254780778

254780778

elongation factor Ts

GeneID in NCBI database:8209784Locus tag:CLIBASIA_03345
Protein GI in NCBI database:254780778Protein Accession:YP_003065191.1
Gene range:+(484385, 485275)Protein Length:296aa
Gene description:elongation factor Ts
COG prediction:[J] Translation elongation factor Ts
KEGG prediction:tsf; elongation factor Ts; K02357 elongation factor EF-Ts
SEED prediction:Translation elongation factor Ts
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Translation elongation factors bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKENDDG
cccccHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEEEEEccccEEEEEEccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHccccEEEEEEEEEEEccccccc
cccccHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHccccEEEEEEEEEccccEEEEEEccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccEccHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHEccccEEccEEEEEHHHHHHccccEEcccEEEEEEEEEEEccccccc
MSKVSAVAVKELrgktgagiMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVetdslakntdfqSLVSNIAGIalstdgsldnvlampfdhsgitvgdgIKQQIAITGECIKLRRSALLCVSEGVIssylhaspseglgSIGVLVALQSSAEDKELLSAIGEKIAVHVMLAspsvisvqmldpsivaNKRAHYMTEAldsgksgniVEKIVNGKMQSFCKECVLLhqgfvvdpsktvSDFLKESEKSIGASIEVVGVSHFVvgkenddg
MSKVSAVAVkelrgktgagimDCKNALLEAKGDSELAIDILRTkgamaaskregrkvsegligiardgykkaSIVEVNVEtdslakntdfQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTealdsgksgnIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEksigasievvgvSHFVVGKENDDG
MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKENDDG
MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYM**********NIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHF**GK*****
MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTK***********KVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKENDDG
***VSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKENDDG
MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKENDDG
MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKENDDG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target296 elongation factor Ts [Candidatus Liberibacter asiaticus
170785425296 elongation factor Ts [Candidatus Liberibacter asiaticus 1 1e-166
315121995299 elongation factor Ts [Candidatus Liberibacter solanacea 1 1e-122
15965249307 elongation factor Ts [Sinorhizobium meliloti 1021] Leng 1 2e-70
150396351307 elongation factor Ts [Sinorhizobium medicae WSM419] Len 1 2e-70
227821898307 elongation factor Ts [Sinorhizobium fredii NGR234] Leng 1 4e-68
116251978308 elongation factor Ts [Rhizobium leguminosarum bv. vicia 1 2e-67
325292738308 Elongation factor Ts [Agrobacterium sp. H13-3] Length = 1 3e-67
222148861308 elongation factor Ts [Agrobacterium vitis S4] Length = 1 4e-67
159184737308 elongation factor Ts [Agrobacterium tumefaciens str. C5 1 5e-67
241204505308 elongation factor Ts [Rhizobium leguminosarum bv. trifo 1 5e-67
>gi|170785425|gb|ACB37706.1| elongation factor Ts [Candidatus Liberibacter asiaticus] Length = 296 Back     alignment and organism information
 Score =  587 bits (1513), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 295/296 (99%), Positives = 296/296 (100%)

Query: 1   MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEG 60
           MSKVSAVAVKELRGKTGAGI+DCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEG
Sbjct: 1   MSKVSAVAVKELRGKTGAGILDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEG 60

Query: 61  LIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSG 120
           LIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSG
Sbjct: 61  LIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSG 120

Query: 121 ITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAED 180
           ITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAED
Sbjct: 121 ITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAED 180

Query: 181 KELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNG 240
           KELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNG
Sbjct: 181 KELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNG 240

Query: 241 KMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKENDDG 296
           KMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKENDDG
Sbjct: 241 KMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKENDDG 296


