254780780

254780780

histidine triad (HIT) protein

GeneID in NCBI database:8209786Locus tag:CLIBASIA_03355
Protein GI in NCBI database:254780780Protein Accession:YP_003065193.1
Gene range:-(482599, 483066)Protein Length:155aa
Gene description:histidine triad (HIT) protein
COG prediction:[F] [G] [R] Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases
KEGG prediction:histidine triad (HIT) protein; K02503 Hit-like protein involved in cell-cycle regulation
SEED prediction:histidine triad (HIT) protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT
ccccccccccccccEEEEEcccccccEEEEcccEEEEEcccccccEEEEEEcccccccHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHc
cccccccccccccHHHHHHcccccccEEEEcccEEEEEcccccccEEEEEEEccccccHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccEEEEEEEEEEEccccccccccEcccccccccHHHHHHHHHHHHHHHHHHHccc
mkekssthydnqNIFIKIIRNETNACRVYEDDILLAIMdimprnpghvliipksrirdifeappEILSQIAFLIKKIAIACKSAFQADGIQilqfnghaagqtvphlhfhvipckngdnashtnihptqKIENFAKLEINAQKIRKELQNFLKTT
mkekssthydnqnIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT
MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT
***********QNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTN***********KLEINAQKIRKE*Q******
*********DNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT
*****STHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKELQNFLK**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENxxxxxxxxxxxxxxxxxxxxxT
MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT
MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target155 histidine triad (HIT) protein [Candidatus Liberibacter
315121997159 histidine triad (HIT) protein [Candidatus Liberibacter 1 1e-62
153009354140 histidine triad (HIT) protein [Ochrobactrum anthropi AT 1 6e-31
121602649140 histidine triad domain-containing protein [Bartonella b 1 1e-30
49474299140 Hit-like protein involved in cell-cycle regulation [Bar 1 2e-30
284055808161 Chain A, Crystal Structure Of Hit-Like Protein Involved 1 4e-30
49475407140 Hit-like protein involved in cell-cycle regulation [Bar 1 5e-30
239832055140 histidine triad (HIT) protein [Ochrobactrum intermedium 1 5e-30
116251971144 HIT family protein [Rhizobium leguminosarum bv. viciae 1 7e-30
163868098140 HIT family protein [Bartonella tribocorum CIP 105476] L 1 8e-30
319783681143 histidine triad (HIT) protein [Mesorhizobium ciceri bio 1 2e-29
>gi|315121997|ref|YP_004062486.1| histidine triad (HIT) protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 159 Back     alignment and organism information
 Score =  242 bits (617), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 112/148 (75%), Positives = 126/148 (85%)

Query: 1   MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIF 60
           M EKSS  YD+QNIFIKIIR E NACRVYEDD L+A+MDIMP +PGHVL+IPK R RDIF
Sbjct: 1   MVEKSSPQYDDQNIFIKIIRGEINACRVYEDDALIALMDIMPHSPGHVLVIPKCRARDIF 60

Query: 61  EAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNA 120
           E PPE+LSQI  ++KKIA ACK+AFQADGIQI+QFNG +AGQT+PHLHFHVIPCK+GDN 
Sbjct: 61  EVPPEVLSQIILVVKKIAKACKNAFQADGIQIMQFNGTSAGQTIPHLHFHVIPCKSGDNT 120

Query: 121 SHTNIHPTQKIENFAKLEINAQKIRKEL 148
            HTNIHPTQK E    L+ NAQKIRKEL
Sbjct: 121 LHTNIHPTQKTETLENLDFNAQKIRKEL 148


