254780781

254780781

2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase

GeneID in NCBI database:8209787Locus tag:CLIBASIA_03360
Protein GI in NCBI database:254780781Protein Accession:YP_003065194.1
Gene range:-(481651, 482508)Protein Length:285aa
Gene description:2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
COG prediction:[E] Tetrahydrodipicolinate N-succinyltransferase
KEGG prediction:dapD; 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (EC:2.3.1.117); K00674 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC:2.3.1.117]
SEED prediction:2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Subsystem involved in SEED:Lysine Biosynthesis DAP Pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS
ccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEEEEEcEEEEEEEccccEEEcccccccccccccHHHcccccHHHEEEccEEEccccEEccccEEccccEEEccEEccccEEccccEEccccEEcccEEEccccEEccccEEEEccccccccccEEccccEEccccEEEccEEEccccEEccccEEccccEEEEEccccEEEEEcccccEEEccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccEEEEEEccccEEEEcHHHHHHHHHHHHHcccEEEccccccccEEEcccEccccccHHHHHHHccEEccccEEEcccEEccccEEccEEEccccEEccccEEcccEEEccccEEccccEEccccEEcccEccEcccccEEccccEEccccEEccccEEccccEEccccEEcccccEEEcccccEEccEEcccEEEEEEEEEcEEEEccccccEEEEEEEEEEccHHHHHHHcccHHHcccc
MITIVSTLEEIIDSFFeesnsknesipqDVKDAVQSTLDLLDRGIiriasrddnghwntHQWIKKAILLSFqinptkiisdgngystwwdkipakfddwktkdfekhnfriipgtivrhsayigpkavlmpsFVNMGAyigegsmidtwstvgscaqigknvhisggvgiggvlepiqtgptiiedncfigARSEIVEGCIIREGSVLGMGVFIGKStkiidrntgeitygevpsysvvvpgsypsinlkgdiagpHLYCAVIIKKVdektrsktSINTLLRDYS
MITIVSTLEEIIDSFFEesnsknesipqdVKDAVQSTLDLLDRGIIRiasrddnghwnTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNtgeitygevpsysVVVPGSYPSINLKGDIAGPHLYCAVIIkkvdektrsktsintllrdys
MITIVSTLEEIIDsffeesnsknesIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHisggvgiggvLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITygevpsysvvvpgsypsINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS
******T**EIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSIN**GDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD**
MITIVSTLEEIIDSFFEE**********DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS
MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR*YS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS
MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS
MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target285 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr
254780942442 UDP-N-acetylglucosamine pyrophosphorylase protein 0.001
255764481271 UDP-N-acetylglucosamine acyltransferase [Candidatu 0.016
>gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 442 Back     alignment
 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 138 AYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIV 197
           A I EGS I+  S VG    +GKNV+I  G  I    +      T I +N FIG+ S ++
Sbjct: 338 ATIKEGSKINHLSYVGDSV-VGKNVNIGAGT-ITCNYDGTHKYKTHINENAFIGSNSSLI 395

Query: 198 EGCIIREGSVLGMGVFIGKST 218
               I +G+ +  G  I + T
Sbjct: 396 APITIGQGTYVASGSIITQDT 416

>gi|255764481|ref|YP_003065182.2| UDP-N-acetylglucosamine acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Back     alignment
 Score = 31.6 bits (70), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 12/114 (10%)

Query: 123 IGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVH------ISGGVGIGGVLE 175
           +G   ++ P + V  GA IG  S+I  +  VGS  +IG  V       ++G   IG   +
Sbjct: 4   MGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTK 63

Query: 176 ----PIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMG-VFIGKSTKIIDRN 224
                +  G T  + + F+G    + + C+IREG  +  G V  G  T + D N
Sbjct: 64  VFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNN 117

