmgglpdlmfvVDTNREKLAIQEARRLRIPIVAvvdtnsnpdlvdyvipgnddssrSIALFCDLVASAAIDGIArqhsymgadtksagetvvhskegmqleedsqssessvldgqevavvpelms
MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELlnkenqgftkkerlnierkrdklkraldgirdmgglpdlmFVVDTNREKLAIqearrlripivavvdtnsnpdlVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSAGETVVHSKEGMQLeedsqssessvldgqevavvpelms
MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSAGETVVHSKEGMQLeedsqssessVLDGQEVAVVPELMS
**LPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELL****QGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAID******************************************************
MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSAGETVVHSKE******************QEVAVVPELMS
*ALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHS************************************QEVAVVP*L**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSAGETVVHSKEGMQLEEDSQSSESSVLDGQEVAVVPELMS
MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSAGETVVHSKEGMQLEEDSQSSESSVLDGQEVAVVPELMS
MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSAGETVVHSKEGMQLEEDSQSSESSVLDGQEVAVVPELMS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target278 30S ribosomal protein S2 [Candidatus Liberibacter asiat
315121996289 30S ribosomal protein S2 [Candidatus Liberibacter solan 1 1e-128
86357534255 30S ribosomal protein S2 [Rhizobium etli CFN 42] Length 1 1e-102
116251977255 30S ribosomal protein S2 [Rhizobium leguminosarum bv. v 1 1e-101
190891607255 30S ribosomal protein S2 [Rhizobium etli CIAT 652] Leng 1 1e-101
327189222255 30S ribosomal protein S2 [Rhizobium etli CNPAF512] Leng 1 1e-101
222085857256 ribosomal protein S2 [Agrobacterium radiobacter K84] Le 1 1e-101
15965248255 30S ribosomal protein S2 [Sinorhizobium meliloti 1021] 1 1e-100
227821897255 30S ribosomal protein S2 [Sinorhizobium fredii NGR234] 1 1e-100
150396350255 30S ribosomal protein S2 [Sinorhizobium medicae WSM419] 1 1e-100
110633734267 30S ribosomal protein S2 [Mesorhizobium sp. BNC1] Lengt 1 1e-100
>gi|315121996|ref|YP_004062485.1| 30S ribosomal protein S2 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 289 Back     alignment and organism information
 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/264 (83%), Positives = 239/264 (90%), Gaps = 6/264 (2%)

Query: 1   MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVIS 60
           MA+P FT++QLLESGVQFGHR FLWNPKM+ YIFCER+NTHIIDLSQTVPML KALQV+S
Sbjct: 1   MAIPNFTMQQLLESGVQFGHRKFLWNPKMKPYIFCERSNTHIIDLSQTVPMLHKALQVVS 60

Query: 61  DTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLE 120
           DTVARGGRILFVATK QAS+ VMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDL+
Sbjct: 61  DTVARGGRILFVATKPQASNVVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLD 120

Query: 121 ELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRL 180
           ELL+KENQ FTKKERLNIER+RDKLKRALDGIRDMGGLPDLMF++DTNREKLAI+EARRL
Sbjct: 121 ELLSKENQDFTKKERLNIERRRDKLKRALDGIRDMGGLPDLMFIIDTNREKLAIEEARRL 180

Query: 181 RIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSA 240
           RIPIVAVVD+N NPDL+DY+IPGNDDS+RSIALFCDLVASAAIDGIARQHSYMG DTK  
Sbjct: 181 RIPIVAVVDSNCNPDLIDYIIPGNDDSARSIALFCDLVASAAIDGIARQHSYMGGDTKPL 240