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|153009354|ref|YP_001370569.1| histidine triad (HIT) protein [Ochrobactrum anthropi ATCC 49188] Length = 140 Back     alignment and organism information
>gi|121602649|ref|YP_988889.1| histidine triad domain-containing protein [Bartonella bacilliformis KC583] Length = 140 Back     alignment and organism information
>gi|49474299|ref|YP_032341.1| Hit-like protein involved in cell-cycle regulation [Bartonella quintana str. Toulouse] Length = 140 Back     alignment and organism information
>gi|284055808|pdb|3LB5|A Chain A, Crystal Structure Of Hit-Like Protein Involved In Cell-Cycle Regulation From Bartonella Henselae With Unknown Ligand Length = 161 Back     alignment and organism information
>gi|49475407|ref|YP_033448.1| Hit-like protein involved in cell-cycle regulation [Bartonella henselae str. Houston-1] Length = 140 Back     alignment and organism information
>gi|239832055|ref|ZP_04680384.1| histidine triad (HIT) protein [Ochrobactrum intermedium LMG 3301] Length = 140 Back     alignment and organism information
>gi|116251971|ref|YP_767809.1| HIT family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 144 Back     alignment and organism information
>gi|163868098|ref|YP_001609302.1| HIT family protein [Bartonella tribocorum CIP 105476] Length = 140 Back     alignment and organism information
>gi|319783681|ref|YP_004143157.1| histidine triad (HIT) protein [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 143 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target155 histidine triad (HIT) protein [Candidatus Liberibacter
cd01277103 cd01277, HINT_subgroup, HINT (histidine triad nucleotid 2e-30
pfam0123098 pfam01230, HIT, HIT domain 8e-21
KOG3275127 KOG3275, KOG3275, KOG3275, Zinc-binding protein of the 1e-17
cd01276104 cd01276, PKCI_related, Protein Kinase C Interacting pro 4e-17
cd01275126 cd01275, FHIT, FHIT (fragile histidine family): FHIT pr 3e-14
cd0046886 cd00468, HIT_like, HIT family: HIT (Histidine triad) pr 2e-12
PRK10687119 PRK10687, PRK10687, purine nucleoside phosphoramidase; 9e-12
KOG3379150 KOG3379, KOG3379, KOG3379, Diadenosine polyphosphate hy 3e-11
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-te 2e-10
COG1085338 COG1085, GalT, Galactose-1-phosphate uridylyltransferas 3e-04
COG0537138 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrola 9e-32
>gnl|CDD|29590 cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|144720 pfam01230, HIT, HIT domain Back     alignment and domain information
>gnl|CDD|38485 KOG3275, KOG3275, KOG3275, Zinc-binding protein of the histidine triad (HIT) family [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|29589 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>gnl|CDD|29588 cd01275, FHIT, FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>gnl|CDD|29586 cd00468, HIT_like, HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|182648 PRK10687, PRK10687, purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>gnl|CDD|38589 KOG3379, KOG3379, KOG3379, Diadenosine polyphosphate hydrolase and related proteins of the histidine triad (HIT) family [Nucleotide transport and metabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|152404 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>gnl|CDD|31282 COG1085, GalT, Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30883 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 155 histidine triad (HIT) protein [Candidatus Liberibacter
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and oth 100.0
cd01275126 FHIT FHIT (fragile histidine family): FHIT proteins, re 100.0
KOG3379150 consensus 99.91
cd00608329 GalT Galactose-1-phosphate uridyl transferase (GalT): T 99.68
PRK11720339 galactose-1-phosphate uridylyltransferase; Provisional 99.66
pfam02744168 GalP_UDP_tr_C Galactose-1-phosphate uridyl transferase, 99.65
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [Energy 99.51
KOG2958354 consensus 98.97
TIGR00209367 galT_1 galactose-1-phosphate uridylyltransferase; Inter 97.09
PRK10687119 purine nucleoside phosphoramidase; Provisional 100.0
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-binding 100.0
cd01276104 PKCI_related Protein Kinase C Interacting protein relat 99.98
pfam0123098 HIT HIT domain. 99.97
pfam11969113 DcpS_C Scavenger mRNA decapping enzyme C-term binding. 99.96
cd01278104 aprataxin_related aprataxin related: Aprataxin, a HINT 99.95
KOG3275127 consensus 99.95
cd0046886 HIT_like HIT family: HIT (Histidine triad) proteins, na 99.94
KOG4359166 consensus 99.49
pfam04677122 CwfJ_C_1 Protein similar to CwfJ C-terminus 1. This reg 99.07