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target285 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr
315121998286 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr 1 1e-123
239832651284 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyl 1 1e-111
153008685284 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr 1 1e-111
306840610284 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyl 1 1e-111
206582134304 Chain A, Crystal Structure Of 2,3,4,5-Tetrahydropyridin 1 1e-111
225629477315 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyl 1 1e-111
256058812284 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr 1 1e-110
306846230284 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyl 1 1e-110
17988614284 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr 1 1e-110
225686783284 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr 1 1e-110
>gi|315121998|ref|YP_004062487.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 286 Back     alignment and organism information
 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/281 (80%), Positives = 248/281 (88%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           V+TLE+IIDS F   +SKN S  ++VKDAVQSTL+LLD G IR+AS D +G W TH+WIK
Sbjct: 6   VTTLEKIIDSHFNRFDSKNSSFSKEVKDAVQSTLNLLDNGSIRVASCDSDGRWITHKWIK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KAILLSFQINPT+IIS GNG+S WWDKIPAKF  W  KDFEKHN R IPG I+RHSAYI 
Sbjct: 66  KAILLSFQINPTQIISGGNGHSIWWDKIPAKFAKWTKKDFEKHNLRTIPGAIIRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P+ VLMPSFVN+GAYI EG+M+DTWST+GSCAQIGKNVHISGGVGIGGVLEPIQTGPTII
Sbjct: 126 PRTVLMPSFVNIGAYIDEGTMVDTWSTIGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDR+TG ITYGEVP YSVVVPGSY
Sbjct: 186 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRSTGTITYGEVPPYSVVVPGSY 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285
           P  +LK +   P+LYCAVIIKKVDEKTRSKTSINTLLRDYS
Sbjct: 246 PGKDLKNNTVAPNLYCAVIIKKVDEKTRSKTSINTLLRDYS 286