Query: 241 GETVVHSKEGMQLEEDSQSSESSV 264
              V        LEEDS++ E  V
Sbjct: 241 DNDV------KSLEEDSKNLEGEV 258


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357534|ref|YP_469426.1| 30S ribosomal protein S2 [Rhizobium etli CFN 42] Length = 255 Back     alignment and organism information
>gi|116251977|ref|YP_767815.1| 30S ribosomal protein S2 [Rhizobium leguminosarum bv. viciae 3841] Length = 255 Back     alignment and organism information
>gi|190891607|ref|YP_001978149.1| 30S ribosomal protein S2 [Rhizobium etli CIAT 652] Length = 255 Back     alignment and organism information
>gi|327189222|gb|EGE56401.1| 30S ribosomal protein S2 [Rhizobium etli CNPAF512] Length = 255 Back     alignment and organism information
>gi|222085857|ref|YP_002544388.1| ribosomal protein S2 [Agrobacterium radiobacter K84] Length = 256 Back     alignment and organism information
>gi|15965248|ref|NP_385601.1| 30S ribosomal protein S2 [Sinorhizobium meliloti 1021] Length = 255 Back     alignment and organism information
>gi|227821897|ref|YP_002825867.1| 30S ribosomal protein S2 [Sinorhizobium fredii NGR234] Length = 255 Back     alignment and organism information
>gi|150396350|ref|YP_001326817.1| 30S ribosomal protein S2 [Sinorhizobium medicae WSM419] Length = 255 Back     alignment and organism information
>gi|110633734|ref|YP_673942.1| 30S ribosomal protein S2 [Mesorhizobium sp. BNC1] Length = 267 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target278 30S ribosomal protein S2 [Candidatus Liberibacter asiat
PRK05299258 PRK05299, rpsB, 30S ribosomal protein S2; Provisional 1e-109
PRK12311326 PRK12311, rpsB, 30S ribosomal protein S2/unknown domain 1e-107
TIGR01011225 TIGR01011, rpsB_bact, ribosomal protein S2, bacterial t 8e-88
pfam00318205 pfam00318, Ribosomal_S2, Ribosomal protein S2 4e-87
KOG0832251 KOG0832, KOG0832, KOG0832, Mitochondrial/chloroplast ri 4e-43
COG0052252 COG0052, RpsB, Ribosomal protein S2 [Translation, ribos 1e-87
cd01425193 cd01425, RPS2, Ribosomal protein S2 (RPS2), involved in 9e-78
CHL00067230 CHL00067, rps2, ribosomal protein S2 1e-69
PTZ00254249 PTZ00254, PTZ00254, 40S ribosomal protein SA; Provision 9e-11
TIGR01012196 TIGR01012, Sa_S2_E_A, ribosomal protein Sa(cytosolic)/S 5e-09
PRK04020204 PRK04020, rps2P, 30S ribosomal protein S2; Provisional 2e-09
>gnl|CDD|180001 PRK05299, rpsB, 30S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|183428 PRK12311, rpsB, 30S ribosomal protein S2/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|130084 TIGR01011, rpsB_bact, ribosomal protein S2, bacterial type Back     alignment and domain information
>gnl|CDD|144054 pfam00318, Ribosomal_S2, Ribosomal protein S2 Back     alignment and domain information
>gnl|CDD|36050 KOG0832, KOG0832, KOG0832, Mitochondrial/chloroplast ribosomal protein S2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30401 COG0052, RpsB, Ribosomal protein S2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100106 cd01425, RPS2, Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome Back     alignment and domain information
>gnl|CDD|177007 CHL00067, rps2, ribosomal protein S2 Back     alignment and domain information
>gnl|CDD|185527 PTZ00254, PTZ00254, 40S ribosomal protein SA; Provisional Back     alignment and domain information
>gnl|CDD|130085 TIGR01012, Sa_S2_E_A, ribosomal protein Sa(cytosolic)/S2(archaeal) Back     alignment and domain information
>gnl|CDD|179713 PRK04020, rps2P, 30S ribosomal protein S2; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 278 30S ribosomal protein S2 [Candidatus Liberibacter asiat
TIGR01011227 rpsB_bact ribosomal protein S2; InterPro: IPR005706 Rib 100.0
PRK12311332 rpsB 30S ribosomal protein S2; Provisional 100.0
COG0052252 RpsB Ribosomal protein S2 [Translation, ribosomal struc 100.0
PRK05299255 rpsB 30S ribosomal protein S2; Provisional 100.0
CHL00067227 rps2 ribosomal protein S2 100.0
pfam00318205 Ribosomal_S2 Ribosomal protein S2. 100.0
cd01425193 RPS2 Ribosomal protein S2 (RPS2), involved in formation 100.0
PRK04020204 rps2P 30S ribosomal protein S2; Provisional 100.0
PTZ00254242 40S ribosomal protein SA; Provisional 100.0
KOG0832251 consensus 100.0
TIGR01012197 Sa_S2_E_A ribosomal protein S2; InterPro: IPR005707 Rib 100.0
KOG0830254 consensus 99.94
PRK00414192 gmhA phosphoheptose isomerase; Reviewed 97.32
PRK13938196 phosphoheptose isomerase; Provisional 96.99
PRK13936197 phosphoheptose isomerase; Provisional 96.83
PRK13937192 phosphoheptose isomerase; Provisional 96.69
cd05006177 SIS_GmhA Phosphoheptose isomerase is a member of the SI 95.95
PRK10886196 DnaA initiator-associating protein DiaA; Provisional 95.12
PRK13608 391 diacylglycerol glucosyltransferase; Provisional 93.84
cd05007257 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase. 92.01
cd05013139 SIS_RpiR RpiR-like protein. RpiR contains a SIS (Sugar 93.03
cd03805392 GT1_ALG2_like This family is most closely related to th 91.93
cd06305273 PBP1_methylthioribose_binding_like Methylthioribose-bin 90.98
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding 90.98
PRK00726359 murG N-acetylglucosaminyl transferase; Provisional 92.72
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferase, th 91.31
TIGR00113364 queA S-adenosylmethionine:tRNA ribosyltransferase-isome 92.09
pfam04007 335 DUF354 Protein of unknown function (DUF354). Members of 91.77
>TIGR01011 rpsB_bact ribosomal protein S2; InterPro: IPR005706 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK12311 rpsB 30S ribosomal protein S2; Provisional Back     alignment and domain information
>COG0052 RpsB Ribosomal protein S2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05299 rpsB 30S ribosomal protein S2; Provisional Back     alignment and domain information
>CHL00067 rps2 ribosomal protein S2 Back     alignment and domain information
>pfam00318 Ribosomal_S2 Ribosomal protein S2 Back     alignment and domain information
>cd01425 RPS2 Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome Back     alignment and domain information
>PRK04020 rps2P 30S ribosomal protein S2; Provisional Back     alignment and domain information
>PTZ00254 40S ribosomal protein SA; Provisional Back     alignment and domain information
>KOG0832 consensus Back     alignment and domain information
>TIGR01012 Sa_S2_E_A ribosomal protein S2; InterPro: IPR005707 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0830 consensus Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information
>PRK13938 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK13936 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK13937 phosphoheptose isomerase; Provisional Back     alignment and domain information
>cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd05007 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase Back     alignment and domain information
>cd05013 SIS_RpiR RpiR-like protein Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK00726 murG N-acetylglucosaminyl transferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>TIGR00113 queA S-adenosylmethionine:tRNA ribosyltransferase-isomerase; InterPro: IPR003699 Queuosine is a hypermodified nucleoside that usually occurs in the first position of the anticodon of tRNAs specifying the amino acids asparagine, aspartate, histidine, and tyrosine Back     alignment and domain information
>pfam04007 DUF354 Protein of unknown function (DUF354) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target278 30S ribosomal protein S2 [Candidatus Liberibacter asiat
1vs5_B241 Crystal Structure Of The Bacterial Ribosome From Es 2e-62
1p87_B240 Real Space Refined Coordinates Of The 30s Subunit F 1e-61
2gy9_B236 Structure Of The 30s Subunit Of A Pre-Translocation 2e-60
3fih_B218 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 4e-58
1i94_B255 Crystal Structures Of The Small Ribosomal Subunit W 2e-56
1fjg_B256 Structure Of The Thermus Thermophilus 30s Ribosomal 2e-56
2e5l_B227 A Snapshot Of The 30s Ribosomal Subunit Capturing M 4e-55
1pns_B234 Crystal Structure Of A Streptomycin Dependent Ribos 4e-54
3fic_B235 T. Thermophilus 70s Ribosome In Complex With Mrna, 5e-54
1x18_E231 Contact Sites Of Era Gtpase On The Thermus Thermoph 1e-52
3bbn_B231 Homology Model For The Spinach Chloroplast 30s Subu 2e-52
3iz6_A305 Localization Of The Small Subunit Ribosomal Protein 5e-27
3bch_A253 Crystal Structure Of The Human Laminin Receptor Pre 8e-27
1vi6_A208 Crystal Structure Of Ribosomal Protein S2p Length = 8e-20
3izb_A252 Localization Of The Small Subunit Ribosomal Protein 2e-19
2xzm_B241 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-19
3jyv_B193 Structure Of The 40s Rrna And Proteins And PE TRNA 4e-19
1s1h_B185 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 4e-19
1vi5_A208 Crystal Structure Of Ribosomal Protein S2p Length = 3e-18
2zkq_b295 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-28
gi|116666568|pdb|1VS5|B Chain B, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 241 Back     alignment and structure
 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 163/241 (67%), Gaps = 1/241 (0%)