KOG2477628 consensus 98.02
KOG2476528 consensus 97.99
COG1085 338 GalT Galactose-1-phosphate uridylyltransferase [Energy 97.81
cd00608 329 GalT Galactose-1-phosphate uridyl transferase (GalT): T 97.73
PRK11720 339 galactose-1-phosphate uridylyltransferase; Provisional 97.58
KOG0562184 consensus 97.3
PRK05471252 CDP-diacylglycerol pyrophosphatase; Provisional 97.07
pfam02611249 CDH CDP-diacylglycerol pyrophosphatase. This is a famil 96.92
COG4360298 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphos 96.69
KOG3969310 consensus 95.98
KOG2720 431 consensus 95.23
COG2134252 Cdh CDP-diacylglycerol pyrophosphatase [Lipid metabolis 95.07
KOG2958 354 consensus 90.94
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>KOG3379 consensus Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>pfam02744 GalP_UDP_tr_C Galactose-1-phosphate uridyl transferase, C-terminal domain Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>KOG2958 consensus Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase; InterPro: IPR001937 Galactose-1-phosphate uridyl transferase 2 Back     alignment and domain information
>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>pfam01230 HIT HIT domain Back     alignment and domain information
>pfam11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>KOG3275 consensus Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>KOG4359 consensus Back     alignment and domain information
>pfam04677 CwfJ_C_1 Protein similar to CwfJ C-terminus 1 Back     alignment and domain information
>KOG2477 consensus Back     alignment and domain information
>KOG2476 consensus Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>KOG0562 consensus Back     alignment and domain information
>PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional Back     alignment and domain information
>pfam02611 CDH CDP-diacylglycerol pyrophosphatase Back     alignment and domain information
>COG4360 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphosphate phosphorylase II) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3969 consensus Back     alignment and domain information
>KOG2720 consensus Back     alignment and domain information
>COG2134 Cdh CDP-diacylglycerol pyrophosphatase [Lipid metabolism] Back     alignment and domain information
>KOG2958 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target155 histidine triad (HIT) protein [Candidatus Liberibacter
3imi_A147 2.01 Angstrom Resolution Crystal Structure Of A Hit 7e-29
3l7x_A173 The Crystal Structure Of Smu.412c From Streptococcu 1e-28
1y23_A145 Crystal Structure Of A Member Of Hit Family Of Prot 1e-28
3lb5_A161 Crystal Structure Of Hit-Like Protein Involved In C 1e-28
3o0m_A149 Crystal Structure Of A Zn-Bound Histidine Triad Fam 5e-25
3ksv_A149 Hypothetical Protein From Leishmania Major Length = 2e-24
2eo4_A149 Crystal Structure Of Hypothetical Histidine Triad N 2e-23
3p0t_A138 Crystal Structure Of An Hit-Like Protein From Mycob 3e-23
1ems_A440 Crystal Structure Of The C. Elegans Nitfhit Protein 6e-14
3r6f_A135 Crystal Structure Of A Zinc-Containing Hit Family P 3e-13
1fhi_A147 Substrate Analog (Ib2) Complex With The Fragile His 3e-12
3fit_A147 Fhit (Fragile Histidine Triad Protein) In Complex W 4e-12
2fhi_A147 Substrate Analog (Ib2) Complex With The His 96 Asn 3e-11
2oik_A154 Crystal Structure Of A Histidine Triad (Hit) Protei 3e-09
3ohe_A137 Crystal Structure Of A Histidine Triad Protein (Maq 1e-05
3i4s_A149 Crystal Structure Of Histidine Triad Protein Blr812 0.001
1xqu_A147 Hit Family Hydrolase From Clostridium Thermocellum 8e-19
3oj7_A117 Crystal Structure Of A Histidine Triad Family Prote 1e-18
3rhn_A115 Histidine Triad Nucleotide-Binding Protein (Hint) F 2e-17
1rzy_A126 Crystal Structure Of Rabbit Hint Complexed With N- 2e-17
1kpb_A125 Pkci-Substrate Analog Length = 125 2e-17
1kpa_A126 Pkci-1-Zinc Length = 126 2e-17
3o1x_A126 High Resolution Crystal Structure Of Histidine Tria 4e-17
3o1c_A126 High Resolution Crystal Structure Of Histidine Tria 4e-17
3o1z_A126 High Resolution Crystal Structure Of Histidine Tria 7e-17
3n1s_A119 Crystal Structure Of Wild Type Echint Gmp Complex L 5e-15
3n1t_A119 Crystal Structure Of The H101a Mutant Echint Gmp Co 2e-14
3nrd_A135 Crystal Structure Of A Histidine Triad (Hit) Protei 0.002
>gi|256032937|pdb|3IMI|A Chain A, 2.01 Angstrom Resolution Crystal Structure Of A Hit Family Protein From Bacillus Anthracis Str. 'ames Ancestor' Length = 147 Back     alignment and structure
 Score =  130 bits (326), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 52/142 (36%), Positives = 70/142 (49%)

