254780782

254780782

succinyl-diaminopimelate desuccinylase

GeneID in NCBI database:8209788Locus tag:CLIBASIA_03365
Protein GI in NCBI database:254780782Protein Accession:YP_003065195.1
Gene range:-(480461, 481630)Protein Length:389aa
Gene description:succinyl-diaminopimelate desuccinylase
COG prediction:none
KEGG prediction:dapE; succinyl-diaminopimelate desuccinylase; K01439 succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
SEED prediction:N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Subsystem involved in SEED:Lysine Biosynthesis DAP Pathway;
Arginine Biosynthesis extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITPSQ
ccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEEcccccccEEEEEEEccccccccHHHcccccccEEEEccEEEccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHccccccEEEEcccccccccccEEEEEEEEEEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEEEEEEcccccccEEccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHcccEEEEcccccccccccccEEHHHHHHHHHHHHHHHHHHHHcccc
cccHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccccccccccHHHHccccccEEEEEccccccccccHHHcccccccccEcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHccccccEEEEcccccHHHHcHEEEccccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEcccccccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHcccEEEEEccccccEEEccccccHHHHHHHHHHHHHHHHHHHccccc
MTPDCLEHLIQlikcpsvtpqdggAFFILVNTLKLLGfsieekdfqtkNTSIVKNLYArfgteaphlmfaghidvvppgdfnhwtyppfsatiaegkiygrgivdMKGSIACFIAAVARFIpkyknfgsisllitgdeegpaingtKKMLSWIEKKgekwdacivgeptcnhiigdtikigrrgslsgeitihgkqghvayphltenpirglIPLLHQltnigfdtgnttfsptnmeittidvgnpsknvipaqvKMSFNIRFNDLWNEKTLKEEIRSRLIKGiqnvpklshtvhfsspvspvflthdRKLTSLLSKSIynttgnipllstsggtsdarfikdycpviefglvGRTMHalnenaslqdleDLTCIYENFlqnwfitpsq
MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSieekdfqtknTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLitgdeegpaiNGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTtgnipllstsggtsdARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQnwfitpsq
MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITPSQ
*TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITP**
MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITPSQ
*TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITP**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITPSQ
MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITPSQ
MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITPSQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target389 succinyl-diaminopimelate desuccinylase [Candidatus Libe
315121999365 succinyl-diaminopimelate desuccinylase [Candidatus Libe 1 1e-167
227820648397 succinyl-diaminopimelate desuccinylase [Sinorhizobium f 1 1e-125
222147378404 succinyl-diaminopimelate desuccinylase [Agrobacterium v 1 1e-124
110632750395 succinyl-diaminopimelate desuccinylase [Mesorhizobium s 1 1e-124
327191112396 succinyl-diaminopimelate desuccinylase protein [Rhizobi 1 1e-124
218673647400 succinyl-diaminopimelate desuccinylase [Rhizobium etli 1 1e-124
116250205397 succinyl-diaminopimelate desuccinylase [Rhizobium legum 1 1e-124
86356074409 succinyl-diaminopimelate desuccinylase [Rhizobium etli 1 1e-124
190890090409 succinyl-diaminopimelate desuccinylase [Rhizobium etli 1 1e-124
238064831397 RecName: Full=Succinyl-diaminopimelate desuccinylase; S 1 1e-123
>gi|315121999|ref|YP_004062488.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 365 Back     alignment and organism information
 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 277/361 (76%), Positives = 322/361 (89%)

Query: 28  ILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYP 87
           +L +TLK LGFSI+++ FQ +NT  VKN+YARFG + PHLMFAGH+DVVPPG+ + W YP
Sbjct: 1   MLADTLKPLGFSIKQQIFQEENTPDVKNIYARFGVKKPHLMFAGHVDVVPPGNLDEWMYP 60

Query: 88  PFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTK 147
           PFSAT+AEG+IYGRG VDMKGSIACFIAAV+RFIPK+ NFGSISLLITGDEEGPAINGTK
Sbjct: 61  PFSATVAEGRIYGRGAVDMKGSIACFIAAVSRFIPKHTNFGSISLLITGDEEGPAINGTK 120

Query: 148 KMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTEN 207
           KMLSW +K GE+WDACIVGEPTC+HI+GDTIKIGRRGSLSGEI IHG QGHVAYPHL  N
Sbjct: 121 KMLSWAKKNGEQWDACIVGEPTCSHILGDTIKIGRRGSLSGEIIIHGTQGHVAYPHLANN 180

Query: 208 PIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLW 267
           PI+GLIPLLHQLT I FDTGNT F  TN+EITT+DVGNP+KN+IPA+VK+SFNIRFN+LW
Sbjct: 181 PIKGLIPLLHQLTTIEFDTGNTDFPSTNLEITTVDVGNPAKNIIPAKVKISFNIRFNNLW 240