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121995|ref|YP_004062484.1| elongation factor Ts [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 299 Back     alignment and organism information
>gi|15965249|ref|NP_385602.1| elongation factor Ts [Sinorhizobium meliloti 1021] Length = 307 Back     alignment and organism information
>gi|150396351|ref|YP_001326818.1| elongation factor Ts [Sinorhizobium medicae WSM419] Length = 307 Back     alignment and organism information
>gi|227821898|ref|YP_002825868.1| elongation factor Ts [Sinorhizobium fredii NGR234] Length = 307 Back     alignment and organism information
>gi|116251978|ref|YP_767816.1| elongation factor Ts [Rhizobium leguminosarum bv. viciae 3841] Length = 308 Back     alignment and organism information
>gi|325292738|ref|YP_004278602.1| Elongation factor Ts [Agrobacterium sp. H13-3] Length = 308 Back     alignment and organism information
>gi|222148861|ref|YP_002549818.1| elongation factor Ts [Agrobacterium vitis S4] Length = 308 Back     alignment and organism information
>gi|159184737|ref|NP_354382.2| elongation factor Ts [Agrobacterium tumefaciens str. C58] Length = 308 Back     alignment and organism information
>gi|241204505|ref|YP_002975601.1| elongation factor Ts [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 308 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target296 elongation factor Ts [Candidatus Liberibacter asiaticus
PRK09377290 PRK09377, tsf, elongation factor Ts; Provisional 1e-74
TIGR00116290 TIGR00116, tsf, translation elongation factor Ts 7e-44
KOG1071340 KOG1071, KOG1071, KOG1071, Mitochondrial translation el 1e-28
COG0264296 COG0264, Tsf, Translation elongation factor Ts [Transla 5e-61
pfam00889177 pfam00889, EF_TS, Elongation factor TS 3e-30
PRK12332198 PRK12332, tsf, elongation factor Ts; Reviewed 6e-27
CHL00098200 CHL00098, tsf, elongation factor Ts 3e-21
PRK12332198 PRK12332, tsf, elongation factor Ts; Reviewed 2e-21
CHL00098200 CHL00098, tsf, elongation factor Ts 2e-10
>gnl|CDD|181810 PRK09377, tsf, elongation factor Ts; Provisional Back     alignment and domain information
>gnl|CDD|129222 TIGR00116, tsf, translation elongation factor Ts Back     alignment and domain information
>gnl|CDD|36289 KOG1071, KOG1071, KOG1071, Mitochondrial translation elongation factor EF-Tsmt, catalyzes nucleotide exchange on EF-Tumt [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30613 COG0264, Tsf, Translation elongation factor Ts [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144474 pfam00889, EF_TS, Elongation factor TS Back     alignment and domain information
>gnl|CDD|183447 PRK12332, tsf, elongation factor Ts; Reviewed Back     alignment and domain information
>gnl|CDD|177028 CHL00098, tsf, elongation factor Ts Back     alignment and domain information
>gnl|CDD|183447 PRK12332, tsf, elongation factor Ts; Reviewed Back     alignment and domain information
>gnl|CDD|177028 CHL00098, tsf, elongation factor Ts Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 296 elongation factor Ts [Candidatus Liberibacter asiaticus
PRK09377288 tsf elongation factor Ts; Provisional 100.0
COG0264296 Tsf Translation elongation factor Ts [Translation, ribo 100.0
TIGR00116364 tsf translation elongation factor Ts; InterPro: IPR0018 100.0
PRK12332216 tsf elongation factor Ts; Reviewed 100.0
CHL00098207 tsf elongation factor Ts 100.0
KOG1071340 consensus 100.0
pfam00889177 EF_TS Elongation factor TS. 100.0
LOAD_efts_N41 consensus 99.49
pfam0062737 UBA UBA/TS-N domain. This small domain is composed of t 97.66
COG1308122 EGD2 Transcription factor homologous to NACalpha-BTF3 [ 95.96
TIGR00264125 TIGR00264 alpha-NAC homolog; InterPro: IPR005231 Eukary 95.76
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is a co 95.39
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, SNF1 95.15
PRK06369116 nac nascent polypeptide-associated complex protein; Rev 94.45
KOG1071 340 consensus 98.5
COG0264 296 Tsf Translation elongation factor Ts [Translation, ribo 96.99
PRK09377 288 tsf elongation factor Ts; Provisional 96.72
pfam00889177 EF_TS Elongation factor TS. 97.24
>PRK09377 tsf elongation factor Ts; Provisional Back     alignment and domain information
>COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00116 tsf translation elongation factor Ts; InterPro: IPR001816 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , Back     alignment and domain information
>PRK12332 tsf elongation factor Ts; Reviewed Back     alignment and domain information
>CHL00098 tsf elongation factor Ts Back     alignment and domain information
>KOG1071 consensus Back     alignment and domain information
>pfam00889 EF_TS Elongation factor TS Back     alignment and domain information
>LOAD_efts_N consensus Back     alignment and domain information
>pfam00627 UBA UBA/TS-N domain Back     alignment and domain information
>COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] Back     alignment and domain information
>TIGR00264 TIGR00264 alpha-NAC homolog; InterPro: IPR005231 Eukaryotic NAC, an abundant heterodimer composed of two homologous subunits, reversibly binds eukaryotic ribosomes and is located in direct proximity to nascent polypeptides as they emerge from the ribosome Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>KOG1071 consensus Back     alignment and domain information
>COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09377 tsf elongation factor Ts; Provisional Back     alignment and domain information
>pfam00889 EF_TS Elongation factor TS Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target296 elongation factor Ts [Candidatus Liberibacter asiaticus
3agp_A 1289 Structure Of Viral Polymerase Form I Length = 1289 1e-64
3mmp_A 678 Structure Of The Qb Replicase, An Rna-Dependent Rna 1e-59
1efu_B282 Elongation Factor Complex Ef-TuEF-Ts From Escherich 5e-52
1xb2_B291 Crystal Structure Of Bos Taurus Mitochondrial Elong 2e-28
1tfe_A145 Dimerization Domain Of Ef-Ts From T. Thermophilus L 6e-23
1aip_C196 Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt 6e-22
1aip_C196 Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt 5e-22
2cp9_A64 Solution Structure Of Rsgi Ruh-042, A Uba Domain Fr 6e-06
>gi|305677666|pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 Back     alignment and structure
 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 153/294 (52%), Gaps = 28/294 (9%)

Query: 1   MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEG 60
           M++++A  VKELR +TGAG+MDCK AL EA GD ELAI+ +R  GA+ A+K+ G   ++G
Sbjct: 1   MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADG 60

Query: 61  LIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSG 120
           +I    DG     I+EVN +TD +AK+  FQ+    +   A++   +   VL   F+   
Sbjct: 61  VIKTKIDG-NYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEER 119

Query: 121 ITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAED 180
           +         +A  GE I +RR A   +   V+ SY H         IGVLVA + + E 
Sbjct: 120 V-------ALVAKIGENINIRRVA--ALEGDVLGSYQHG------ARIGVLVAAKGADE- 163

Query: 181 KELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNG 240
                 + + IA+HV  + P  I  + +   +V  +    +  A+ SGK   I EK+V G
Sbjct: 164 -----ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEG 218