Query: 8   HYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEIL 67
           H  +  IF KII  +    +VYED+ +LA +DI     GH L+IPK   +DIF   PEI 
Sbjct: 6   HTADNCIFCKIIDGQILCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTPEIA 65

Query: 68  SQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHP 127
           S I  ++ KIA A K+ F   G  +L  NG  AGQTV H H H+IP    ++        
Sbjct: 66  SHIFSVVPKIANAIKAEFNPVGFNLLNNNGEKAGQTVFHFHLHLIPRYGENDGFGAVWKS 125

Query: 128 TQKIENFAKLEINAQKIRKELQ 149
            Q       L+  A  I   ++
Sbjct: 126 HQNEYTXENLQNIASTIANSVK 147


>gi|313754268|pdb|3L7X|A Chain A, The Crystal Structure Of Smu.412c From Streptococcus Mutans Ua159 Length = 173 Back     alignment and structure
gi|60594506|pdb|1Y23|A Chain A, Crystal Structure Of A Member Of Hit Family Of Proteins From Bacillus Subtilis Length = 145 Back     alignment and structure
>gi|284055808|pdb|3LB5|A Chain A, Crystal Structure Of Hit-Like Protein Involved In Cell-Cycle Regulation From Bartonella Henselae With Unknown Ligand Length = 161 Back     alignment and structure
>gi|302148927|pdb|3O0M|A Chain A, Crystal Structure Of A Zn-Bound Histidine Triad Family Protein From Mycobacterium Smegmatis Length = 149 Back     alignment and structure
>gi|283807226|pdb|3KSV|A Chain A, Hypothetical Protein From Leishmania Major Length = 149 Back     alignment and structure
>gi|158428568|pdb|2EO4|A Chain A, Crystal Structure Of Hypothetical Histidine Triad Nucleotide-Binding Protein St2152 From Sulfolobus Tokodaii Strain7 Length = 149 Back     alignment and structure
>gi|313754475|pdb|3P0T|A Chain A, Crystal Structure Of An Hit-Like Protein From Mycobacterium Paratuberculosis Length = 138 Back     alignment and structure
gi|9955180|pdb|1EMS|A Chain A, Crystal Structure Of The C. Elegans Nitfhit Protein Length = 440 Back     alignment and structure
>gi|327200761|pdb|3R6F|A Chain A, Crystal Structure Of A Zinc-Containing Hit Family Protein From Encephalitozoon Cuniculi Length = 135 Back     alignment and structure
gi|157831075|pdb|1FHI|A Chain A, Substrate Analog (Ib2) Complex With The Fragile Histidine Triad Protein, Fhit Length = 147 Back     alignment and structure
>gi|2781315|pdb|3FIT|A Chain A, Fhit (Fragile Histidine Triad Protein) In Complex With AdenosineSULFATE AMP ANALOG Length = 147 Back     alignment and structure
>gi|157834961|pdb|2FHI|A Chain A, Substrate Analog (Ib2) Complex With The His 96 Asn Substitution Of The Fragile Histidine Triad Protein, Fhit Length = 147 Back     alignment and structure
>gi|126031601|pdb|2OIK|A Chain A, Crystal Structure Of A Histidine Triad (Hit) Protein (Mfla_2506) From Methylobacillus Flagellatus Kt At 1.65 A Resolution Length = 154 Back     alignment and structure
>gi|306440717|pdb|3OHE|A Chain A, Crystal Structure Of A Histidine Triad Protein (Maqu_1709) From Marinobacter Aquaeolei Vt8 At 1.20 A Resolution Length = 137 Back     alignment and structure
>gi|254221177|pdb|3I4S|A Chain A, Crystal Structure Of Histidine Triad Protein Blr8122 From Bradyrhizobium Japonicum Length = 149 Back     alignment and structure
>gi|58177558|pdb|1XQU|A Chain A, Hit Family Hydrolase From Clostridium Thermocellum Cth-393 Length = 147 Back     alignment and structure
>gi|306440728|pdb|3OJ7|A Chain A, Crystal Structure Of A Histidine Triad Family Protein From Entamoeba Histolytica, Bound To Sulfate Length = 117 Back     alignment and structure
>gi|157836884|pdb|3RHN|A Chain A, Histidine Triad Nucleotide-Binding Protein (Hint) From Rabbit Complexed With Gmp Length = 115 Back     alignment and structure
gi|47168922|pdb|1RZY|A Chain A, Crystal Structure Of Rabbit Hint Complexed With N- Ethylsulfamoyladenosine Length = 126 Back     alignment and structure
>gi|157878705|pdb|1KPB|A Chain A, Pkci-1-Apo Length = 125 Back     alignment and structure
>gi|227968190|pdb|1KPA|A Chain A, Pkci-1-Zinc Length = 126 Back     alignment and structure
>gi|302148930|pdb|3O1X|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C84a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>gi|302148929|pdb|3O1C|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C38a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>gi|302148931|pdb|3O1Z|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) Double Cysteine Mutant From Rabbit Length = 126 Back     alignment and structure
gi|309319962|pdb|3N1S|A Chain A, Crystal Structure Of Wild Type Echint Gmp Complex Length = 119 Back     alignment and structure
>gi|309319970|pdb|3N1T|A Chain A, Crystal Structure Of The H101a Mutant Echint Gmp Complex Length = 119 Back     alignment and structure
>gi|301598788|pdb|3NRD|A Chain A, Crystal Structure Of A Histidine Triad (Hit) Protein (Smc02904) From Sinorhizobium Meliloti 1021 At 2.06 A Resolution Length = 135 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target155 histidine triad (HIT) protein [Candidatus Liberibacter
3lb5_A161 HIT-like protein involved in cell-cycle regulation; nia 6e-32
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protein; WO 3e-29
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emera 1e-25
3ksv_A149 Uncharacterized protein; HIT family, structural genomic 5e-25
3imi_A147 HIT family protein; structural genomics, infectious dis 1e-24
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine tria 4e-24
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, cell 2e-23
2eo4_A149 150AA long hypothetical histidine triad nucleotide-bind 5e-20
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, prote 7e-18
2oik_A154 Histidine triad (HIT) protein; YP_546612.1, structural 7e-16
1kpf_A126 Protein kinase C interacting protein; protein kinase in 2e-24
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide bindi 4e-24
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydrolase 6e-24
3oj7_A117 Putative histidine triad family protein; hydrolase, str 8e-23
1xqu_A147 HIT family hydrolase; protein structure initiative, PSI 2e-21
1z84_A351 Galactose-1-phosphate uridyl transferase-like protein; 1e-14
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleotidylt 5e-13
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand complex, c 7e-05
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, HIT su 1e-17
3nrd_A135 Histidine triad (HIT) protein; structural genomics, joi 4e-17
3ohe_A137 Histidine triad (HIT) protein; structural genomics, joi 2e-14
>3lb5_A HIT-like protein involved in cell-cycle regulation; niaid, seattle structural genomics center for infectious disease, ssgcid; 1.90A {Bartonella henselae} Length = 161 Back     alignment and structure
 Score =  131 bits (331), Expect = 6e-32
 Identities = 70/140 (50%), Positives = 88/140 (62%), Gaps = 4/140 (2%)

Query: 9   YDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILS 68
           YDN NIF K+IRNE  + RVYEDD ++A MDIMP+ PGH L+IPK   R++ +A  E L 
Sbjct: 26  YDNNNIFAKLIRNEIPSVRVYEDDDVIAFMDIMPQAPGHTLVIPKKGSRNLLDADTETLF 85

Query: 69  QIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPT 128
            +   ++KIA A K AFQADGI ++QFN  A+ QTV HLHFH+IP   G   +       
Sbjct: 86  PVIKAVQKIAKAVKKAFQADGITVMQFNEAASQQTVYHLHFHIIPRMEGIELT----PHN 141