Query: 3   LPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDT 62
           +   ++R +L++GV FGH+   WNPKM+ +IF  RN  HII+L +TVPM  +AL  ++  
Sbjct: 1   MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKI 60

Query: 63  VARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLE-E 121
            +R G+ILFV TK  AS+ V +AA    Q+ VN +WLGGM+TNWKTV QSI++L+DLE +
Sbjct: 61  ASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQ 120

Query: 122 LLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLR 181
             +      TKKE L   R+ +KL+ +L GI+DMGGLPD +FV+D + E +AI+EA  L 
Sbjct: 121 SQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLG 180

Query: 182 IPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSAG 241
           IP+ A+VDTNS+PD VD+VIPGNDD+ R++ L+   VA+   +G ++  +    ++    
Sbjct: 181 IPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEA 240

Query: 242 E 242
           E
Sbjct: 241 E 241


>gi|33357956|pdb|1P87|B Chain B, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome Length = 240 Back     alignment and structure
gi|116667411|pdb|2GY9|B Chain B, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 236 Back     alignment and structure
>gi|224510723|pdb|3FIH|B Chain B, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 218 Back     alignment and structure
>gi|14278531|pdb|1I94|B Chain B, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 255 Back     alignment and structure
gi|10835586|pdb|1FJG|B Chain B, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 256 Back     alignment and structure
>gi|149241276|pdb|2E5L|B Chain B, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via The Shine- Dalgarno Interaction Length = 227 Back     alignment and structure
>gi|34811530|pdb|1PNS|B Chain B, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 234 Back     alignment and structure
>gi|224510685|pdb|3FIC|B Chain B, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 235 Back     alignment and structure
>gi|73536330|pdb|1X18|E Chain E, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 231 Back     alignment and structure
>gi|188036203|pdb|3BBN|B Chain B, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 231 Back     alignment and structure
gi|313103629|pdb|3IZ6|A Chain A, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 305 Back     alignment and structure
>gi|161761214|pdb|3BCH|A Chain A, Crystal Structure Of The Human Laminin Receptor Precursor Length = 253 Back     alignment and structure
>gi|40889982|pdb|1VI6|A Chain A, Crystal Structure Of Ribosomal Protein S2p Length = 208 Back     alignment and structure
gi|313103664|pdb|3IZB|A Chain A, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 252 Back     alignment and structure
gi|319443357|pdb|2XZM|B Chain B, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 241 Back     alignment and structure
>gi|281500808|pdb|3JYV|B Chain B, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 193 Back     alignment and structure
>gi|49258822|pdb|1S1H|B Chain B, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 185 Back     alignment and structure
>gi|40889978|pdb|1VI5|A Chain A, Crystal Structure Of Ribosomal Protein S2p Length = 208 Back     alignment and structure
gi|187609256|pdb|2ZKQ|BB Chain b, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 295 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target278 30S ribosomal protein S2 [Candidatus Liberibacter asiat
3ofo_B218 30S ribosomal protein S2; protein biosynthesis, ribosom 5e-76
3bbn_B231 Ribosomal protein S2; small ribosomal subunit, spinach 4e-64
3i1m_B241 30S ribosomal protein S2; ribosome structure, protein-R 6e-63
2vqe_B256 30S ribosomal protein S2; tRNA-binding, rRNA-binding, m 9e-54
3bch_A253 40S ribosomal protein SA; laminin receptor, P40 ribosom 2e-46
3jyv_B193 40S ribosomal protein S0(A); eukaryotic ribosome, RACK1 1e-41
1vi6_A208 30S ribosomal protein S2P; structural genomics, ribosom 1e-38
2zkq_b295 40S ribosomal protein SA; protein-RNA complex, 40S ribo 8e-49
>3ofo_B 30S ribosomal protein S2; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_B* 2wwl_B 3ofp_B 3i1m_B 1vs7_B* 3e1a_B 3e1c_B 1vs5_B 3i1o_B 3i1q_B 3i1s_B 3i1z_B 3i21_B 3kc4_B 3or9_B 3ora_B 2qal_B* 1p87_B 2aw7_B 2avy_B ... Length = 218 Back     alignment and structure
 Score =  279 bits (715), Expect = 5e-76
 Identities = 110/218 (50%), Positives = 153/218 (70%), Gaps = 1/218 (0%)