Query: 241 KMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKEND 294
           +M+ F  E  L  Q FV++PSKTV   LKE       + EV G   F VG+  +
Sbjct: 219 RMKKFTGEVSLTGQPFVMEPSKTVGQLLKEH------NAEVTGFIRFEVGEGIE 266


>gi|297787753|pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 Back     alignment and structure
>gi|1942722|pdb|1EFU|B Chain B, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 282 Back     alignment and structure
>gi|56967055|pdb|1XB2|B Chain B, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 291 Back     alignment and structure
>gi|157833929|pdb|1TFE|A Chain A, Dimerization Domain Of Ef-Ts From T. Thermophilus Length = 145 Back     alignment and structure
gi|2624673|pdb|1AIP|C Chain C, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 196 Back     alignment and structure
gi|2624673|pdb|1AIP|C Chain C, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 196 Back     alignment and structure
>gi|159163835|pdb|2CP9|A Chain A, Solution Structure Of Rsgi Ruh-042, A Uba Domain From Human Mitochondrial Elongation Factor Ts Length = 64 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target296 elongation factor Ts [Candidatus Liberibacter asiaticus
3agp_A 1289 Elongation factor TS, elongation factor TU, linke repli 5e-77
3mmp_A 678 Elongation factor TU 2, elongation factor TS; RDRP,HOST 3e-69
1efu_B282 Elongation factor TS; complex (TWO elongation factors); 2e-58
1xb2_B291 EF-TS, elongation factor TS, mitochondrial, EF-TSMT; pr 2e-35
1tfe_A145 Elongation factor TS; 1.70A {Thermus thermophilus} SCOP 2e-20
1aip_C196 EF-TS, elongation factor TS; nucleotide exchange, GTP-b 3e-16
1aip_C196 EF-TS, elongation factor TS; nucleotide exchange, GTP-b 1e-16
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UB 2e-15
>3agp_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase; 2.80A {Escherichia coli O157} PDB: 3agq_A Length = 1289 Back     alignment and structure
 Score =  282 bits (724), Expect = 5e-77
 Identities = 105/299 (35%), Positives = 152/299 (50%), Gaps = 32/299 (10%)

Query: 1   MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEG 60
           M++++A  VKELR +TGAG+MDCK AL EA GD ELAI+ +R  GA+ A+K+ G   ++G
Sbjct: 1   MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADG 60

Query: 61  LIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSG 120
           +I    DG     I+EVN +TD +AK+  FQ+    +   A++   +   VL        
Sbjct: 61  VIKTKIDG-NYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKA------ 113

Query: 121 ITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAED 180
               +     +A  GE I +RR A   +   V+ SY H         IGVLVA + + E+
Sbjct: 114 -QFEEERVALVAKIGENINIRRVAA--LEGDVLGSYQHG------ARIGVLVAAKGADEE 164

Query: 181 KELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNG 240
                 + + IA+HV  + P  I  + +   +V  +    +  A+ SGK   I EK+V G
Sbjct: 165 ------LVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEG 218

Query: 241 KMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVG----KENDD 295
           +M+ F  E  L  Q FV++PSKTV   LKE       + EV G   F VG    K   D
Sbjct: 219 RMKKFTGEVSLTGQPFVMEPSKTVGQLLKE------HNAEVTGFIRFEVGEGIEKVETD 271


>3mmp_A Elongation factor TU 2, elongation factor TS; RDRP,HOST-factor complex, translation, transferase; HET: PXN; 2.50A {Escherichia coli} Length = 678 Back     alignment and structure
>1efu_B Elongation factor TS; complex (TWO elongation factors); 2.50A {Escherichia coli} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Length = 282 Back     alignment and structure
>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Length = 291 Back     alignment and structure
>1tfe_A Elongation factor TS; 1.70A {Thermus thermophilus} SCOP: d.43.1.1 Length = 145 Back     alignment and structure
>1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 Length = 196 Back     alignment and structure
>1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 Length = 196 Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Length = 64 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target296 elongation factor Ts [Candidatus Liberibacter asiaticus
3agp_A 1289 Elongation factor TS, elongation factor TU, linke repli 100.0
3mmp_A 678 Elongation factor TU 2, elongation factor TS; RDRP,HOST 100.0
1efu_B282 Elongation factor TS; complex (TWO elongation factors); 100.0
1xb2_B291 EF-TS, elongation factor TS, mitochondrial, EF-TSMT; pr 100.0
1aip_C196 EF-TS, elongation factor TS; nucleotide exchange, GTP-b 100.0
1tfe_A145 Elongation factor TS; 1.70A {Thermus thermophilus} SCOP 100.0
1xb2_B 291 EF-TS, elongation factor TS, mitochondrial, EF-TSMT; pr 97.31
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UB 99.78
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, cDNA 96.56
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin associ 96.19
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A; ubi 96.05
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin 95.89
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, ubiqui 95.86
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; UBA d 95.63
1wji_A63 Tudor domain containing protein 3; UBA domain, structur 95.41
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T 95.15
1tr8_A102 Conserved protein (MTH177); chaperones, nascent polypep 94.87
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bundle, 94.81
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin associat 94.8
2dna_A67 Unnamed protein product; ubiquitin associated domain, D 94.77
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, 94.57
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T 93.7
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPSFA, n 93.6
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucl 93.34
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protein; 2. 93.19
2cwb_A108 Chimera of immunoglobulin G binding protein G and ubiqu 93.13
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, str 92.94
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin associ 92.82
2g3q_A43 Protein YBL047C; endocytosis, solution structure, UBA d 92.79
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; UBA do 90.75
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, m 90.62
1tfe_A145 Elongation factor TS; 1.70A {Thermus thermophilus} SCOP 98.85
3agp_A 1289 Elongation factor TS, elongation factor TU, linke repli 92.43
1efu_B282 Elongation factor TS; complex (TWO elongation factors); 92.15
>3agp_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase; 2.80A {Escherichia coli O157} PDB: 3agq_A Back     alignment and structure
Probab=100.00  E-value=0  Score=681.71  Aligned_cols=263  Identities=40%  Similarity=0.590  Sum_probs=247.0