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|239832651|ref|ZP_04680980.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [Ochrobactrum intermedium LMG 3301] Length = 284 Back     alignment and organism information
>gi|153008685|ref|YP_001369900.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase [Ochrobactrum anthropi ATCC 49188] Length = 284 Back     alignment and organism information
>gi|306840610|ref|ZP_07473363.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [Brucella sp. BO2] Length = 284 Back     alignment and organism information
>gi|206582134|pdb|3EG4|A Chain A, Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- Carboxylate N-Succinyltransferase From Brucella Melitensis Biovar Abortus 2308 Length = 304 Back     alignment and organism information
>gi|225629477|ref|ZP_03787510.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [Brucella ceti str. Cudo] Length = 315 Back     alignment and organism information
>gi|256058812|ref|ZP_05449028.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase [Brucella neotomae 5K33] Length = 284 Back     alignment and organism information
>gi|306846230|ref|ZP_07478792.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [Brucella sp. BO1] Length = 284 Back     alignment and organism information
>gi|17988614|ref|NP_541247.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase [Brucella melitensis bv. 1 str. 16M] Length = 284 Back     alignment and organism information
>gi|225686783|ref|YP_002734755.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase [Brucella melitensis ATCC 23457] Length = 284 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target285 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr
PRK11830272 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxyl 1e-132
TIGR00965269 TIGR00965, dapD, 2,3,4,5-tetrahydropyridine-2,6-dicarbo 2e-97
COG2171271 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransfe 1e-75
cd03350139 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine- 2e-58
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix (Lbeta 9e-16
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase (AT) 5e-11
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 1e-07
KOG1461 673 KOG1461, KOG1461, KOG1461, Translation initiation facto 3e-07
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 5e-07
cd04649147 cd04649, LbH_THP_succinylT_putative, Putative 2,3,4,5-t 1e-06
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 2e-06
cd03354101 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT c 3e-06
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] g 5e-06
cd00710167 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): 7e-06
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophospho 1e-05
PRK09451456 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phos 1e-05
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamin 2e-05
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, 3e-05
COG1045194 COG1045, CysE, Serine acetyltransferase [Amino acid tra 3e-05
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltrans 3e-05
KOG4750269 KOG4750, KOG4750, KOG4750, Serine O-acetyltransferase [ 4e-05
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, cen 5e-05
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamin 8e-05
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltr 2e-04
COG1044 338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 3e-04
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltrans 5e-04
TIGR02353695 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthet 5e-04
PRK14357448 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phos 7e-04
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylas 0.001
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltr 0.002
COG1043260 COG1043, LpxA, Acyl-[acyl carrier protein] 0.002
PRK12461255 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransfe 0.003
TIGR01172162 TIGR01172, cysE, serine O-acetyltransferase 0.004
TIGR03532231 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dica 1e-26
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 1e-10
cd03359161 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); D 3e-05
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate u 0.001
PRK10502182 PRK10502, PRK10502, putative acyl transferase; Provisio 0.001
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phos 0.004
cd04647109 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)- 2e-08
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphat 8e-04
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltrans 0.001
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-li 0.001
PRK00892 343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamin 0.001
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate u 0.003
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 0.001
TIGR01853 324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] g 0.003
>gnl|CDD|183330 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130038 TIGR00965, dapD, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>gnl|CDD|32354 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100054 cd04649, LbH_THP_succinylT_putative, Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>gnl|CDD|162561 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|31401 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179158 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31007 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|31247 COG1045, CysE, Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|39947 KOG4750, KOG4750, KOG4750, Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|179158 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|162818 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>gnl|CDD|184644 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162235 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|31245 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130240 TIGR01172, cysE, serine O-acetyltransferase Back     alignment and domain information
>gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|100049 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|182500 PRK10502, PRK10502, putative acyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|179158 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|162561 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 285 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 100.0
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 100.0
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 100.0
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 100.0
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 99.86
PRK05289261 UDP-N-acetylglucosamine acyltransferase; Provisional 99.82
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 99.8
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 99.78
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.78
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.77
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.77
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.76
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 99.66
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.55
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.53
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.3
PRK13627196 carnitine operon protein CaiE; Provisional 99.2
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.05
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 98.33
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 98.03
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 100.0
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 100.0
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.91
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.9
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.88
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.87
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.84
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 99.83
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.8
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 99.78
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.78
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 99.74
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.74
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 99.71
PRK13627196 carnitine operon protein CaiE; Provisional 99.64
KOG4750269 consensus 99.61
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 99.56
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.53
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.52
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 99.49
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.48
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.43
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.42
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.42
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.4
COG1043260 LpxA Acyl-[acyl carrier protein] 99.34