Query: 11  LLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRIL 70
           +L++GV FGH+   WNPKM+ +IF  RN  HII+L +TVPM  +AL  ++   +R G+IL
Sbjct: 1   MLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKIL 60

Query: 71  FVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELL-NKENQG 129
           FV TK  AS+ V +AA    Q+ VN +WLGGM+TNWKTV QSI++L+DLE    +     
Sbjct: 61  FVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDK 120

Query: 130 FTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVD 189
            TKKE L   R+ +KL+ +L GI+DMGGLPD +FV+D + E +AI+EA  L IP+ A+VD
Sbjct: 121 LTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVD 180

Query: 190 TNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIA 227
           TNS+PD VD+VIPGNDD+ R++ L+   VA+   +G +
Sbjct: 181 TNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRS 218


>3bbn_B Ribosomal protein S2; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 231 Back     alignment and structure
>3i1m_B 30S ribosomal protein S2; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_B* 3e1a_B 3e1c_B 1vs5_B 3i1o_B 3i1q_B 3i1s_B 3i1z_B 3i21_B 2qal_B* 1p87_B 2aw7_B 2avy_B 2i2u_B 2i2p_B* 2qan_B* 2qb9_B* 2qbb_B* 2qbd_B 2qbf_B ... Length = 241 Back     alignment and structure
>2vqe_B 30S ribosomal protein S2; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.23.15.1 PDB: 1gix_E* 1hnw_B* 1hnx_B* 1hnz_B* 1hr0_B 1ibk_B* 1ibl_B* 1ibm_B 1j5e_B 1jgo_E* 1jgp_E* 1jgq_E* 1ml5_E* 1n32_B* 1n33_B* 1n34_B 1n36_B 1xmo_B* 1xmq_B* 1xnq_B* ... Length = 256 Back     alignment and structure
>3bch_A 40S ribosomal protein SA; laminin receptor, P40 ribosomal protein, acetylation, cytoplasm, phosphorylation, polymorphism; 2.15A {Homo sapiens} Length = 253 Back     alignment and structure
>3jyv_B 40S ribosomal protein S0(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_B Length = 193 Back     alignment and structure
>1vi6_A 30S ribosomal protein S2P; structural genomics, ribosome; 1.95A {Archaeoglobus fulgidus} SCOP: c.23.15.1 PDB: 1vi5_A Length = 208 Back     alignment and structure
>2zkq_b 40S ribosomal protein SA; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 295 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target278 30S ribosomal protein S2 [Candidatus Liberibacter asiat
2vqe_B256 30S ribosomal protein S2; tRNA-binding, rRNA-binding, m 100.0
3bbn_B231 Ribosomal protein S2; small ribosomal subunit, spinach 100.0
3ofo_B218 30S ribosomal protein S2; protein biosynthesis, ribosom 100.0
3bch_A253 40S ribosomal protein SA; laminin receptor, P40 ribosom 100.0
2zkq_b295 40S ribosomal protein SA; protein-RNA complex, 40S ribo 100.0
1vi6_A208 30S ribosomal protein S2P; structural genomics, ribosom 100.0
3jyv_B193 40S ribosomal protein S0(A); eukaryotic ribosome, RACK1 100.0
1tk9_A188 Phosphoheptose isomerase 1; lipopolysaccharide biosynth 97.65
2i2w_A212 Phosphoheptose isomerase; lipopolysaccharide biosynthes 97.43
2xbl_A198 Phosphoheptose isomerase; capsule; HET: M7P PGE PG4; 1. 96.71
2yva_A196 DNAA initiator-associating protein DIAA; intermolecular 96.33
1x92_A199 APC5045, phosphoheptose isomerase; midwest centre for s 95.9
1nri_A306 Hypothetical protein HI0754; structural genomics, PSI, 93.23
3dzc_A 396 UDP-N-acetylglucosamine 2-epimerase; structural genomic 91.74
3cs3_A277 Sugar-binding transcriptional regulator, LACI family; s 91.21
>2vqe_B 30S ribosomal protein S2; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.23.15.1 PDB: 1gix_E* 1hnw_B* 1hnx_B* 1hnz_B* 1hr0_B 1ibk_B* 1ibl_B* 1ibm_B 1j5e_B 1jgo_E* 1jgp_E* 1jgq_E* 1ml5_E* 1n32_B* 1n33_B* 1n34_B 1n36_B 1xmo_B* 1xmq_B* 1xnq_B* ... Back     alignment and structure
Probab=100.00  E-value=0  Score=599.81  Aligned_cols=228  Identities=46%  Similarity=0.800  Sum_probs=221.2

Q ss_pred             CC-CCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH
Q ss_conf             66-24589998608860754776578856210200188167538999999999999999861078816996078235799
Q gi|254780779|r    3 LP-QFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDC   81 (278)
Q Consensus         3 m~-~~t~~~Ll~ag~H~Gh~~~~wnPkM~~yI~g~rngihIIdL~kT~~~L~~A~~~i~~i~~~gg~ILFVgTk~~~~~~   81 (278)
                      || ++|+++||+|||||||++++|||+|+|||||.|||+|||||++|+.+|++|+.|++.++.+||+|||||||+|++.+
T Consensus         1 m~~~~ti~~ll~ag~H~Gh~~~~wnp~m~~yIyg~r~gi~IIdL~kT~~~L~~A~~~i~~i~~~~g~iLfVgTk~~~~~~   80 (256)
T 2vqe_B            1 MPVEITVKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDI   80 (256)
T ss_dssp             -----CCCSTTCSSTTCCCBSSSCCGGGSTTEEEEETTEEEECHHHHHHHHHHHHHHHHHHHTTTCCEEEECCSSSSTTT
T ss_pred             CCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCEECCCCCCEEECHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH
T ss_conf             99747799999719826667685798875612045088168869999999999999999885179869999575999999