Q ss_pred             CCCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCEEEEEEEEE
Q ss_conf             97355899999998719998999999996299989999999982388998651033642200004407885369999840
Q gi|254780778|r    1 MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVE   80 (296)
Q Consensus         1 Ma~it~~~iK~LR~~Tgag~~dCKkAL~e~~gD~e~Ai~~LRkkG~~~A~Kk~~R~a~eG~v~~~~~~~~~a~liEincE   80 (296)
                      ||+|||++||+||++||||||||||||+|++||+|+|++|||+||+++|+||++|.|+||+|+++.++ +.|+|+|||||
T Consensus         1 Ma~ITA~~VKeLRe~TGAGMMDCKkAL~E~~GD~ekAie~LRkkG~a~AaKKa~R~aaEGli~~~~~~-~~~~lvEvN~E   79 (1289)
T 3agp_A            1 MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDG-NYGIILEVNCQ   79 (1289)
T ss_dssp             -CCSCHHHHHHHHHHHCCCSHHHHHHHHTTTSCHHHHHHHHHHTTHHHHHHHTTSCCCEEEEEEEEET-TEEEEEEEEES
T ss_pred             CCCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECC-CEEEEEEEECC
T ss_conf             98548999999998749948899999877588899999999986358777646610027549999739-87999999767


Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCC
Q ss_conf             31010226799999988875310335657786400410000146778999985434310244431022221000001353
Q gi|254780778|r   81 TDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHAS  160 (296)
Q Consensus        81 TDFVAkn~~F~~l~~~i~~~~l~~~~~~~~~~~~~~~~~~~tv~d~i~~~ia~iGEnI~l~R~~~~~~~~~~v~~Y~H~~  160 (296)
                      |||||||+.|++|++++++.++.++.+..+.+.       .|++|.+.+++++|||||+|||+.++  +++++++|+|+ 
T Consensus        80 TDFVAkne~F~~l~~~i~~~~~~~~~~~~e~l~-------~~~~e~~~~~ia~iGEni~lrR~~~~--~~~~v~~Y~H~-  149 (1289)
T 3agp_A           80 TDFVAKDAGFQAFADKVLDAAVAGKITDVEVLK-------AQFEEERVALVAKIGENINIRRVAAL--EGDVLGSYQHG-  149 (1289)
T ss_dssp             CHHHHTCHHHHHHHHHHHHHHHHTTCCSHHHHH-------HHHHHHHHHHHHHHCSCCEEEEEEEE--ECSEEEEEEET-
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHH-------HHHHHHHHHHHHHHCCCEEEEEEEEE--ECCEEEEEECC-
T ss_conf             664227827999999999999855988899987-------07999999998760687799889997--28879999729-


Q ss_pred             CCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             23460344344430354321578999885655667654332045878362777766566677631257867899777401
Q gi|254780778|r  161 PSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNG  240 (296)
Q Consensus       161 ~~~~~GkigvlV~l~~~~~~~~~~~~~ak~iAmhiaA~~P~~l~~~~v~~~~i~~Ek~i~~~~~~~~gKp~~i~ekIv~G  240 (296)
                           |||||||++++.++      +++|+||||||||+|.||++++||++++++|++|+++|++++|||++|++|||+|
T Consensus       150 -----~kIgvlV~~~~~~~------e~akdiAMhIAA~~P~~ls~~~vp~~vve~Er~i~~~qa~~~GKPe~I~eKIveG  218 (1289)
T 3agp_A          150 -----ARIGVLVAAKGADE------ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEG  218 (1289)
T ss_dssp             -----TTEEEEEEETTCCH------HHHHHHHHHHHTTCCSBSSGGGSCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHH
T ss_pred             -----CEEEEEEEECCCCH------HHHHHHHHHHHHHCCCCCCHHHCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             -----97999999568759------9998899999853873188156999999999999999998739979999999878


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEEEEEECC
Q ss_conf             676664233302560002777439999987764207982899889876224
Q gi|254780778|r  241 KMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGK  291 (296)
Q Consensus       241 kl~Kf~~E~~LleQ~fv~D~~~tV~~~l~e~~k~~g~~i~I~~F~R~~lGE  291 (296)
                      ||+|||+|+|||+|+||+||++||++||++.      +.+|++|+||+|||
T Consensus       219 rl~kf~~E~~Ll~Q~fVkD~~~tV~~~l~~~------~~~v~~F~R~evGE  263 (1289)
T 3agp_A          219 RMKKFTGEVSLTGQPFVMEPSKTVGQLLKEH------NAEVTGFIRFEVGE  263 (1289)
T ss_dssp             HHHHHHHHTBGGGSBCTTSTTSBHHHHHHHT------TCCCCEEEEEETTT
T ss_pred             HHHHHHHHHEECCCCEEECCCCCHHHHHHHC------CCEEEEEEEEEECC
T ss_conf             8887745632136850327963199999867------99799999997448