Query: 268 NEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIP 327
           NE+TLK+EI SRL K +QN+PKLS+ +HFSSPVSPVFLT ++ LTSLLS+SI+  TG  P
Sbjct: 241 NEQTLKKEIESRLTKSLQNMPKLSYNLHFSSPVSPVFLTDNKTLTSLLSESIHRVTGGTP 300

Query: 328 LLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITP 387
            LST+GGTSDARFIKD+CPVIEFGLVG+T+HA+NEN  L+DLEDLTCIYE+FL NWFI+ 
Sbjct: 301 QLSTTGGTSDARFIKDHCPVIEFGLVGKTIHAVNENVLLKDLEDLTCIYEDFLHNWFISS 360

Query: 388 S 388
           S
Sbjct: 361 S 361


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820648|ref|YP_002824618.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium fredii NGR234] Length = 397 Back     alignment and organism information
>gi|222147378|ref|YP_002548335.1| succinyl-diaminopimelate desuccinylase [Agrobacterium vitis S4] Length = 404 Back     alignment and organism information
>gi|110632750|ref|YP_672958.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium sp. BNC1] Length = 395 Back     alignment and organism information
>gi|327191112|gb|EGE58160.1| succinyl-diaminopimelate desuccinylase protein [Rhizobium etli CNPAF512] Length = 396 Back     alignment and organism information
>gi|218673647|ref|ZP_03523316.1| succinyl-diaminopimelate desuccinylase [Rhizobium etli GR56] Length = 400 Back     alignment and organism information
>gi|116250205|ref|YP_766043.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv. viciae 3841] Length = 397 Back     alignment and organism information
>gi|86356074|ref|YP_467966.1| succinyl-diaminopimelate desuccinylase [Rhizobium etli CFN 42] Length = 409 Back     alignment and organism information
>gi|190890090|ref|YP_001976632.1| succinyl-diaminopimelate desuccinylase [Rhizobium etli CIAT 652] Length = 409 Back     alignment and organism information
>gi|238064831|sp|Q2KD47|DAPE_RHIEC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP desuccinylase; AltName: Full=N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase Length = 397 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target389 succinyl-diaminopimelate desuccinylase [Candidatus Libe
PRK13009375 PRK13009, PRK13009, succinyl-diaminopimelate desuccinyl 1e-173
TIGR01246370 TIGR01246, dapE_proteo, succinyl-diaminopimelate desucc 1e-121
PRK08651394 PRK08651, PRK08651, succinyl-diaminopimelate desuccinyl 6e-54
TIGR01910375 TIGR01910, DapE-ArgE, acetylornithine deacetylase or su 6e-46
PRK06133410 PRK06133, PRK06133, glutamate carboxypeptidase; Reviewe 1e-17
PRK07205444 PRK07205, PRK07205, hypothetical protein; Provisional 1e-14
TIGR01883361 TIGR01883, PepT-like, peptidase T-like protein 9e-07
COG0624409 COG0624, ArgE, Acetylornithine deacetylase/Succinyl-dia 2e-76
pfam01546310 pfam01546, Peptidase_M20, Peptidase family M20/M25/M40 8e-55
PRK08588377 PRK08588, PRK08588, succinyl-diaminopimelate desuccinyl 2e-33
KOG2275420 KOG2275, KOG2275, KOG2275, Aminoacylase ACY1 and relate 4e-25
PRK06837427 PRK06837, PRK06837, acetylornithine deacetylase; Provis 3e-21
PRK08262486 PRK08262, PRK08262, hypothetical protein; Provisional 6e-18
PRK00466346 PRK00466, PRK00466, acetyl-lysine deacetylase; Validate 3e-16
PRK07338402 PRK07338, PRK07338, hypothetical protein; Provisional 2e-11
KOG2276473 KOG2276, KOG2276, KOG2276, Metalloexopeptidases [Amino 3e-10
PRK07522385 PRK07522, PRK07522, acetylornithine deacetylase; Provis 2e-27
TIGR01892364 TIGR01892, AcOrn-deacetyl, acetylornithine deacetylase 1e-23
PRK13007352 PRK13007, PRK13007, succinyl-diaminopimelate desuccinyl 1e-17
TIGR01891363 TIGR01891, amidohydrolases, amidohydrolase 7e-10
PRK13004399 PRK13004, PRK13004, peptidase; Reviewed 1e-26
TIGR03526395 TIGR03526, selenium_YgeY, putative selenium metabolism 6e-19
TIGR03320395 TIGR03320, ygeY, M20/DapE family protein YgeY 1e-17
COG4187 553 COG4187, RocB, Arginine degradation protein (predicted 1e-07
PRK13013427 PRK13013, PRK13013, succinyl-diaminopimelate desuccinyl 1e-24
TIGR01902336 TIGR01902, dapE-lys-deAc, N-acetyl-ornithine/N-acetyl-l 2e-10
PRK13983400 PRK13983, PRK13983, diaminopimelate aminotransferase; P 9e-23
PRK08652347 PRK08652, PRK08652, acetylornithine deacetylase; Provis 1e-15
TIGR01900373 TIGR01900, dapE-gram_pos, succinyl-diaminopimelate desu 9e-12
pfam07687107 pfam07687, M20_dimer, Peptidase dimerization domain 6e-21
PRK06915422 PRK06915, PRK06915, acetylornithine deacetylase; Valida 8e-18
PRK05111383 PRK05111, PRK05111, acetylornithine deacetylase; Provis 3e-17
PRK08737364 PRK08737, PRK08737, acetylornithine deacetylase; Provis 2e-16
PRK08596421 PRK08596, PRK08596, acetylornithine deacetylase; Valida 2e-15
PRK06446436 PRK06446, PRK06446, hypothetical protein; Provisional 5e-14
PRK08201456 PRK08201, PRK08201, hypothetical protein; Provisional 2e-12
PRK09104464 PRK09104, PRK09104, hypothetical protein; Validated 8e-11