Query: 129 QKIENFAKLEINAQKIRKEL 148
             I     LE NA+KIR  L
Sbjct: 142 NIITPTEILEENAKKIRAAL 161


>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Length = 440 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 1.90A {Leishmania major} Length = 149 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases, center for structural genomics of infectious diseases, unknown function; 2.01A {Bacillus anthracis str} Length = 147 Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Length = 147 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotide-binding protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Length = 149 Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; YP_546612.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus KT} SCOP: d.13.1.1 Length = 154 Back     alignment and structure
>1kpf_A Protein kinase C interacting protein; protein kinase inhibitor, PKCI-1, HIT protein family, histidine triad protein family, nucleotidyl hydrolase; HET: AMP; 1.50A {Homo sapiens} SCOP: d.13.1.1 PDB: 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 1kpe_B* 1kpb_A* 1rzy_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3o1z_A 3o1x_A* 1kpe_B* 1kpb_A* 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* Length = 117 Back     alignment and structure
>1xqu_A HIT family hydrolase; protein structure initiative, PSI, southeast collaboratory for structural genomics, secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Length = 351 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Length = 348 Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Length = 301 Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Length = 149 Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Length = 135 Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 1.20A {Marinobacter aquaeolei} Length = 137 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target155 histidine triad (HIT) protein [Candidatus Liberibacter
3lb5_A161 HIT-like protein involved in cell-cycle regulation; nia 100.0
3imi_A147 HIT family protein; structural genomics, infectious dis 100.0
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, cell 100.0
3ksv_A149 Uncharacterized protein; HIT family, structural genomic 100.0
2eo4_A149 150AA long hypothetical histidine triad nucleotide-bind 100.0
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emera 100.0
2oik_A154 Histidine triad (HIT) protein; YP_546612.1, structural 100.0
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protein; WO 99.98
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine tria 99.97
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, HIT su 99.93
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, prote 99.93
3ohe_A137 Histidine triad (HIT) protein; structural genomics, joi 99.93
3nrd_A135 Histidine triad (HIT) protein; structural genomics, joi 99.92
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleotidylt 99.9
1z84_A351 Galactose-1-phosphate uridyl transferase-like protein; 99.86
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydrolase 100.0
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide bindi 100.0
3oj7_A117 Putative histidine triad family protein; hydrolase, str 100.0
1xqu_A147 HIT family hydrolase; protein structure initiative, PSI 100.0
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand complex, c 98.77
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomics, J 98.17
1z84_A 351 Galactose-1-phosphate uridyl transferase-like protein; 98.09
1gup_A 348 Galactose-1-phosphate uridylyltransferase; nucleotidylt 98.03
2pof_A227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, 96.97
>3lb5_A HIT-like protein involved in cell-cycle regulation; niaid, seattle structural genomics center for infectious disease, ssgcid; 1.90A {Bartonella henselae} Back     alignment and structure
Probab=100.00  E-value=2.9e-42  Score=283.53  Aligned_cols=142  Identities=49%  Similarity=0.724  Sum_probs=132.1

Q ss_pred             CCCCCCCCCCCHHHHHHCCCCCCCEEEECCEEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             76656658976545444688873178778909999417888982299994155421344027888989999997304455
Q gi|254780780|r    3 EKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACK   82 (155)
Q Consensus         3 ~~s~~~~dd~CiFC~Ii~ge~p~~~v~E~d~~~afld~~P~~~GH~lViPk~H~~~l~dL~~~~~~~l~~~~~~v~~al~   82 (155)
                      +..+.+|||+|+||+|++|++|+++|||||.++||+|++|.+|||+|||||+|+.++.+|+++++.+++.++++++++++
T Consensus        20 ~~~~~~~d~~CiFC~Ii~ge~p~~ivyEde~~~afld~~P~~~GH~LViPk~H~~~l~~l~~~~~~~l~~~~~~v~~al~   99 (161)
T 3lb5_A           20 GSMKQAYDNNNIFAKLIRNEIPSVRVYEDDDVIAFMDIMPQAPGHTLVIPKKGSRNLLDADTETLFPVIKAVQKIAKAVK   99 (161)
T ss_dssp             -----CCCTTSHHHHHHTTSSCCCEEEECSSEEEEECSSCSSTTCEEEEESSCCSSTTTSCHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHCCCCCCCEEEECCCEEEEECCCCCCCEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             63210259989266646488888879879979999788889985699997447666000057888999999999999998


Q ss_pred             HHCCCCCEEEEEECCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             313526669998257566863101069999523799765345577666889899999999999999
Q gi|254780780|r   83 SAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKEL  148 (155)
Q Consensus        83 ~~~~~~~~ni~~~~g~~~gq~V~HlH~HiiPR~~~d~~~~~~~~~~~~~~~~~~l~~~a~~lr~~l  148 (155)
                      +.++++|+|+++|+|+.+||+|+|+|+|||||+++|++++    ......+.+++++.++|||++|
T Consensus       100 ~~~~~~~~ni~~~~g~~agq~v~HlHiHiIPR~~gd~l~~----~~~~~~~~e~le~~a~kiR~aL  161 (161)
T 3lb5_A          100 KAFQADGITVMQFNEAASQQTVYHLHFHIIPRMEGIELTP----HNNIITPTEILEENAKKIRAAL  161 (161)
T ss_dssp             HHHTCSEEEEEEEESGGGTCCSCSCCEEEEEECTTCCC----------CCCHHHHHHHHHHHHHHC
T ss_pred             HHCCCCCCEEEECCCCCCCEEEEEEEEEEECCCCCCCCCC----CCCCCCCHHHHHHHHHHHHHCC
T ss_conf             6046688779855767787425289999989878998887----7874489899999999999619