Q ss_pred             HHHHHHHCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHH-HCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             999986339831423345873234266655567789988763-0121267746788766556777643443322113595
Q gi|254780779|r   82 VMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELL-NKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPD  160 (278)
Q Consensus        82 i~~~A~~~~~~yV~~RWlGG~LTN~~ti~~si~~l~~l~~~~-~~~~~~~tkKe~~~~~r~~~kl~k~lgGi~~m~~lP~  160 (278)
                      |+++|.+||+||||+||+|||||||+||++|+.+|++++... .+.++.|||||.+.+.|++.||+++||||++|.++||
T Consensus        81 v~~~A~~~~~~yvn~RWlgG~LTN~~~i~~~i~~l~~l~~~~~~~~~~~l~Kke~~~~~~~~~kl~~~~~Gi~~m~~~Pd  160 (256)
T 2vqe_B           81 VRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPD  160 (256)
T ss_dssp             TTTTTTSSSCCEECSCCCTTTTTTHHHHHHHHHHHHHHHHHTTSTTSSCSCHHHHTTHHHHHHHHHHHSTTGGGCSSCCS
T ss_pred             HHHHHHHHCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             99999995993362441287501746665676543577755124520125606888867899999986157522246897


Q ss_pred             EEEEECCCCCCHHHHHHHHCCCEEEEECCCCCCCHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7999438877123212343398145403677670011520321577268999999999999999999744
Q gi|254780779|r  161 LMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQH  230 (278)
Q Consensus       161 ~iiv~d~~~e~~Av~EA~kl~IPvIaivDTn~dp~~idypIP~NDds~~si~l~~~~i~~ai~~g~~~~~  230 (278)
                      +|||+||..|++||+||.+|||||||||||||||++|||||||||||++||+||++.+++||++|+..+.
T Consensus       161 ~v~v~d~~~~~~AI~EA~~l~IPvIaivDTn~~p~~IdypIP~NDds~~sI~li~~~l~~ai~~g~~~~~  230 (256)
T 2vqe_B          161 AIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGGVV  230 (256)
T ss_dssp             EEEESCTTTTHHHHHHHHHTTCCCEECCCTTSCGGGCSEECCSCSSCHHHHHHHHHHHHHHHHTTTSCCC
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             7996377500889999998589557761389880005446546886198999999999999999840112



>3bbn_B Ribosomal protein S2; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
>3ofo_B 30S ribosomal protein S2; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_B* 2wwl_B 3ofp_B 3i1m_B 1vs7_B* 3e1a_B 3e1c_B 1vs5_B 3i1o_B 3i1q_B 3i1s_B 3i1z_B 3i21_B 3kc4_B 3or9_B 3ora_B 2qal_B* 1p87_B 2aw7_B 2avy_B ... Back     alignment and structure
>3bch_A 40S ribosomal protein SA; laminin receptor, P40 ribosomal protein, acetylation, cytoplasm, phosphorylation, polymorphism; 2.15A {Homo sapiens} Back     alignment and structure
>2zkq_b 40S ribosomal protein SA; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1vi6_A 30S ribosomal protein S2P; structural genomics, ribosome; 1.95A {Archaeoglobus fulgidus} SCOP: c.23.15.1 PDB: 1vi5_A Back     alignment and structure
>3jyv_B 40S ribosomal protein S0(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_B Back     alignment and structure
>1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} SCOP: c.80.1.3 Back     alignment and structure
>2i2w_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A Back     alignment and structure
>2xbl_A Phosphoheptose isomerase; capsule; HET: M7P PGE PG4; 1.62A {Burkholderia pseudomallei} PDB: 2x3y_A Back     alignment and structure
>2yva_A DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar binding protein, DNAA binding protein; 1.85A {Escherichia coli} Back     alignment and structure
>1x92_A APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} SCOP: c.80.1.3 PDB: 3bjz_A Back     alignment and structure
>1nri_A Hypothetical protein HI0754; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Haemophilus influenzae} SCOP: c.80.1.3 Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, infectious diseases, isomerase, center for structural genomics of infectious diseases; 2.35A {Vibrio cholerae} Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI family; structural genomics, protein structure initiative, PSI-2; 2.40A {Enterococcus faecalis V583} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 278 30S ribosomal protein S2 [Candidatus Liberibacter asiat
d2gy9b1218 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia c 1e-65
d2uubb1234 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus therm 5e-63
d1vi6a_193 c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Archaeogl 8e-41
>d2gy9b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Ribosomal protein S2
family: Ribosomal protein S2
domain: Ribosomal protein S2
species: Escherichia coli [TaxId: 562]
 Score =  243 bits (621), Expect = 1e-65
 Identities = 110/218 (50%), Positives = 152/218 (69%), Gaps = 1/218 (0%)

Query: 11  LLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRIL 70
           +L++GV FGH+   WNPKM+ +IF  RN  HII+L +TVPM  +AL  ++   +R G+IL
Sbjct: 1   MLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKIL 60

Query: 71  FVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKEN-QG 129
           FV TK  AS+ V +AA    Q+ VN +WLGGM+TNWKTV QSI++L+DLE          
Sbjct: 61  FVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDK 120

Query: 130 FTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVAVVD 189
            TKKE L   R+ +KL+ +L GI+DMGGLPD +FV+D + E +AI+EA  L IP+ A+VD
Sbjct: 121 LTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVD 180

Query: 190 TNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIA 227
           TNS+PD VD+VIPGNDD+ R++ L+   VA+   +G +
Sbjct: 181 TNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRS 218