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.29
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.27
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 99.25
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.24
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.23
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.09
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.04
PRK12461256 UDP-N-acetylglucosamine acyltransferase; Provisional 99.0
PRK05289261 UDP-N-acetylglucosamine acyltransferase; Provisional 98.98
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 98.95
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 98.72
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 98.55
COG1043260 LpxA Acyl-[acyl carrier protein] 98.31
KOG4042190 consensus 95.83
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 99.82
PRK12461256 UDP-N-acetylglucosamine acyltransferase; Provisional 99.81
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 99.72
KOG4750269 consensus 97.53
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 99.77
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.74
PRK10092183 maltose O-acetyltransferase; Provisional 99.68
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.67
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 99.66
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 99.66
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.65
PRK11132273 cysE serine acetyltransferase; Provisional 99.65
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 99.6
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 99.58
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.57
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 99.38
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.27
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.23
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 98.9
TIGR02353719 NRPS_term_dom non-ribosomal peptide synthetase terminal 98.89
PRK10092183 maltose O-acetyltransferase; Provisional 98.81
PRK03282406 consensus 98.77
PRK03701431 consensus 98.73
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 98.71
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 98.7
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 98.7
PRK04928405 consensus 98.69
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 98.68
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 98.62
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 98.58
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 98.48
TIGR02353 719 NRPS_term_dom non-ribosomal peptide synthetase terminal 98.42
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 98.41
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 98.33
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 98.32
PRK01884435 consensus 98.27
KOG3121184 consensus 98.25
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 98.24
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 98.1
KOG1462433 consensus 97.56
KOG1460407 consensus 97.39
KOG1462433 consensus 97.32
KOG3121184 consensus 97.25
KOG1322371 consensus 96.22
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 99.71
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 98.39
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 98.31
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 99.58
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.41
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 98.6
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 97.49
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 97.33
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.56
KOG1461 673 consensus 99.17
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 98.8
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 98.76
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 98.74
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 98.64
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 98.62
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.54
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 98.49
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 98.46
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 98.43
PRK03282406 consensus 98.39
PRK04928405 consensus 98.24
PRK11132273 cysE serine acetyltransferase; Provisional 98.21
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 97.93
PRK03701431 consensus 97.78
PRK01884435 consensus 97.78
KOG4042190 consensus 97.73
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 97.59
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 95.98
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.33
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.05
KOG1461 673 consensus 98.87
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 97.98
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 98.83
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 98.74
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 98.55
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 97.43
COG4801277 Predicted acyltransferase [General function prediction 94.71
COG4801277 Predicted acyltransferase [General function prediction 92.67
pfam07959414 Fucokinase L-fucokinase. In the salvage pathway of GDP- 91.29
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 98.69
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 98.6
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 98.45
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 98.48
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 93.96
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 98.41
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 96.57
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 95.0
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 97.94
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 97.9
KOG1460407 consensus 96.37
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 97.79
KOG1322371 consensus 97.49
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 95.82
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>KOG3121 consensus Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>KOG3121 consensus Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>pfam07959 Fucokinase L-fucokinase Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target285 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltr
3eg4_A304 Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- 2e-94
3gos_A276 The Crystal Structure Of 2,3,4,5-Tetrahydropyridine 1e-80
1kgq_A274 Crystal Structure Of Tetrahydrodipicolinate N- Succ 2e-80
3bxy_A285 Crystal Structure Of Tetrahydrodipicolinate N- Succ 1e-79
1tdt_A259 Three-Dimensional Structure Of Tetrahydrodipicolina 2e-74
3r8y_A240 Structure Of The Bacillus Anthracis Tetrahydropicol 1e-16
3cj8_A236 Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- 2e-15
3gvd_A276 Crystal Structure Of Serine Acetyltransferase Cyse 7e-08
3eh0_A341 Crystal Structure Of Lpxd From Escherichia Coli Len 1e-05
3fsx_A332 Structure Of Tetrahydrodipicolinate N-Succinyltrans 1e-05
3fs8_A273 Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Did 0.002
3kwd_A213 Inactive Truncation Of The Beta-Carboxysomal Gamma- 0.004
3kwc_A229 Oxidized, Active Structure Of The Beta-Carboxysomal 0.004
2rij_A387 Crystal Structure Of A Putative 2,3,4,5-Tetrahydrop 1e-08
1t3d_A289 Crystal Structure Of Serine Acetyltransferase From 5e-07
2v0h_A456 Characterization Of Substrate Binding And Catalysis 1e-06
1hv9_A456 Structure Of E. Coli Glmu: Analysis Of Pyrophosphor 2e-06
1hm9_A468 Crystal Structure Of S.Pneumoniae N-Acetylglucosami 2e-06
3fww_A456 The Crystal Structure Of The Bifunctional N-Acetylg 5e-06
1g95_A459 Crystal Structure Of S.Pneumoniae Glmu, Apo Form Le 1e-05
3mqg_A192 Crystal Structure Of The 3-N-Acetyl Transferase Wlb 5e-04
3mc4_A287 Crystal Structure Of WwRSP5WWP DOMAIN: BACTERIAL Tr 6e-07
1sst_A267 Serine Acetyltransferase- Complex With Coa Length = 1e-06
1ssq_A267 Serine Acetyltransferase- Complex With Cysteine Len 1e-06
1s80_A278 Structure Of Serine Acetyltransferase From Haemophi 2e-06
1ssm_A242 Serine Acetyltransferase- Apoenzyme (Truncated) Len 3e-06
3q1x_A313 Crystal Structure Of Entamoeba Histolytica Serine A 6e-05
3p47_A315 Crystal Structure Of Entamoeba Histolytica Serine A 6e-05
3p1b_A314 Crystal Structure Of The Native Serine Acetyltransf 6e-05
3f1x_A310 Three Dimensional Structure Of The Serine Acetyltra 7e-05
2ic7_A185 Crystal Structure Of Maltose Transacetylase From Ge 7e-05
2iu8_A374 Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Com 8e-04
3ftt_A199 Crystal Structure Of The Galactoside O-Acetyltransf 0.001
1kqa_A203 Galactoside Acetyltransferase In Complex With Coenz 0.002
1ocx_A182 E. Coli Maltose-O-Acetyltransferase Length = 182 0.004
>gi|206582134|pdb|3EG4|A Chain A, Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- Carboxylate N-Succinyltransferase From Brucella Melitensis Biovar Abortus 2308 Length = 304 Back     alignment and structure
 Score =  349 bits (896), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 183/280 (65%), Positives = 231/280 (82%)