PRK04443348 PRK04443, PRK04443, acetyl-lysine deacetylase; Provisio 3e-17
TIGR01887447 TIGR01887, dipeptidaselike, dipeptidase, putative 1e-15
PRK07318466 PRK07318, PRK07318, dipeptidase PepV; Reviewed 5e-14
PRK07906426 PRK07906, PRK07906, hypothetical protein; Provisional 7e-12
PRK07907449 PRK07907, PRK07907, hypothetical protein; Provisional 2e-10
TIGR01886466 TIGR01886, dipeptidase, dipeptidase PepV 1e-08
PRK07079469 PRK07079, PRK07079, hypothetical protein; Provisional 0.003
PRK09133472 PRK09133, PRK09133, hypothetical protein; Provisional 6e-14
PRK08554438 PRK08554, PRK08554, peptidase; Reviewed 4e-12
TIGR01880400 TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid amidohy 1e-08
COG1473392 COG1473, AbgB, Metal-dependent amidase/aminoacylase/car 5e-11
TIGR01887447 TIGR01887, dipeptidaselike, dipeptidase, putative 0.003
>gnl|CDD|183838 PRK13009, PRK13009, succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>gnl|CDD|162269 TIGR01246, dapE_proteo, succinyl-diaminopimelate desuccinylase, proteobacterial clade Back     alignment and domain information
>gnl|CDD|181522 PRK08651, PRK08651, succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>gnl|CDD|162596 TIGR01910, DapE-ArgE, acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase Back     alignment and domain information
>gnl|CDD|180418 PRK06133, PRK06133, glutamate carboxypeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|180882 PRK07205, PRK07205, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|162579 TIGR01883, PepT-like, peptidase T-like protein Back     alignment and domain information
>gnl|CDD|30969 COG0624, ArgE, Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|144950 pfam01546, Peptidase_M20, Peptidase family M20/M25/M40 Back     alignment and domain information
>gnl|CDD|181490 PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>gnl|CDD|37486 KOG2275, KOG2275, KOG2275, Aminoacylase ACY1 and related metalloexopeptidases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180721 PRK06837, PRK06837, acetylornithine deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|181333 PRK08262, PRK08262, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|166979 PRK00466, PRK00466, acetyl-lysine deacetylase; Validated Back     alignment and domain information
>gnl|CDD|180938 PRK07338, PRK07338, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|37487 KOG2276, KOG2276, KOG2276, Metalloexopeptidases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181015 PRK07522, PRK07522, acetylornithine deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|130947 TIGR01892, AcOrn-deacetyl, acetylornithine deacetylase (ArgE) Back     alignment and domain information
>gnl|CDD|183837 PRK13007, PRK13007, succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>gnl|CDD|162584 TIGR01891, amidohydrolases, amidohydrolase Back     alignment and domain information
>gnl|CDD|183836 PRK13004, PRK13004, peptidase; Reviewed Back     alignment and domain information
>gnl|CDD|132565 TIGR03526, selenium_YgeY, putative selenium metabolism hydrolase Back     alignment and domain information
>gnl|CDD|132363 TIGR03320, ygeY, M20/DapE family protein YgeY Back     alignment and domain information
>gnl|CDD|33922 COG4187, RocB, Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183841 PRK13013, PRK13013, succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>gnl|CDD|130957 TIGR01902, dapE-lys-deAc, N-acetyl-ornithine/N-acetyl-lysine deacetylase Back     alignment and domain information
>gnl|CDD|184437 PRK13983, PRK13983, diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181523 PRK08652, PRK08652, acetylornithine deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|130955 TIGR01900, dapE-gram_pos, succinyl-diaminopimelate desuccinylase Back     alignment and domain information
>gnl|CDD|116301 pfam07687, M20_dimer, Peptidase dimerization domain Back     alignment and domain information
>gnl|CDD|180745 PRK06915, PRK06915, acetylornithine deacetylase; Validated Back     alignment and domain information
>gnl|CDD|179939 PRK05111, PRK05111, acetylornithine deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|181544 PRK08737, PRK08737, acetylornithine deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|181495 PRK08596, PRK08596, acetylornithine deacetylase; Validated Back     alignment and domain information
>gnl|CDD|180564 PRK06446, PRK06446, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|169276 PRK08201, PRK08201, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181650 PRK09104, PRK09104, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|179850 PRK04443, PRK04443, acetyl-lysine deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|162581 TIGR01887, dipeptidaselike, dipeptidase, putative Back     alignment and domain information