>3imi_A HIT family protein; structural genomics, infectious diseases, center for structural genomics of infectious diseases, unknown function; 2.01A {Bacillus anthracis str} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 1.90A {Leishmania major} Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotide-binding protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; YP_546612.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus KT} SCOP: d.13.1.1 Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3o1z_A 3o1x_A* 1kpe_B* 1kpb_A* 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* Back     alignment and structure
>1xqu_A HIT family hydrolase; protein structure initiative, PSI, southeast collaboratory for structural genomics, secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis, structural genomics; 1.40A {Escherichia coli O157} SCOP: d.13.1.4 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 155 histidine triad (HIT) protein [Candidatus Liberibacter
d1y23a_139 d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Len 2e-21
d1emsa1160 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-termina 1e-17
d1fita_146 d.13.1.1 (A:) FHIT (fragile histidine triad protein) {H 2e-17
d2oika1139 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Me 2e-14
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Hum 2e-21
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium thermocel 3e-18
d1guqa2171 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltran 2e-12
d1z84a2156 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltran 2e-11
d1vlra1192 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-termi 4e-05
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Length = 139 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Hit
species: Bacillus subtilis [TaxId: 1423]
 Score = 95.0 bits (235), Expect = 2e-21
 Identities = 45/135 (33%), Positives = 66/135 (48%)

Query: 14  IFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFL 73
           IF KII  +  + +VYED+ +LA +DI     GH L+IPK+ I +++E   E+  Q    
Sbjct: 4   IFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPKTHIENVYEFTDELAKQYFHA 63

Query: 74  IKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIEN 133
           + KIA A +  F+  G+  L  NG  AGQ+V H H H+IP     +              
Sbjct: 64  VPKIARAIRDEFEPIGLNTLNNNGEKAGQSVFHYHMHIIPRYGKGDGFGAVWKTHADDYK 123

Query: 134 FAKLEINAQKIRKEL 148
              L+  +  I K L
Sbjct: 124 PEDLQNISSSIAKRL 138


>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Length = 139 Back     information, alignment and structure
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 156 Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 192 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target155 histidine triad (HIT) protein [Candidatus Liberibacter
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 100.0
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nematode (C 100.0
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus flage 100.0
d1fita_146 FHIT (fragile histidine triad protein) {Human (Homo sap 99.97
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale cress 99.94
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escherichia 99.93
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapie 100.0
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxId: 15 99.98
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mu 99.17
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale cress 98.03
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escherichia 97.9
d2pofa1220 CDP-diacylglycerol pyrophosphatase CDH {Escherichia col 97.41
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Hit
species: Bacillus subtilis [TaxId: 1423]
Probab=100.00  E-value=6.6e-41  Score=273.52  Aligned_cols=138  Identities=33%  Similarity=0.487  Sum_probs=127.4

Q ss_pred             CCCHHHHHHCCCCCCCEEEECCEEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             97654544468887317877890999941788898229999415542134402788898999999730445531352666
Q gi|254780780|r   11 NQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGI   90 (155)
Q Consensus        11 d~CiFC~Ii~ge~p~~~v~E~d~~~afld~~P~~~GH~lViPk~H~~~l~dL~~~~~~~l~~~~~~v~~al~~~~~~~~~   90 (155)
                      |+|+||+|++||+|+.+|||||.++||+|++|.+|||+||+||+|+.++.+|+++++.+++.+++++++++++.++++|+
T Consensus         1 e~CiFC~I~~~e~p~~~i~ede~~~af~d~~P~~~GH~LViPk~H~~~~~dL~~~~~~~l~~~~~~~~~~l~~~~~~~g~   80 (139)
T d1y23a_           1 ENCIFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPKTHIENVYEFTDELAKQYFHAVPKIARAIRDEFEPIGL   80 (139)
T ss_dssp             CCCHHHHHHHTSSCCCEEEECSSEEEEECTTCSSTTCEEEEESSCCSSGGGCCHHHHHTTTTHHHHHHHHHHHHHCCSEE
T ss_pred             CCCCCCCCCCCCCCCCEEEECCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             91803755268987567987797899866888998579999721324521110478888999999988887640156774


Q ss_pred             EEEEECCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             9998257566863101069999523799765345577666889899999999999999
Q gi|254780780|r   91 QILQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKEL  148 (155)
Q Consensus        91 ni~~~~g~~~gq~V~HlH~HiiPR~~~d~~~~~~~~~~~~~~~~~~l~~~a~~lr~~l  148 (155)
                      |+++|+|+.+||+|||+|+|||||++++......++......+.+++++++++||++|
T Consensus        81 ~i~~n~g~~agq~v~H~H~HviPR~~~~~~~~~~~~~~~~~~~~e~~~~~~~~i~~~L  138 (139)
T d1y23a_          81 NTLNNNGEKAGQSVFHYHMHIIPRYGKGDGFGAVWKTHADDYKPEDLQNISSSIAKRL  138 (139)
T ss_dssp             EEEEEESGGGTCCSSSCCEEEEEECSTTCSEEEEECCCGGGSCHHHHHHHHHHHHHHT
T ss_pred             EEEECCCCCCCEECCEEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             8986777430574478999997243289886535666778789999999999999960