>d2uubb1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} Length = 234 Back     information, alignment and structure
>d1vi6a_ c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 193 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target278 30S ribosomal protein S2 [Candidatus Liberibacter asiat
d2uubb1234 Ribosomal protein S2 {Thermus thermophilus [TaxId: 274] 100.0
d2gy9b1218 Ribosomal protein S2 {Escherichia coli [TaxId: 562]} 100.0
d1vi6a_193 Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [ 100.0
d1x94a_191 Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 97.13
d1tk9a_188 Phosphoheptose isomerase GmhA1 {Campylobacter jejuni [T 96.7
d1x92a_194 Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa 96.68
d1nria_248 Hypothetical protein HI0754 {Haemophilus influenzae [Ta 94.04
d1m3sa_186 Hypothetical protein YckF {Bacillus subtilis [TaxId: 14 93.01
d1ir6a_ 385 Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} 92.15
>d2uubb1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Ribosomal protein S2
family: Ribosomal protein S2
domain: Ribosomal protein S2
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=0  Score=596.02  Aligned_cols=224  Identities=46%  Similarity=0.792  Sum_probs=217.0

Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             89998608860754776578856210200188167538999999999999999861078816996078235799999986
Q gi|254780779|r    8 IRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAK   87 (278)
Q Consensus         8 ~~~Ll~ag~H~Gh~~~~wnPkM~~yI~g~rngihIIdL~kT~~~L~~A~~~i~~i~~~gg~ILFVgTk~~~~~~i~~~A~   87 (278)
                      +++||+|||||||++++|||+|+|||||.|||+|||||++|+.+|++|++|++.++++||+|||||||++++++|+++|+
T Consensus         1 I~~ll~ag~H~Gh~~~~wnpkm~~yIyg~rngihIIdL~kT~~~L~~A~~~i~~~~~~~g~iLfVgTk~~~~~~i~~~A~   80 (234)
T d2uubb1           1 VKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAE   80 (234)
T ss_dssp             CCCSSCTTSTTBCCCSCCCGGGGGGEEEEETTEEEECHHHHHHHHHHHHHHHHHHHHTTCCEEEECCSSSSHHHHHHHHH
T ss_pred             CHHHHHCCCCCCCCCCCCCCCCCCCEECCCCCCEEECHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHH
T ss_conf             96688678866677674798874500156199389869999999999999999987237823677266877899999999


Q ss_pred             HCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHH-HCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             339831423345873234266655567789988763-0121267746788766556777643443322113595799943
Q gi|254780779|r   88 RSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELL-NKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVD  166 (278)
Q Consensus        88 ~~~~~yV~~RWlGG~LTN~~ti~~si~~l~~l~~~~-~~~~~~~tkKe~~~~~r~~~kl~k~lgGi~~m~~lP~~iiv~d  166 (278)
                      +||+||||+||+|||||||+||++|+++|++++.+. ++.++.+||||++.+.|++.||+++|||+++|+++||+|||+|
T Consensus        81 ~~~~~yv~~RWlgG~LTN~~ti~~~i~~l~~l~~~~~~~~~~~~tkke~~~~~~~~~kl~k~~~Gi~~m~~~Pd~viv~d  160 (234)
T d2uubb1          81 RAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVD  160 (234)
T ss_dssp             SSSCCEECSCCCTTTTTTHHHHHHHHHHHHHHHHHHSSTTGGGSCHHHHTHHHHHHHHHHHHSTTGGGCSSCCSEEEESC
T ss_pred             HHCCEEECCCEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHCCEEEEEEC
T ss_conf             94998744435077223440000233206999987604752236558899888999999986222000110331688705


Q ss_pred             CCCCCHHHHHHHHCCCEEEEECCCCCCCHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88771232123433981454036776700115203215772689999999999999999997443
Q gi|254780779|r  167 TNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHS  231 (278)
Q Consensus       167 ~~~e~~Av~EA~kl~IPvIaivDTn~dp~~idypIP~NDds~~si~l~~~~i~~ai~~g~~~~~~  231 (278)
                      |..|++||+||.+|||||||||||||||+.|||||||||||++||+||++.+++||++|++....
T Consensus       161 ~~~~~~Ai~Ea~~l~IPvIaivDTn~dp~~vdypIP~NDds~~sI~li~~~l~~ai~~gk~~~~~  225 (234)
T d2uubb1         161 PTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGGVVE  225 (234)
T ss_dssp             TTTTHHHHHHHHHHTCCEEEEECTTSCGGGCSEEEESCSSCHHHHHHHHHHHHHHHHTTSSCCCC
T ss_pred             CCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             77428899988860987789963378966786787788865999999999999999998336676



>d2gy9b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi6a_ c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tk9a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1x92a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nria_ c.80.1.3 (A:) Hypothetical protein HI0754 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 278 30S ribosomal protein S2 [Candidatus Liberibacter
3bbn_B_231 (B:) Ribosomal protein S2; small ribosomal subunit 2e-68
2vqe_B_256 (B:) 30S ribosomal protein S2; tRNA-binding, rRNA- 7e-63
3bch_A_253 (A:) 40S ribosomal protein SA; laminin receptor, P 4e-46
3jyv_B_193 (B:) 40S ribosomal protein S0(A); eukaryotic ribos 6e-45
1vi6_A_208 (A:) 30S ribosomal protein S2P; structural genomic 3e-43
3i1m_B_46-241196 (B:46-241) 30S ribosomal protein S2; ribosome stru 8e-52
2zkq_b_295 (b:) 40S ribosomal protein SA; protein-RNA complex 5e-48
>3bbn_B (B:) Ribosomal protein S2; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 231 Back     alignment and structure
 Score =  253 bits (647), Expect = 2e-68
 Identities = 85/226 (37%), Positives = 126/226 (55%), Gaps = 1/226 (0%)