>gnl|CDD|180927 PRK07318, PRK07318, dipeptidase PepV; Reviewed Back     alignment and domain information
>gnl|CDD|181163 PRK07906, PRK07906, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181164 PRK07907, PRK07907, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|130941 TIGR01886, dipeptidase, dipeptidase PepV Back     alignment and domain information
>gnl|CDD|180826 PRK07079, PRK07079, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181666 PRK09133, PRK09133, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|169481 PRK08554, PRK08554, peptidase; Reviewed Back     alignment and domain information
>gnl|CDD|162577 TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid amidohydrolase Back     alignment and domain information
>gnl|CDD|31662 COG1473, AbgB, Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|162581 TIGR01887, dipeptidaselike, dipeptidase, putative Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 389 succinyl-diaminopimelate desuccinylase [Candidatus Libe
TIGR01246383 dapE_proteo succinyl-diaminopimelate desuccinylase; Int 100.0
PRK13009375 succinyl-diaminopimelate desuccinylase; Reviewed 100.0
PRK08588378 succinyl-diaminopimelate desuccinylase; Reviewed 100.0
PRK06837427 acetylornithine deacetylase; Provisional 100.0
PRK06915422 acetylornithine deacetylase; Validated 100.0
PRK13013427 succinyl-diaminopimelate desuccinylase; Reviewed 100.0
PRK05111383 acetylornithine deacetylase; Provisional 100.0
PRK13983399 diaminopimelate aminotransferase; Provisional 100.0
PRK13004397 peptidase; Reviewed 100.0
PRK07522387 acetylornithine deacetylase; Provisional 100.0
TIGR03320395 ygeY M20/DapE family protein YgeY. Members of this prot 100.0
TIGR03526395 selenium_YgeY putative selenium metabolism hydrolase. S 100.0
PRK08596421 acetylornithine deacetylase; Validated 100.0
PRK08651371 succinyl-diaminopimelate desuccinylase; Reviewed 100.0
TIGR01910427 DapE-ArgE acetylornithine deacetylase or succinyl-diami 100.0
PRK07906437 hypothetical protein; Provisional 100.0
PRK06446433 hypothetical protein; Provisional 100.0
TIGR01892386 AcOrn-deacetyl acetylornithine deacetylase (ArgE); Inte 100.0
PRK08652349 acetylornithine deacetylase; Provisional 100.0
PRK09133464 hypothetical protein; Provisional 100.0
PRK08201455 hypothetical protein; Provisional 100.0
COG0624409 ArgE Acetylornithine deacetylase/Succinyl-diaminopimela 100.0
PRK13007354 dipeptidase; Reviewed 100.0
PRK07907437 hypothetical protein; Provisional 100.0
PRK06133418 glutamate carboxypeptidase; Reviewed 100.0
PRK00466345 acetyl-lysine deacetylase; Validated 100.0
PRK04443352 acetyl-lysine deacetylase; Provisional 100.0
PRK08737366 acetylornithine deacetylase; Provisional 100.0
PRK07338407 hypothetical protein; Provisional 100.0
PRK07205444 hypothetical protein; Provisional 100.0
PRK07318469 dipeptidase PepV; Reviewed 100.0
PRK09104465 hypothetical protein; Validated 100.0
PRK08554438 peptidase; Reviewed 100.0
PRK07473376 carboxypeptidase; Provisional 100.0
PRK07079468 hypothetical protein; Provisional 100.0
PRK08262489 hypothetical protein; Provisional 100.0
TIGR01880433 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase; Int 100.0
TIGR01887492 dipeptidaselike dipeptidase, putative; InterPro: IPR010 100.0
KOG2275420 consensus 100.0
PRK06156522 hypothetical protein; Provisional 100.0
KOG2276473 consensus 100.0
TIGR01902352 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacet 100.0
PRK13381413 peptidase T; Provisional 100.0
TIGR01883363 PepT-like peptidase T-like protein; InterPro: IPR010162 100.0
PRK05469405 peptidase T; Provisional 100.0
TIGR01886480 dipeptidase dipeptidase PepV; InterPro: IPR011291 Metal 100.0
TIGR01893506 aa-his-dipept aminoacyl-histidine dipeptidase; InterPro 100.0
TIGR01900373 dapE-gram_pos succinyl-diaminopimelate desuccinylase; I 100.0
PRK12893408 allantoate amidohydrolase; Reviewed 100.0
PRK09290412 allantoate amidohydrolase; Reviewed 100.0
PRK12890412 allantoate amidohydrolase; Reviewed 100.0
PRK12892413 allantoate amidohydrolase; Reviewed 100.0
PRK12891414 allantoate amidohydrolase; Reviewed 100.0
TIGR03176406 AllC allantoate amidohydrolase. This enzyme catalyzes t 100.0
PRK13799591 unknown domain/N-carbamoyl-L-amino acid hydrolase fusio 100.0
TIGR01879406 hydantase amidase, hydantoinase/carbamoylase family; In 100.0
PRK13590590 putative bifunctional OHCU decarboxylase/allantoate ami 100.0
COG1473392 AbgB Metal-dependent amidase/aminoacylase/carboxypeptid 100.0
COG2195414 PepD Di- and tripeptidases [Amino acid transport and me 100.0
TIGR01882413 peptidase-T peptidase T; InterPro: IPR010161 Metallopro 99.95
COG1363355 FrvX Cellulase M and related proteins [Carbohydrate tra 99.73