>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 155 histidine triad (HIT) protein [Candidatus Liberiba
1z84_A_351 (A:) Galactose-1-phosphate uridyl transferase-like 7e-25
3imi_A_1-122122 (A:1-122) HIT family protein; structural genomics, 1e-24
3lb5_A_161 (A:) HIT-like protein involved in cell-cycle regul 2e-24
2eo4_A_149 (A:) 150AA long hypothetical histidine triad nucle 6e-24
1kpf_A_126 (A:) Protein kinase C interacting protein; protein 6e-24
3ksv_A_1-123123 (A:1-123) Uncharacterized protein; HIT family, str 1e-23
1y23_A_1-118118 (A:1-118) HIT, histidine triad protein; HIT protei 1e-23
1ems_A_286-440155 (A:286-440) Nitfhit, NIT-fragIle histidine triad f 3e-23
1fit_A_147 (A:) FragIle histidine protein; FHIT, fragIle hist 1e-22
1xqu_A_147 (A:) HIT family hydrolase; protein structure initi 9e-22
2oik_A_154 (A:) Histidine triad (HIT) protein; YP_546612.1, s 1e-20
3i4s_A_149 (A:) Histidine triad protein; hydrolase, phosphata 1e-19
3i24_A_149 (A:) HIT family hydrolase; structural genomics, PS 1e-17
1vlr_A_183-322140 (A:183-322) MRNA decapping enzyme; 16740816, struc 3e-16
1gup_A_348 (A:) Galactose-1-phosphate uridylyltransferase; nu 3e-16
3bl9_A_136-275140 (A:136-275) Scavenger mRNA-decapping enzyme DCPS; 4e-16
>1z84_A (A:) Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana}Length = 351 Back     alignment and structure
 Score =  107 bits (268), Expect = 7e-25
 Identities = 17/152 (11%), Positives = 38/152 (25%), Gaps = 7/152 (4%)

Query: 1   MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIF 60
            +   +  Y  +     +   ++    + E    +++       P  + IIPK       
Sbjct: 201 SRLDGTKDYFEETGKCCLCEAKSKHFVIDESSHFVSVAPFAATYPFEIWIIPKDHSSHFH 260

Query: 61  EAPPEILSQIAFLIKKIAIACKSAFQAD----GIQILQFNGHAAGQTVPHLHFHVIPCKN 116
                    +  L+K +                I         +     H    ++P  +
Sbjct: 261 HLDDVKAVDLGGLLKLMLQKIAKQLNDPPYNYMIHTSPLKVTESQLPYTHWFLQIVPQLS 320

Query: 117 GDNASHTNIHPTQKIENFAKLEINAQKIRKEL 148
           G               N    E  A+ +R+  
Sbjct: 321 GVGGFEIGTGCYI---NPVFPEDVAKVMREVS 349


>3imi_A (A:1-122) HIT family protein; structural genomics, infectious diseases, center for structural genomics of infectious diseases, unknown function; 2.01A {Bacillus anthracis str}Length = 122 Back     alignment and structure
>3lb5_A (A:) HIT-like protein involved in cell-cycle regulation; niaid, seattle structural genomics center for infectious disease, ssgcid; 1.90A {Bartonella henselae}Length = 161 Back     alignment and structure
>2eo4_A (A:) 150AA long hypothetical histidine triad nucleotide-binding protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii}Length = 149 Back     alignment and structure
>1kpf_A (A:) Protein kinase C interacting protein; protein kinase inhibitor, PKCI-1, HIT protein family, histidine triad protein family, nucleotidyl hydrolase; HET: AMP; 1.50A {Homo sapiens}Length = 126 Back     alignment and structure
>3ksv_A (A:1-123) Uncharacterized protein; HIT family, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 1.90A {Leishmania major}Length = 123 Back     alignment and structure
>1y23_A (A:1-118) HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis}Length = 118 Back     alignment and structure
>1ems_A (A:286-440) Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans}Length = 155 Back     alignment and structure
>1fit_A (A:) FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens}Length = 147 Back     alignment and structure
>1xqu_A (A:) HIT family hydrolase; protein structure initiative, PSI, southeast collaboratory for structural genomics, secsg; 2.30A {Clostridium thermocellum}Length = 147 Back     alignment and structure
>2oik_A (A:) Histidine triad (HIT) protein; YP_546612.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus KT}Length = 154 Back     alignment and structure
>3i4s_A (A:) Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum}Length = 149 Back     alignment and structure
>3i24_A (A:) HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114}Length = 149 Back     alignment and structure
>1vlr_A (A:183-322) MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus}Length = 140 Back     alignment and structure
>1gup_A (A:) Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli}Length = 348 Back     alignment and structure
>3bl9_A (A:136-275) Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens}Length = 140 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target155 histidine triad (HIT) protein [Candidatus Liberibacter
2eo4_A_149 150AA long hypothetical histidine triad nucleotide 100.0
3lb5_A_161 HIT-like protein involved in cell-cycle regulation 100.0
1ems_A_286-440155 Nitfhit, NIT-fragIle histidine triad fusion protei 100.0
3i4s_A_149 Histidine triad protein; hydrolase, phosphatase, H 100.0
2oik_A_154 Histidine triad (HIT) protein; YP_546612.1, struct 100.0
1fit_A_147 FragIle histidine protein; FHIT, fragIle histidine 99.97
3i24_A_149 HIT family hydrolase; structural genomics, PSI-2, 99.96
1gup_A_348 Galactose-1-phosphate uridylyltransferase; nucleot 99.95
1z84_A_351 Galactose-1-phosphate uridyl transferase-like prot 99.92
3ksv_A_1-123123 Uncharacterized protein; HIT family, structural ge 99.98
3imi_A_1-122122 HIT family protein; structural genomics, infectiou 99.97
1xqu_A_147 HIT family hydrolase; protein structure initiative 99.97
1y23_A_1-118118 HIT, histidine triad protein; HIT protein, PKCI-1, 99.97
1kpf_A_126 Protein kinase C interacting protein; protein kina 99.96
1vlr_A_183-322140 MRNA decapping enzyme; 16740816, structural genomi 99.9
3bl9_A_136-275140 Scavenger mRNA-decapping enzyme DCPS; ligand compl 99.9
1z84_A_ 351 Galactose-1-phosphate uridyl transferase-like prot 98.21
1gup_A_ 348 Galactose-1-phosphate uridylyltransferase; nucleot 97.91
2pof_A_227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 96.91
>2eo4_A (A:) 150AA long hypothetical histidine triad nucleotide-binding protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
Probab=100.00  E-value=8.9e-35  Score=237.73  Aligned_cols=142  Identities=32%  Similarity=0.527  Sum_probs=137.0