Query: 5   QFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVA 64
              + +++E+GV FGH    WNP+M  YI  +    HII+L++T   L +A  ++ D  +
Sbjct: 3   NINLEEMMEAGVHFGHGTRKWNPRMSPYISAKCKGIHIINLTRTARFLSEACDLVFDASS 62

Query: 65  RGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLN 124
           RG + L V TK++A+D V  AA R+  + VN KWLGGM+TNW T    + K RDL     
Sbjct: 63  RGKQFLIVGTKNKAADSVARAAIRARCHYVNKKWLGGMLTNWSTTETRLHKFRDLRMEQT 122

Query: 125 KEN-QGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIP 183
                   K++   ++R+   L+  L GI+ M GLPD++ +VD   E  A++E   L IP
Sbjct: 123 AGRLARLPKRDAAVVKRQLSHLQTYLGGIKYMTGLPDIVIIVDQQEEYTALRECITLGIP 182

Query: 184 IVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQ 229
            + ++DTN NPDL D  IP NDD+  SI L    +  A  +G +  
Sbjct: 183 TICLIDTNCNPDLADISIPANDDAIASIRLILTKLVFAICEGRSSY 228


>2vqe_B (B:) 30S ribosomal protein S2; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 256 Back     alignment and structure
>3bch_A (A:) 40S ribosomal protein SA; laminin receptor, P40 ribosomal protein, acetylation, cytoplasm, phosphorylation, polymorphism; 2.15A {Homo sapiens}Length = 253 Back     alignment and structure
>3jyv_B (B:) 40S ribosomal protein S0(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_BLength = 193 Back     alignment and structure
>1vi6_A (A:) 30S ribosomal protein S2P; structural genomics, ribosome; 1.95A {Archaeoglobus fulgidus}Length = 208 Back     alignment and structure
>3i1m_B (B:46-241) 30S ribosomal protein S2; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_B* 3e1a_B 3e1c_B 1vs5_B 3i1o_B 3i1q_B 3i1s_B 3i1z_B 3i21_B 2qal_B* 1p87_B 2aw7_B 2avy_B 2i2u_B 2i2p_B* 2qan_B* 2qb9_B* 2qbb_B* 2qbd_B 2qbf_B ...Length = 196 Back     alignment and structure
>2zkq_b (b:) 40S ribosomal protein SA; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 295 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target278 30S ribosomal protein S2 [Candidatus Liberibacter asiat
3bbn_B_231 Ribosomal protein S2; small ribosomal subunit, spi 100.0
2vqe_B_256 30S ribosomal protein S2; tRNA-binding, rRNA-bindi 100.0
2zkq_b_295 40S ribosomal protein SA; protein-RNA complex, 40S 100.0
3bch_A_253 40S ribosomal protein SA; laminin receptor, P40 ri 100.0
1vi6_A_208 30S ribosomal protein S2P; structural genomics, ri 100.0
3jyv_B_193 40S ribosomal protein S0(A); eukaryotic ribosome, 100.0
3i1m_B_46-241196 30S ribosomal protein S2; ribosome structure, prot 100.0
2yva_A_196 DNAA initiator-associating protein DIAA; intermole 95.76
2i2w_A_212 Phosphoheptose isomerase; lipopolysaccharide biosy 95.74
2a3n_A_1-192192 Putative glucosamine-fructose-6-phosphate aminotra 91.7
1x92_A_199 APC5045, phosphoheptose isomerase; midwest centre 90.74
2uz1_A_182-367186 Benzaldehyde lyase; thiamine diphosphate, thiamine 90.53
1nri_A_1-233233 Hypothetical protein HI0754; structural genomics, 96.88
1tk9_A_188 Phosphoheptose isomerase 1; lipopolysaccharide bio 95.67
1vim_A_200 Hypothetical protein AF1796; structural genomics, 95.08
3beo_A_1-192_357-375211 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 94.59
1jeo_A_180 MJ1247, hypothetical protein MJ1247; RUMP pathway, 93.97
1m3s_A_186 Hypothetical protein YCKF; structural genomics, PS 92.76
3fkj_A_1-173173 Putative phosphosugar isomerases; NP_459564.1, str 92.39
3knz_A_34-182149 Putative sugar binding protein; structural genomic 93.66
3c3j_A_25-192168 Putative tagatose-6-phosphate ketose/aldose isomer 93.45
3cvj_A_243 Putative phosphoheptose isomerase; NP_244191.1, st 92.89
>3bbn_B (B:) Ribosomal protein S2; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
Probab=100.00  E-value=0  Score=560.51  Aligned_cols=226  Identities=38%  Similarity=0.634  Sum_probs=221.2

Q ss_pred             CCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             24589998608860754776578856210200188167538999999999999999861078816996078235799999
Q gi|254780779|r    5 QFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVME   84 (278)
Q Consensus         5 ~~t~~~Ll~ag~H~Gh~~~~wnPkM~~yI~g~rngihIIdL~kT~~~L~~A~~~i~~i~~~gg~ILFVgTk~~~~~~i~~   84 (278)
                      ++|+++||+||+||||++++|||+|+|||||.|||+|||||++|+.+|++|++|+++++++||+||||||+++++++|++
T Consensus         3 ~i~l~~ll~ag~HiGh~~~~wnp~m~~yI~g~rngi~IIdl~~T~~~L~~A~~~i~~i~~~~g~iLfV~t~~~~~~~i~~   82 (231)
T 3bbn_B            3 NINLEEMMEAGVHFGHGTRKWNPRMSPYISAKCKGIHIINLTRTARFLSEACDLVFDASSRGKQFLIVGTKNKAADSVAR   82 (231)
T ss_dssp             SCSSHHHHHTSSSSCCCSSCCCGGGGGGEEEEETTEEEECHHHHHHHTHHHHHHSHHHHTTTCCEEEECCCTTTHHHHHH
T ss_pred             CCCHHHHHHCCCCCCCCCCCCCCCCCCHHHCCCCCCEEECHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHH
T ss_conf             88899999728736766673798862500055199278859999999999999999997078833898636766689999