TIGR03106343 trio_M42_hydro hydrolase, peptidase M42 family. This mo 99.72
PRK09961345 exoaminopeptidase; Provisional 99.67
TIGR03107350 glu_aminopep glutamyl aminopeptidase. This model repres 99.61
PRK09864356 putative fructose-specific phosphotransferase system pr 99.59
pfam01546310 Peptidase_M20 Peptidase family M20/M25/M40. This family 100.0
TIGR01891384 amidohydrolases amidohydrolase; InterPro: IPR010168 Met 100.0
COG4187 553 RocB Arginine degradation protein (predicted deacylase) 99.94
pfam07687107 M20_dimer Peptidase dimerization domain. This domain co 99.73
pfam05343292 Peptidase_M42 M42 glutamyl aminopeptidase. These peptid 99.06
KOG2194 834 consensus 98.88
PRK10199346 alkaline phosphatase isozyme conversion aminopeptidase; 98.82
KOG3946338 consensus 97.49
KOG2526555 consensus 95.68
pfam04389173 Peptidase_M28 Peptidase family M28. 98.52
KOG2195702 consensus 95.77
COG2195414 PepD Di- and tripeptidases [Amino acid transport and me 92.05
COG2234435 Iap Predicted aminopeptidases [General function predict 97.55
PRK09961345 exoaminopeptidase; Provisional 97.0
TIGR03107350 glu_aminopep glutamyl aminopeptidase. This model repres 96.75
PRK09864356 putative fructose-specific phosphotransferase system pr 95.98
COG4882486 Predicted aminopeptidase, Iap family [General function 92.11
>TIGR01246 dapE_proteo succinyl-diaminopimelate desuccinylase; InterPro: IPR005941 The lysine/diaminopimelic acid branch of the aspartate pathway produces the essential amino acid lysine via the intermediate meso-diaminopimelic acid (meso-DAP), which is also a vital cell wall component in Gram-negative bacteria Back     alignment and domain information
>PRK13009 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK08588 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK06837 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK06915 acetylornithine deacetylase; Validated Back     alignment and domain information
>PRK13013 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK05111 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK13983 diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK13004 peptidase; Reviewed Back     alignment and domain information
>PRK07522 acetylornithine deacetylase; Provisional Back     alignment and domain information
>TIGR03320 ygeY M20/DapE family protein YgeY Back     alignment and domain information
>TIGR03526 selenium_YgeY putative selenium metabolism hydrolase Back     alignment and domain information
>PRK08596 acetylornithine deacetylase; Validated Back     alignment and domain information
>PRK08651 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>TIGR01910 DapE-ArgE acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase; InterPro: IPR010182 This group of sequences contains annotations for both acetylornithine deacetylase and succinyl-diaminopimelate desuccinylase, but does not contain any members with experimental characterization Back     alignment and domain information
>PRK07906 hypothetical protein; Provisional Back     alignment and domain information
>PRK06446 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01892 AcOrn-deacetyl acetylornithine deacetylase (ArgE); InterPro: IPR010169 This entry represents a clade of acetylornithine deacetylases (argE) from proteobacteria, which catalyse the final step in arginine biosynthesis Back     alignment and domain information
>PRK08652 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK09133 hypothetical protein; Provisional Back     alignment and domain information
>PRK08201 hypothetical protein; Provisional Back     alignment and domain information
>COG0624 ArgE Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13007 dipeptidase; Reviewed Back     alignment and domain information
>PRK07907 hypothetical protein; Provisional Back     alignment and domain information
>PRK06133 glutamate carboxypeptidase; Reviewed Back     alignment and domain information
>PRK00466 acetyl-lysine deacetylase; Validated Back     alignment and domain information
>PRK04443 acetyl-lysine deacetylase; Provisional Back     alignment and domain information
>PRK08737 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK07338 hypothetical protein; Provisional Back     alignment and domain information
>PRK07205 hypothetical protein; Provisional Back     alignment and domain information
>PRK07318 dipeptidase PepV; Reviewed Back     alignment and domain information
>PRK09104 hypothetical protein; Validated Back     alignment and domain information
>PRK08554 peptidase; Reviewed Back     alignment and domain information
>PRK07473 carboxypeptidase; Provisional Back     alignment and domain information
>PRK07079 hypothetical protein; Provisional Back     alignment and domain information