>3mmp_A Elongation factor TU 2, elongation factor TS; RDRP,HOST-factor complex, translation, transferase; HET: PXN; 2.50A {Escherichia coli} Back     alignment and structure
>1efu_B Elongation factor TS; complex (TWO elongation factors); 2.50A {Escherichia coli} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Back     alignment and structure
>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Back     alignment and structure
>1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 Back     alignment and structure
>1tfe_A Elongation factor TS; 1.70A {Thermus thermophilus} SCOP: d.43.1.1 Back     alignment and structure
>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome, UBA-domain, ubiquitin; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1tfe_A Elongation factor TS; 1.70A {Thermus thermophilus} SCOP: d.43.1.1 Back     alignment and structure
>3agp_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase; 2.80A {Escherichia coli O157} PDB: 3agq_A Back     alignment and structure
>1efu_B Elongation factor TS; complex (TWO elongation factors); 2.50A {Escherichia coli} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 296 elongation factor Ts [Candidatus Liberibacter asiaticus
d1tfea_142 d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisatio 2e-22
d1efub2143 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dime 7e-16
d1xb2b3109 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dime 5e-08
d1efub354 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-termin 4e-15
d1aipc152 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-termin 2e-14
d1xb2b156 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-term 3e-14
d1xb2b2111 d.43.1.1 (B:112-222) Elongation factor Ts (EF-Ts), dime 9e-15
d1efub485 d.43.1.1 (B:55-139) Elongation factor Ts (EF-Ts), dimer 2e-12
>d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]} Length = 142 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: EF-Ts domain-like
superfamily: Elongation factor Ts (EF-Ts), dimerisation domain
family: Elongation factor Ts (EF-Ts), dimerisation domain
domain: Elongation factor Ts (EF-Ts), dimerisation domain
species: Thermus thermophilus [TaxId: 274]
 Score =  100 bits (249), Expect = 2e-22
 Identities = 42/145 (28%), Positives = 73/145 (50%), Gaps = 8/145 (5%)

Query: 149 SEGVISSYLHASPSEGLGSIGVLVALQSSAE---DKELLSAIGEKIAVHVMLASPSVISV 205
            EG+I  Y+H +       +GVLV L    +     EL   + + +A+H+ + +P  +S 
Sbjct: 2   REGIIGHYIHHN-----QRVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPRYVSA 56

Query: 206 QMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVS 265
           + +    +  +R  Y+  AL+ GK   I EKI  G+++ + +E VLL Q FV D    V 
Sbjct: 57  EEIPAEELEKERQIYIQAALNEGKPQQIAEKIAEGRLKKYLEEVVLLEQPFVKDDKVKVK 116

Query: 266 DFLKESEKSIGASIEVVGVSHFVVG 290
           + ++++   IG +I V     F +G
Sbjct: 117 ELIQQAIAKIGENIVVRRFCRFELG 141


>d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} Length = 143 Back     information, alignment and structure
>d1xb2b3 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 109 Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 54 Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 52 Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 56 Back     information, alignment and structure
>d1xb2b2 d.43.1.1 (B:112-222) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 111 Back     information, alignment and structure
>d1efub4 d.43.1.1 (B:55-139) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target296 elongation factor Ts [Candidatus Liberibacter asiaticus
d1tfea_142 Elongation factor Ts (EF-Ts), dimerisation domain {Ther 100.0
d1efub2143 Elongation factor Ts (EF-Ts), dimerisation domain {Esch 100.0
d1xb2b3109 Elongation factor Ts (EF-Ts), dimerisation domain {Cow 99.92
d1xb2b2111 Elongation factor Ts (EF-Ts), dimerisation domain {Cow 98.34
d1efub485 Elongation factor Ts (EF-Ts), dimerisation domain {Esch 96.61
d1xb2b2111 Elongation factor Ts (EF-Ts), dimerisation domain {Cow 99.9
d1efub485 Elongation factor Ts (EF-Ts), dimerisation domain {Esch 99.83
d1tfea_142 Elongation factor Ts (EF-Ts), dimerisation domain {Ther 99.05
d1xb2b3109 Elongation factor Ts (EF-Ts), dimerisation domain {Cow 94.01
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {Escher 99.79
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {Cow (B 99.77
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {Thermu 99.75
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (Homo s 95.84
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Arabido 95.66
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapi 95.27
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus 94.95
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis thal 94.89
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sapiens) 94.05
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 93.82
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 93.55
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} 93.43
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [Ta 93.36
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 92.91
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 92.83
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis thal 91.39
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus mu 90.49
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) {Huma 90.07
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat ( 90.05
>d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: EF-Ts domain-like
superfamily: Elongation factor Ts (EF-Ts), dimerisation domain
family: Elongation factor Ts (EF-Ts), dimerisation domain
domain: Elongation factor Ts (EF-Ts), dimerisation domain
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=3.8e-42  Score=298.31  Aligned_cols=138  Identities=30%  Similarity=0.589  Sum_probs=131.7