Query: 4   IVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
            +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+
Sbjct: 25  DLASLEKTIEKAFDERDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWL 84

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI
Sbjct: 85  KKAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYI 144

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 145 APNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTI 204

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+
Sbjct: 205 IEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGT 264

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            P  N+ G+  GP LYCAVI+K+ DEKTRSKTSIN LLRD
Sbjct: 265 MPGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD 304


>gi|237640599|pdb|3GOS|A Chain A, The Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- Carboxylate N-Succinyltransferase From Yersinia Pestis Co92 Length = 276 Back     alignment and structure
gi|20150772|pdb|1KGQ|A Chain A, Crystal Structure Of Tetrahydrodipicolinate N- Succinyltransferase In Complex With L-2-Aminopimelate And Succinamide-Coa Length = 274 Back     alignment and structure
>gi|166235502|pdb|3BXY|A Chain A, Crystal Structure Of Tetrahydrodipicolinate N- Succinyltransferase From E. Coli Length = 285 Back     alignment and structure
>gi|2392550|pdb|1TDT|A Chain A, Three-Dimensional Structure Of Tetrahydrodipicolinate-N- Succinlytransferase Length = 259 Back     alignment and structure
gi|329666277|pdb|3R8Y|A Chain A, Structure Of The Bacillus Anthracis Tetrahydropicolinate Succinyltransferase Length = 240 Back     alignment and structure
>gi|170785257|pdb|3CJ8|A Chain A, Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- Carboxylate N-Succinyltransferase From Enterococcus Faecalis V583 Length = 236 Back     alignment and structure
>gi|237640606|pdb|3GVD|A Chain A, Crystal Structure Of Serine Acetyltransferase Cyse From Yersinia Pestis Length = 276 Back     alignment and structure
>gi|256032569|pdb|3EH0|A Chain A, Crystal Structure Of Lpxd From Escherichia Coli Length = 341 Back     alignment and structure
>gi|241913262|pdb|3FSX|A Chain A, Structure Of Tetrahydrodipicolinate N-Succinyltransferase (Rv1201c; Dapd) From Mycobacterium Tuberculosis Length = 332 Back     alignment and structure
>gi|223674077|pdb|3FS8|A Chain A, Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Dideoxy-D- Glucose N-Acetyl Transferase From Thermoanaerobacterium Thermosaccharolyticum In Complex With Acetyl-Coa Length = 273 Back     alignment and structure
>gi|289526818|pdb|3KWD|A Chain A, Inactive Truncation Of The Beta-Carboxysomal Gamma-Carbonic Anhydrase, Ccmm, Form 1 Length = 213 Back     alignment and structure