>PRK08262 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01880 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase; InterPro: IPR010159 This entry represents a family of eukaryotic N-acyl-L-amino-acid amidohydrolase (3 Back     alignment and domain information
>TIGR01887 dipeptidaselike dipeptidase, putative; InterPro: IPR010964 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>KOG2275 consensus Back     alignment and domain information
>PRK06156 hypothetical protein; Provisional Back     alignment and domain information
>KOG2276 consensus Back     alignment and domain information
>TIGR01902 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacetylase; InterPro: IPR010175 This clade of mainly archaeal and related bacterial species contains two characterised enzymes, an deacetylase with specificity for both N-acetyl-ornithine and N-acetyl-lysine from Thermus which is found within a lysine biosynthesis operon, and a fusion protein with acetyl-glutamate kinase (an enzyme of ornithine biosynthesis) from Lactobacillus Back     alignment and domain information
>PRK13381 peptidase T; Provisional Back     alignment and domain information
>TIGR01883 PepT-like peptidase T-like protein; InterPro: IPR010162 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>PRK05469 peptidase T; Provisional Back     alignment and domain information
>TIGR01886 dipeptidase dipeptidase PepV; InterPro: IPR011291 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>TIGR01893 aa-his-dipept aminoacyl-histidine dipeptidase; InterPro: IPR001160 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>TIGR01900 dapE-gram_pos succinyl-diaminopimelate desuccinylase; InterPro: IPR010174 This entry represents a clade of succinyl-diaminopimelate desuccinylases from actinobacteria (high-GC Gram-positives) and is based on the characterisation of the enzyme from Corynebacterium glutamicum Back     alignment and domain information
>PRK12893 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK09290 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK12890 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK12892 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK12891 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>TIGR03176 AllC allantoate amidohydrolase Back     alignment and domain information
>PRK13799 unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional Back     alignment and domain information
>TIGR01879 hydantase amidase, hydantoinase/carbamoylase family; InterPro: IPR010158 Enzymes in this subfamily hydrolyse the amide bonds of compounds containing carbamoyl groups or hydantoin rings Back     alignment and domain information
>PRK13590 putative bifunctional OHCU decarboxylase/allantoate amidohydrolase; Provisional Back     alignment and domain information
>COG1473 AbgB Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only] Back     alignment and domain information
>COG2195 PepD Di- and tripeptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01882 peptidase-T peptidase T; InterPro: IPR010161 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG1363 FrvX Cellulase M and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03106 trio_M42_hydro hydrolase, peptidase M42 family Back     alignment and domain information
>PRK09961 exoaminopeptidase; Provisional Back     alignment and domain information
>TIGR03107 glu_aminopep glutamyl aminopeptidase Back     alignment and domain information
>PRK09864 putative fructose-specific phosphotransferase system protein FrvX; Provisional Back     alignment and domain information
>pfam01546 Peptidase_M20 Peptidase family M20/M25/M40 Back     alignment and domain information
>TIGR01891 amidohydrolases amidohydrolase; InterPro: IPR010168 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism] Back     alignment and domain information
>pfam07687 M20_dimer Peptidase dimerization domain Back     alignment and domain information
>pfam05343 Peptidase_M42 M42 glutamyl aminopeptidase Back     alignment and domain information
>KOG2194 consensus Back     alignment and domain information
>PRK10199 alkaline phosphatase isozyme conversion aminopeptidase; Provisional Back     alignment and domain information
>KOG3946 consensus Back     alignment and domain information
>KOG2526 consensus Back     alignment and domain information
>pfam04389 Peptidase_M28 Peptidase family M28 Back     alignment and domain information
>KOG2195 consensus Back     alignment and domain information
>COG2195 PepD Di- and tripeptidases [Amino acid transport and metabolism] Back     alignment and domain information
>COG2234 Iap Predicted aminopeptidases [General function prediction only] Back     alignment and domain information