Q ss_pred             CCCCEEEECCCCCCCCHHHHHHHHHHCCCCC---HHHHHHHHHHHHHHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             2210000013532346034434443035432---1578999885655667654332045878362777766566677631
Q gi|254780778|r  149 SEGVISSYLHASPSEGLGSIGVLVALQSSAE---DKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEAL  225 (296)
Q Consensus       149 ~~~~v~~Y~H~~~~~~~GkigvlV~l~~~~~---~~~~~~~~ak~iAmhiaA~~P~~l~~~~v~~~~i~~Ek~i~~~~~~  225 (296)
                      .+|.+++|+|++     ||+||||.+++.++   ..+.+.+++++|||||+|++|.||++++||++++++|+++++++++
T Consensus         2 ~eG~v~~YiH~~-----gkigvlv~l~~~~d~~~~~~~~~~~ak~iAmhiaA~~P~~i~~~~v~~~~i~~E~ei~~~~~~   76 (142)
T d1tfea_           2 REGIIGHYIHHN-----QRVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPRYVSAEEIPAEELEKERQIYIQAAL   76 (142)
T ss_dssp             CEEEEEEEECTT-----SSEEEEEEEEESCHHHHHSHHHHHHHHHHHHHHHHHCCSBSSGGGSCHHHHHHHHHHHHHHHH
T ss_pred             CCCEEEEEECCC-----CCEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCHHHHHHHHHHHHHHHH
T ss_conf             987899998389-----967999999735612320157899999998655403865388567879999999999877754


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEEEEEECC
Q ss_conf             257867899777401676664233302560002777439999987764207982899889876224
Q gi|254780778|r  226 DSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGK  291 (296)
Q Consensus       226 ~~gKp~~i~ekIv~Gkl~Kf~~E~~LleQ~fv~D~~~tV~~~l~e~~k~~g~~i~I~~F~R~~lGE  291 (296)
                      .+|||++|++||++|||+|||+|+|||+|+||+||++||++||++.++++|.+|+|++|+||+||-
T Consensus        77 ~~gKP~~i~ekIv~Gk~~Kf~~E~~LleQ~fv~D~~~tV~~~l~~~~~~~g~~i~i~~F~R~~vG~  142 (142)
T d1tfea_          77 NEGKPQQIAEKIAEGRLKKYLEEVVLLEQPFVKDDKVKVKELIQQAIAKIGENIVVRRFCRFELGA  142 (142)
T ss_dssp             TTTCCHHHHHHHHHHHHHHHHHHHBGGGSEETTEEEEEHHHHHHHHHHHHCSCCEEEEEEEEETTC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEEEEEECC
T ss_conf             045378899999999999888876320587405998409999999898608980899999998369



>d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xb2b3 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1xb2b2 d.43.1.1 (B:112-222) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1efub4 d.43.1.1 (B:55-139) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xb2b2 d.43.1.1 (B:112-222) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1efub4 d.43.1.1 (B:55-139) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xb2b3 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 296 elongation factor Ts [Candidatus Liberibacter asia
1efu_B_1-265265 (B:1-265) Elongation factor TS; complex (TWO elong 9e-55
1aip_C_1-104_164-196137 (C:1-104,C:164-196) EF-TS, elongation factor TS; n 3e-29
1xb2_B_46-291246 (B:46-291) EF-TS, elongation factor TS, mitochondr 2e-22
2cp9_A_64 (A:) EF-TS, EF-TSMT, elongation factor TS, mitocho 5e-17
1xb2_B_1-4545 (B:1-45) EF-TS, elongation factor TS, mitochondria 2e-12
1tfe_A_1-50_110-14586 (A:1-50,A:110-145) Elongation factor TS; 1.70A {Th 3e-13
1tfe_A_51-10959 (A:51-109) Elongation factor TS; 1.70A {Thermus th 4e-10
1aip_C_105-16359 (C:105-163) EF-TS, elongation factor TS; nucleotid 4e-10
>1efu_B (B:1-265) Elongation factor TS; complex (TWO elongation factors); 2.50A {Escherichia coli}Length = 265 Back     alignment and structure
 Score =  207 bits (529), Expect = 9e-55
 Identities = 100/289 (34%), Positives = 144/289 (49%), Gaps = 28/289 (9%)

Query: 2   SKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGL 61
           ++++A  VKELR +TGAG+MDCK AL EA GD ELAI+ +R  GA+ A+K+ G   ++G+
Sbjct: 1   AEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGV 60

Query: 62  IGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGI 121
           I    DG     I+EVN +TD +AK+  FQ+    +   A++             +    
Sbjct: 61  IKTKIDG-NYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK-------ITDVEVLKA 112

Query: 122 TVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSEGLGSIGVLVALQSSAEDK 181
              +     +A  GE I +RR A   +   V+ SY H         IGVLVA       K
Sbjct: 113 QFEEERVALVAKIGENINIRRVA--ALEGDVLGSYQHG------ARIGVLVAA------K 158

Query: 182 ELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGK 241
                + + IA+HV  + P  I  + +   +V  +    +  A+ SGK   I EK+V G+
Sbjct: 159 GADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGR 218

Query: 242 MQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVG 290
           M+ F  E  L  Q FV++PSKTV   LKE       + EV G   F VG
Sbjct: 219 MKKFTGEVSLTGQPFVMEPSKTVGQLLKE------HNAEVTGFIRFEVG 261