Q ss_pred             HHHHCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH-HHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             98633983142334587323426665556778998876-30121267746788766556777643443322113595799
Q gi|254780779|r   85 AAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEEL-LNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMF  163 (278)
Q Consensus        85 ~A~~~~~~yV~~RWlGG~LTN~~ti~~si~~l~~l~~~-~~~~~~~~tkKe~~~~~r~~~kl~k~lgGi~~m~~lP~~ii  163 (278)
                      +|++||+|||++||+|||||||.|+++++.+|++++.+ .++.++.++|||.+.+.|++.||+++|+||++|.++||+||
T Consensus        83 ~a~~~~~~~v~~rWigG~LTN~~~i~~~i~~l~~l~~~~~~~~~~~~~kke~~~~~k~~~kl~k~~~Gi~~m~~~P~~ii  162 (231)
T 3bbn_B           83 AAIRARCHYVNKKWLGGMLTNWSTTETRLHKFRDLRMEQTAGRLARLPKRDAAVVKRQLSHLQTYLGGIKYMTGLPDIVI  162 (231)
T ss_dssp             HHHHHTCEECCSSCCSCSSSCHHHHHHHHHHHHHHHHSTTSTTTTTSCHHHHHHHHHHHHHHTTSTTSTTSCCSCCSEEE
T ss_pred             HHHHCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHCCCCEEE
T ss_conf             99866980431452477546652002567779999877623761147789999888888887640224100111451689


Q ss_pred             EECCCCCCHHHHHHHHCCCEEEEECCCCCCCHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9438877123212343398145403677670011520321577268999999999999999999744
Q gi|254780779|r  164 VVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQH  230 (278)
Q Consensus       164 v~d~~~e~~Av~EA~kl~IPvIaivDTn~dp~~idypIP~NDds~~si~l~~~~i~~ai~~g~~~~~  230 (278)
                      |+||..|++||+||.+|||||||+|||||||+.|||||||||||++||.|+++.+++||++|++.+.
T Consensus       163 i~d~~~~~~ai~Ea~~l~IPvI~ivDTn~~p~~IdypIP~Ndds~~sI~li~~~l~~ai~~g~~~~~  229 (231)
T 3bbn_B          163 IVDQQEEYTALRECITLGIPTICLIDTNCNPDLADISIPANDDAIASIRLILTKLVFAICEGRSSYI  229 (231)
T ss_dssp             ESCTTTTHHHHHHHHTTTCCEEECCCSSSCCSSCSEECCCCSSSHHHHHHHHHHHHHHHHHTSSCCC
T ss_pred             EECCCCCHHHHHHHHHCCCCEEEEEECCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8316621898998986699769987279997657677636886699999999999999999887762



>2vqe_B (B:) 30S ribosomal protein S2; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure
>2zkq_b (b:) 40S ribosomal protein SA; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3bch_A (A:) 40S ribosomal protein SA; laminin receptor, P40 ribosomal protein, acetylation, cytoplasm, phosphorylation, polymorphism; 2.15A {Homo sapiens} Back     alignment and structure
>1vi6_A (A:) 30S ribosomal protein S2P; structural genomics, ribosome; 1.95A {Archaeoglobus fulgidus} Back     alignment and structure
>3jyv_B (B:) 40S ribosomal protein S0(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_B Back     alignment and structure
>3i1m_B (B:46-241) 30S ribosomal protein S2; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_B* 3e1a_B 3e1c_B 1vs5_B 3i1o_B 3i1q_B 3i1s_B 3i1z_B 3i21_B 2qal_B* 1p87_B 2aw7_B 2avy_B 2i2u_B 2i2p_B* 2qan_B* 2qb9_B* 2qbb_B* 2qbd_B 2qbf_B ... Back     alignment and structure
>2yva_A (A:) DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar binding protein, DNAA binding protein; 1.85A {Escherichia coli} Back     alignment and structure
>2i2w_A (A:) Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A Back     alignment and structure
>2a3n_A (A:1-192) Putative glucosamine-fructose-6-phosphate aminotransferase; 16423107, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Salmonella typhimurium LT2} Back     alignment and structure
>1x92_A (A:) APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2uz1_A (A:182-367) Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3d7k_A* Back     alignment and structure
>1nri_A (A:1-233) Hypothetical protein HI0754; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Haemophilus influenzae} Back     alignment and structure
>1tk9_A (A:) Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} Back     alignment and structure
>1vim_A (A:) Hypothetical protein AF1796; structural genomics, unknown function; 1.36A {Archaeoglobus fulgidus} Back     alignment and structure
>3beo_A (A:1-192,A:357-375) UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>1jeo_A (A:) MJ1247, hypothetical protein MJ1247; RUMP pathway, phosphosugar, 3-hexulose-6-phosphate isomerase, PHI, structural genomics; HET: CME CIT; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1m3s_A (A:) Hypothetical protein YCKF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} Back     alignment and structure
>3fkj_A (A:1-173) Putative phosphosugar isomerases; NP_459564.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.12A {Salmonella typhimurium LT2} Back     alignment and structure
>3knz_A (A:34-182) Putative sugar binding protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 2.50A {Salmonella enterica subsp} Back     alignment and structure
>3c3j_A (A:25-192) Putative tagatose-6-phosphate ketose/aldose isomerase; structural genomics, PSI, MCSG, protein structure initiative; 1.80A {Escherichia coli K12} Back     alignment and structure
>3cvj_A (A:) Putative phosphoheptose isomerase; NP_244191.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Bacillus halodurans c-125} Back     alignment and structure