>PRK09961 exoaminopeptidase; Provisional Back     alignment and domain information
>TIGR03107 glu_aminopep glutamyl aminopeptidase Back     alignment and domain information
>PRK09864 putative fructose-specific phosphotransferase system protein FrvX; Provisional Back     alignment and domain information
>COG4882 Predicted aminopeptidase, Iap family [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target389 succinyl-diaminopimelate desuccinylase [Candidatus Libe
3ic1_A377 Crystal Structure Of Zinc-Bound Succinyl-Diaminopim 3e-66
1vgy_A393 Crystal Structure Of Succinyl Diaminopimelate Desuc 3e-61
3pfo_A433 Crystal Structure Of A Putative Acetylornithine Dea 4e-30
3gb0_A373 Crystal Structure Of Aminopeptidase Pept (Np_980509 4e-25
3ct9_A356 Crystal Structure Of A Putative Zinc Peptidase (Np_ 2e-24
1cg2_A393 Carboxypeptidase G2 Length = 393 1e-23
3ife_A434 1.55 Angstrom Resolution Crystal Structure Of Pepti 3e-22
2zof_A479 Crystal Structure Of Mouse Carnosinase Cn2 Complexe 1e-21
3dlj_A485 Crystal Structure Of Human Carnosine Dipeptidase 1 6e-20
2f7v_A369 Structure Of Acetylcitrulline Deacetylase Complexed 3e-18
1vix_A420 Crystal Structure Of A Putative Peptidase T Length 2e-16
2rb7_A364 Crystal Structure Of Co-Catalytic Metallopeptidase 1e-15
3pfe_A472 Crystal Structure Of A M20a Metallo Peptidase (Dape 2e-13
1xmb_A418 X-Ray Structure Of Iaa-Aminoacid Hydrolase From Ara 3e-12
1z2l_A423 Crystal Structure Of Allantoate-Amidohydrolase From 5e-11
2pok_A481 Crystal Structure Of A M20 Family Metallo Peptidase 5e-12
2pok_A481 Crystal Structure Of A M20 Family Metallo Peptidase 4e-05
1fno_A417 Peptidase T (Tripeptidase) Length = 417 5e-11
gi|259090306|pdb|3IC1|A Chain A, Crystal Structure Of Zinc-Bound Succinyl-Diaminopimelate Desuccinylase From Haemophilus Influenzae Length = 377 Back     alignment and structure
 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 155/388 (39%), Positives = 215/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT  ++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI      L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|39655033|pdb|1VGY|A Chain A, Crystal Structure Of Succinyl Diaminopimelate Desuccinylase Length = 393 Back     alignment and structure
>gi|311772321|pdb|3PFO|A Chain A, Crystal Structure Of A Putative Acetylornithine Deacetylase (Rpa2325) From Rhodopseudomonas Palustris Cga009 At 1.90 A Resolution Length = 433 Back     alignment and structure
>gi|224510946|pdb|3GB0|A Chain A, Crystal Structure Of Aminopeptidase Pept (Np_980509.1) From Bacillus Cereus Atcc 10987 At 2.04 A Resolution Length = 373 Back     alignment and structure
>gi|187609402|pdb|3CT9|A Chain A, Crystal Structure Of A Putative Zinc Peptidase (Np_812461.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 2.31 A Resolution Length = 356 Back     alignment and structure
>gi|2780967|pdb|1CG2|A Chain A, Carboxypeptidase G2 Length = 393 Back     alignment and structure
>gi|255311967|pdb|3IFE|A Chain A, 1.55 Angstrom Resolution Crystal Structure Of Peptidase T (Pept-1) From Bacillus Anthracis Str. 'ames Ancestor' Length = 434 Back     alignment and structure
>gi|190016263|pdb|2ZOF|A Chain A, Crystal Structure Of Mouse Carnosinase Cn2 Complexed With Mn Bestatin Length = 479 Back     alignment and structure
>gi|197107410|pdb|3DLJ|A Chain A, Crystal Structure Of Human Carnosine Dipeptidase 1 Length = 485 Back     alignment and structure
>gi|116667126|pdb|2F7V|A Chain A, Structure Of Acetylcitrulline Deacetylase Complexed With One Co Length = 369 Back     alignment and structure
>gi|40890019|pdb|1VIX|A Chain A, Crystal Structure Of A Putative Peptidase T Length = 420 Back     alignment and structure
>gi|158430758|pdb|2RB7|A Chain A, Crystal Structure Of Co-Catalytic Metallopeptidase (Yp_387682.1) From Desulfovibrio Desulfuricans G20 At 1.60 A Resolution Length = 364 Back     alignment and structure
>gi|312208192|pdb|3PFE|A Chain A, Crystal Structure Of A M20a Metallo Peptidase (Dape, Lpg0809) From Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1 At 1.50 A Resolution Length = 472 Back     alignment and structure
>gi|56554606|pdb|1XMB|A Chain A, X-Ray Structure Of Iaa-Aminoacid Hydrolase From Arabidopsis Thaliana Gene At5g56660 Length = 418 Back     alignment and structure
>gi|62738884|pdb|1Z2L|A Chain A, Crystal Structure Of Allantoate-Amidohydrolase From E.Coli K12 In Complex With Substrate Allantoate Length = 423 Back     alignment and structure
>gi|149243304|pdb|2POK|A Chain A, Crystal Structure Of A M20 Family Metallo Peptidase From Streptococcus Pneumoniae Length = 481 Back     alignment and structure
>gi|149243304|pdb|2POK|A Chain A, Crystal Structure Of A M20 Family Metallo Peptidase From Streptococcus Pneumoniae Length = 481 Back     alignment and structure