>1aip_C (C:1-104,C:164-196) EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus}Length = 137 Back     alignment and structure
>1xb2_B (B:46-291) EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus}Length = 246 Back     alignment and structure
>2cp9_A (A:) EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens}Length = 64 Back     alignment and structure
>1xb2_B (B:1-45) EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus}Length = 45 Back     alignment and structure
>1tfe_A (A:1-50,A:110-145) Elongation factor TS; 1.70A {Thermus thermophilus}Length = 86 Back     alignment and structure
>1tfe_A (A:51-109) Elongation factor TS; 1.70A {Thermus thermophilus}Length = 59 Back     alignment and structure
>1aip_C (C:105-163) EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus}Length = 59 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target296 elongation factor Ts [Candidatus Liberibacter asiaticus
1efu_B_1-265265 Elongation factor TS; complex (TWO elongation fact 100.0
1xb2_B_46-291246 EF-TS, elongation factor TS, mitochondrial, EF-TSM 100.0
1aip_C_1-104_164-196137 EF-TS, elongation factor TS; nucleotide exchange, 100.0
2cp9_A_64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 99.84
1xb2_B_1-4545 EF-TS, elongation factor TS, mitochondrial, EF-TSM 99.66
2cwb_A_108 Chimera of immunoglobulin G binding protein G and 96.36
1vej_A_74 Riken cDNA 4931431F19; UBA domain, three helix bun 96.28
1wj7_A_104 Hypothetical protein (RSGI RUH-015); UBA domain, u 96.17
1vg5_A_73 RSGI RUH-014, rhomboid family protein; UBA domain, 96.16
2dna_A_67 Unnamed protein product; ubiquitin associated doma 96.14
2dah_A_54 Ubiquilin-3; UBA domain, structural genomics, NPPS 95.99
1wiv_A_73 UBP14, ubiquitin-specific protease 14; ubiquitin a 95.96
3ihp_A_707-78175 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 95.95
1wr1_B_58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 95.88
2dai_A_83 Ubadc1, ubiquitin associated domain containing 1; 95.82
2g3q_A_43 Protein YBL047C; endocytosis, solution structure, 95.53
1veg_A_83 NEDD8 ultimate buster-1; ubiquitin associated doma 95.52
1wgn_A_63 UBAP1, ubiquitin associated protein; ubiquitin ass 95.35
2qsf_X_105-17167 RAD23, UV excision repair protein RAD23; alpha-bet 95.33
1oqy_A_126-22499 HHR23A, UV excision repair protein RAD23 homolog A 95.28
1wji_A_63 Tudor domain containing protein 3; UBA domain, str 95.23
1ify_A_49 HHR23A, UV excision repair protein RAD23 homolog A 95.19
1oqy_A_309-36860 HHR23A, UV excision repair protein RAD23 homolog A 95.16
2dak_A_63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 94.72
1dv0_A_47 DNA repair protein HHR23A; helical bundle, DNA bin 94.07
1tr8_A_63-10240 Conserved protein (MTH177); chaperones, nascent po 93.7
2bwb_A_46 Ubiquitin-like protein DSK2; UBA, signaling protei 93.65
2dag_A_74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 93.26
3ihp_A_637-70670 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 93.2
2cpw_A_64 CBL-interacting protein STS-1 variant; ubiquitin a 93.07
1vek_A_84 UBP14, ubiquitin-specific protease 14, putative; U 93.04
2jy5_A_52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 92.59
3bq3_A_1-6565 Defective in cullin neddylation protein 1; ubiquit 91.23
1tfe_A_1-50_110-14586 Elongation factor TS; 1.70A {Thermus thermophilus} 99.81
1tfe_A_51-10959 Elongation factor TS; 1.70A {Thermus thermophilus} 99.68
1aip_C_105-16359 EF-TS, elongation factor TS; nucleotide exchange, 99.68
1tfe_A_1-50_110-14586 Elongation factor TS; 1.70A {Thermus thermophilus} 98.36
1aip_C_1-104_164-196137 EF-TS, elongation factor TS; nucleotide exchange, 98.31
1xb2_B_46-291 246 EF-TS, elongation factor TS, mitochondrial, EF-TSM 98.03
1efu_B_1-265265 Elongation factor TS; complex (TWO elongation fact 96.54
>1efu_B (B:1-265) Elongation factor TS; complex (TWO elongation factors); 2.50A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=621.30  Aligned_cols=265  Identities=38%  Similarity=0.566  Sum_probs=250.9

Q ss_pred             CCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCEEEEEEEEEC
Q ss_conf             73558999999987199989999999962999899999999823889986510336422000044078853699998403
Q gi|254780778|r    2 SKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGRKVSEGLIGIARDGYKKASIVEVNVET   81 (296)
Q Consensus         2 a~it~~~iK~LR~~Tgag~~dCKkAL~e~~gD~e~Ai~~LRkkG~~~A~Kk~~R~a~eG~v~~~~~~~~~a~liEincET   81 (296)
                      |+||+++||+||++||||||||||||++|+||+|+|++|||++|+++|+||++|.|+||+|+++.++ +.|+|+||||||
T Consensus         1 a~is~~~ik~LR~~Tgag~~~CKkAL~~~~gd~~~A~~~Lrk~G~~~a~k~~~r~~~eG~i~~~~~~-~~~~ivElncET   79 (265)
T 1efu_B            1 AEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDG-NYGIILEVNCQT   79 (265)
T ss_dssp             CCCCHHHHHHHHHHHCCCHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHHTTSCCCEEEEEEEEET-TEEEEEEEEESC
T ss_pred             CCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECC-CEEEEEEEECCC
T ss_conf             9778999999998869859999999998489899999999997179888652870557659999749-879999983356