Q ss_pred             CHHHHHHCCCCCCCEEEECCEEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             65454446888731787789099994178889822999941554213440278889899999973044553135266699
Q gi|254780780|r   13 NIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQI   92 (155)
Q Consensus        13 CiFC~Ii~ge~p~~~v~E~d~~~afld~~P~~~GH~lViPk~H~~~l~dL~~~~~~~l~~~~~~v~~al~~~~~~~~~ni   92 (155)
                      |+||+|++++.|+++||||+.++||+|++|..|||+||+||+|++++.||+++++.+++.+++++++++++.++++++|+
T Consensus         1 C~fC~i~~~~~~~~~v~e~~~~~~~~~~~p~~~gh~lvipk~H~~~~~~L~~~e~~~l~~~~~~~~~~l~~~~~~~~~~~   80 (149)
T 2eo4_A            1 CTFCSIINRELEGYFVYEDEKFAAILDKYPVSLGHTLVIPKKHFENYLEADEDTLAELAKVVKLVSLGIKDAVKADGLRL   80 (149)
T ss_dssp             CHHHHHHTTSSCCCEEEECSSEEEEECSSCSSTTCEEEEESSCCSSGGGSCHHHHHHHHHHHHHHHHHHHHHTTCSEEEE
T ss_pred             CCCCCCCCCCCCCCEEEECCCEEEEECCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             97782627988768898799499998368999857999971132317766566999999999999887664157516889


Q ss_pred             EEECCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98257566863101069999523799765345577666889899999999999999998840
Q gi|254780780|r   93 LQFNGHAAGQTVPHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKELQNFLKT  154 (155)
Q Consensus        93 ~~~~g~~~gq~V~HlH~HiiPR~~~d~~~~~~~~~~~~~~~~~~l~~~a~~lr~~l~~~l~~  154 (155)
                      ++|.|+.+||+|+|+|+|||||+++|.....+.+......+.+.+++++++||++|+.+..+
T Consensus        81 ~~~~~~~~g~~v~HlH~HiiPr~~~d~~~~~~~~~~~~~~~~~~~~~~~~~lr~~l~~~~~~  142 (149)
T 2eo4_A           81 LTNIGRSAGQVIFHLHVHIIPTWEGDYPDIFKSFKPRKEQEKEYYELLQKIIRESIENLKRK  142 (149)
T ss_dssp             ECCCSGGGTCCSCSCCEEEEEECSSCCCTTSCCCCTTSCCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98425555866777899995465798875112356567781999999999999999999998



>3lb5_A (A:) HIT-like protein involved in cell-cycle regulation; niaid, seattle structural genomics center for infectious disease, ssgcid; 1.90A {Bartonella henselae} Back     alignment and structure
>1ems_A (A:286-440) Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} Back     alignment and structure
>3i4s_A (A:) Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>2oik_A (A:) Histidine triad (HIT) protein; YP_546612.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus KT} Back     alignment and structure
>1fit_A (A:) FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} Back     alignment and structure
>3i24_A (A:) HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>1gup_A (A:) Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} Back     alignment and structure
>1z84_A (A:) Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} Back     alignment and structure
>3ksv_A (A:1-123) Uncharacterized protein; HIT family, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 1.90A {Leishmania major} Back     alignment and structure
>3imi_A (A:1-122) HIT family protein; structural genomics, infectious diseases, center for structural genomics of infectious diseases, unknown function; 2.01A {Bacillus anthracis str} Back     alignment and structure
>1xqu_A (A:) HIT family hydrolase; protein structure initiative, PSI, southeast collaboratory for structural genomics, secsg; 2.30A {Clostridium thermocellum} Back     alignment and structure
>1y23_A (A:1-118) HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} Back     alignment and structure
>1kpf_A (A:) Protein kinase C interacting protein; protein kinase inhibitor, PKCI-1, HIT protein family, histidine triad protein family, nucleotidyl hydrolase; HET: AMP; 1.50A {Homo sapiens} Back     alignment and structure
>1vlr_A (A:183-322) MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} Back     alignment and structure
>3bl9_A (A:136-275) Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} Back     alignment and structure
>1z84_A (A:) Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} Back     alignment and structure
>1gup_A (A:) Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} Back     alignment and structure
>2pof_A (A:) CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis, structural genomics; 1.40A {Escherichia coli O157} Back     alignment and structure