>gi|20149818|pdb|1FNO|A Chain A, Peptidase T (Tripeptidase) Length = 417 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target389 succinyl-diaminopimelate desuccinylase [Candidatus Libe
1vgy_A393 Succinyl-diaminopimelate desuccinylase; structural geno 3e-74
3pfo_A433 Putative acetylornithine deacetylase; metal binding, me 2e-64
3isz_A377 Succinyl-diaminopimelate desuccinylase; DAPE, Zn-bindin 2e-61
3khx_A492 Putative dipeptidase sacol1801; DAPE, metallopeptidase, 4e-53
3pfe_A472 Succinyl-diaminopimelate desuccinylase; metal binding, 2e-41
3ife_A434 Peptidase T; metallopeptidase, aminopeptidase, cytoplas 2e-40
1lfw_A470 PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bacteria 2e-38
2pok_A481 Peptidase, M20/M25/M40 family; M20 family peptidase, me 5e-37
1fno_A417 Peptidase T; metallo peptidase, protease, zinc, hydrola 1e-36
3dlj_A485 Beta-Ala-His dipeptidase; CNDP1, carnosine dipeptidase 2e-35
2zog_A479 Cytosolic non-specific dipeptidase; metallopeptidase, p 2e-34
3gb0_A373 Peptidase T; NP_980509.1, aminopeptidase PEPT, peptidas 5e-29
1vho_A346 Endoglucanase; structural genomics, unknown function; H 1e-28
1vhe_A373 Aminopeptidase/glucanase homolog; structural genomics, 2e-27
1z2l_A423 Allantoate amidohydrolase; ALLC, purine catabolism, all 4e-27
2cf4_A332 Protein PH0519, phtet1-12S; aminopeptidase, metalloprot 4e-27
2gre_A349 Deblocking aminopeptidase; structural genomics, PSI, pr 9e-27
2vpu_A354 TET3, 354AA long hypothetical operon protein FRV; unkno 9e-27
1cg2_A393 Carboxypeptidase G2; metallocarboxypeptidase, hydrolase 2e-26
2rb7_A364 Peptidase, M20/M25/M40 family; YP_387682.1, CO-catalyti 9e-25
1y0y_A353 FRV operon protein FRVX; aminopeptidase, PDZ, hydrolase 1e-24
3ct9_A356 Acetylornithine deacetylase; NP_812461.1, A putative zi 1e-23
3kl9_A355 PEPA, glutamyl aminopeptidase; tetrahedral aminopeptida 4e-22
2v8h_A474 Beta-alanine synthase; amidohydrolase, alpha and beta p 9e-22
2f7v_A369 Aectylcitrulline deacetylase; alpha/beta, hydrolase; 1. 9e-22
1ylo_A348 Hypothetical protein SF2450; structural genomics, MCSG, 2e-21
2fvg_A340 Endoglucanase; TM1049, structural genomics, joint cente 8e-21
3isx_A343 Endoglucanase; TM1050, structural genomics, joint cente 4e-19
3cpx_A321 Aminopeptidase, M42 family; YP_676701.1, putative M42 g 7e-17
1q7l_A198 Aminoacylase-1; catalysis, enzyme dimerization, site- d 1e-28
3mru_A490 Aminoacyl-histidine dipeptidase; metalloprotease, homod 2e-27
2qyv_A487 XAA-His dipeptidase; YP_718209.1, structural genomics, 5e-23
1xmb_A418 IAA-amino acid hydrolase homolog 2; structural genomics 7e-08
3mru_A490 Aminoacyl-histidine dipeptidase; metalloprotease, homod 2e-13
2qyv_A487 XAA-His dipeptidase; YP_718209.1, structural genomics, 2e-11
1q7l_B88 Aminoacylase-1; catalysis, enzyme dimerization, site- d 2e-05
1ysj_A404 Protein YXEP; M20 family peptidase, dinuclear metal bin 2e-04
>1vgy_A Succinyl-diaminopimelate desuccinylase; structural genomics, unknown function; HET: MSE; 1.90A {Neisseria meningitidis MC58} SCOP: c.56.5.4 d.58.19.1 Length = 393 Back     alignment and structure
 Score =  274 bits (701), Expect = 3e-74
 Identities = 165/381 (43%), Positives = 220/381 (57%), Gaps = 13/381 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     ++   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 9   LELAKELISRPSVTPDDRDCQKLMAERLHKIGFAAEEMHFGN-----TKNIWLRRGTKAP 63

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  RF+ K+ 
Sbjct: 64  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHP 123

Query: 126 NFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N   SI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 124 NHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 183

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 184 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 243

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S    P F
Sbjct: 244 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSCSGQP-F 297

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNEN 363
           LT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NEN
Sbjct: 298 LTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAMAQELIELGPSNATIHQINEN 357

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
             L D+  L+ +YE  L    
Sbjct: 358 VRLNDIPKLSAVYEGILVRLL 378


>3pfo_A Putative acetylornithine deacetylase; metal binding, merops M20A family, amino-acid biosynthesis, metallopeptidase; 1.90A {Rhodopseudomonas palustris} Length = 433 Back     alignment and structure
>3isz_A Succinyl-diaminopimelate desuccinylase; DAPE, Zn-binding, metallopeptidase, structural genomics, PSI-2; 2.00A {Haemophilus influenzae rd KW20} PDB: 3ic1_A Length = 377 Back     alignment and structure