Q ss_pred             CHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCC
Q ss_conf             10102267999999888753103356577864004100001467789999854343102444310222210000013532
Q gi|254780778|r   82 DSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASP  161 (296)
Q Consensus        82 DFVAkn~~F~~l~~~i~~~~l~~~~~~~~~~~~~~~~~~~tv~d~i~~~ia~iGEnI~l~R~~~~~~~~~~v~~Y~H~~~  161 (296)
                      ||||||+.|++|+.++++.++.++.+..       ...+.|++|.+.++++++||||.|||+..+  +++++++|.|+  
T Consensus        80 DFVArn~~F~~l~~~ia~~~~~~~~~~~-------~~~~~tv~d~i~~~~~~igEni~l~R~~~~--~~~~v~~y~H~--  148 (265)
T 1efu_B           80 DFVAKDAGFQAFADKVLDAAVAGKITDV-------EVLKAQFEEERVALVAKIGENINIRRVAAL--EGDVLGSYQHG--  148 (265)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHHHTTCCCH-------HHHHHHHHHHHHHHHHHHCSCCEEEEEEEE--ECSEEEEEEET--
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCCH-------HHHHHHHHHHHHHHHHHHCCCCCCCEEEEE--ECCEEEEEECC--
T ss_conf             5330767899999999999984488889-------998606899999999885446210126897--17725898669--


Q ss_pred             CCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             34603443444303543215789998856556676543320458783627777665666776312578678997774016
Q gi|254780778|r  162 SEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGK  241 (296)
Q Consensus       162 ~~~~GkigvlV~l~~~~~~~~~~~~~ak~iAmhiaA~~P~~l~~~~v~~~~i~~Ek~i~~~~~~~~gKp~~i~ekIv~Gk  241 (296)
                          |+||++|++++++.      ++++++||||+||+|.||++++||++++++|++++.+|+..+|||++|++||++||
T Consensus       149 ----g~ig~lv~~~~~~~------~~ak~iAmhiaa~~P~~l~~~~vp~~~i~~e~~i~~~q~~~~gKP~~i~ekIveGk  218 (265)
T 1efu_B          149 ----ARIGVLVAAKGADE------ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGR  218 (265)
T ss_dssp             ----TTEEEEEEEESCCH------HHHHHHHHHHHHHCCSBSSGGGSCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHH
T ss_pred             ----CCEEEEEECCCCHH------HHHHHHHHHHHHCCCCCCCHHHCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCC
T ss_conf             ----86068995367649------99998889998518743883559999999999999999975399888998884053


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEEEEEECCCCC
Q ss_conf             76664233302560002777439999987764207982899889876224124
Q gi|254780778|r  242 MQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEVVGVSHFVVGKEND  294 (296)
Q Consensus       242 l~Kf~~E~~LleQ~fv~D~~~tV~~~l~e~~k~~g~~i~I~~F~R~~lGE~~~  294 (296)
                      |+|||+|+|||+||||+||++||++||++.      +++|++|+||+|||..|
T Consensus       219 l~k~~~E~~LleQ~fi~D~~~tV~~~l~~~------~i~V~~F~R~evGEg~e  265 (265)
T 1efu_B          219 MKKFTGEVSLTGQPFVMEPSKTVGQLLKEH------NAEVTGFIRFEVGEGIE  265 (265)
T ss_dssp             HHHHHHHHBTTTSEETTEEEEEHHHHHHTT------TCEEEEEEEEETTTTSC
T ss_pred             CCCCCCCCEEECCCCCCCCCCCHHHHHHHC------CCEEEEEEEEECCCCEE
T ss_conf             102112214543643169963799999976------99899999995478655



>1xb2_B (B:46-291) EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} Back     alignment and structure
>1aip_C (C:1-104,C:164-196) EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} Back     alignment and structure
>2cp9_A (A:) EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xb2_B (B:1-45) EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} Back     alignment and structure
>2cwb_A (A:) Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>1vej_A (A:) Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1wj7_A (A:) Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>1vg5_A (A:) RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2dna_A (A:) Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dah_A (A:) Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wiv_A (A:) UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3ihp_A (A:707-781) Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>1wr1_B (B:) Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dai_A (A:) Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g3q_A (A:) Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1veg_A (A:) NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1wgn_A (A:) UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1oqy_A (A:126-224) HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} Back     alignment and structure
>1wji_A (A:) Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} Back     alignment and structure
>1ify_A (A:) HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1oqy_A (A:309-368) HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} Back     alignment and structure
>2dak_A (A:) Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A (A:) DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1tr8_A (A:63-102) Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome, UBA-domain, ubiquitin; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>2bwb_A (A:) Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} Back     alignment and structure
>2dag_A (A:) Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ihp_A (A:637-706) Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2cpw_A (A:) CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vek_A (A:) UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2jy5_A (A:) Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1tfe_A (A:1-50,A:110-145) Elongation factor TS; 1.70A {Thermus thermophilus} Back     alignment and structure
>1tfe_A (A:51-109) Elongation factor TS; 1.70A {Thermus thermophilus} Back     alignment and structure
>1aip_C (C:105-163) EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} Back     alignment and structure
>1tfe_A (A:1-50,A:110-145) Elongation factor TS; 1.70A {Thermus thermophilus} Back     alignment and structure
>1aip_C (C:1-104,C:164-196) EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} Back     alignment and structure
>1xb2_B (B:46-291) EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} Back     alignment and structure
>1efu_B (B:1-265) Elongation factor TS; complex (TWO elongation factors); 2.50A {Escherichia coli} Back     alignment and structure