254780783

254780783

transcription regulator protein

GeneID in NCBI database:8209789Locus tag:CLIBASIA_03370
Protein GI in NCBI database:254780783Protein Accession:YP_003065196.1
Gene range:+(479917, 480366)Protein Length:149aa
Gene description:transcription regulator protein
COG prediction:none
KEGG prediction:transcription regulator protein
SEED prediction:TRANSCRIPTION REGULATOR PROTEIN
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTSKV
ccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHccccEEEEcccccHHHHHHHHHHHHccccHHHHHHHcccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHcc
ccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHccccHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccc
mdddasfdssERFLEMTVDIVAAYVSNhvvpmadigSLITDVHSALQRvvsrapcqdnvqperlkpavpirksiengclycledgMQFKSLKRHLKthhnmtpdeyRIKWnlasdypmvsREYATTRSKLAKnmglgrgrkkrvltskv
mdddasfdsSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSrapcqdnvqperlkpavpirksIENGCLYCLEDGMQFKSLKRHLKThhnmtpdeyriKWNLASDYPMVSREYATTrsklaknmglgrgrkkrvltskv
MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTSKV
*************LEMTVDIVAAYVSNHVVPMADIGSLITDVHSAL*****************************NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS*****************************
**********ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGR***********
*******DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVV******************PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGL*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTSKV
MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTSKV
MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTSKV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target149 transcription regulator protein [Candidatus Liberibacte
315122005143 transcription regulator protein [Candidatus Liberibacte 1 3e-66
227821334143 transcriptional regulatory protein, Ros/MucR family [Si 1 2e-38
15964752143 transcription regulator protein [Sinorhizobium meliloti 1 3e-38
222085297143 transcriptional regulator protein - nodulation competit 1 5e-38
51012474143 transcriptional regulatory protein RosR [Rhizobium legu 1 7e-38
86356889143 transcriptional regulator protein - nodulation competit 1 7e-38
170783770143 RosR [Rhizobium gallicum bv. gallicum] Length = 143 1 8e-38
190890962143 transcriptional regulator protein - nodulation competit 1 1e-37
116251147143 nodulation competitiveness transcriptional regulator [R 1 1e-37
150395838143 MucR family transcriptional regulator [Sinorhizobium me 1 1e-37
>gi|315122005|ref|YP_004062494.1| transcription regulator protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 143 Back     alignment and organism information
 Score =  254 bits (649), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/143 (81%), Positives = 128/143 (89%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDDDA+FD SE+ LEMTV+IVAAYV NHVVPM DIGSL+ DVH+ L+ ++S  P QDN+ 
Sbjct: 1   MDDDATFDGSEKILEMTVNIVAAYVGNHVVPMGDIGSLVADVHTVLRNLISHNPGQDNLP 60

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ERLKPAVPIRKSIENG LYCLEDGM+FKSLKRHL THHNMTP+EYRIKWNLASDYPMVS
Sbjct: 61  TERLKPAVPIRKSIENGLLYCLEDGMKFKSLKRHLMTHHNMTPEEYRIKWNLASDYPMVS 120

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
           REYA TRSKLAKNMGLGRGRKKR
Sbjct: 121 REYANTRSKLAKNMGLGRGRKKR 143


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821334|ref|YP_002825304.1| transcriptional regulatory protein, Ros/MucR family [Sinorhizobium fredii NGR234] Length = 143 Back     alignment and organism information
>gi|15964752|ref|NP_385105.1| transcription regulator protein [Sinorhizobium meliloti 1021] Length = 143 Back     alignment and organism information
>gi|222085297|ref|YP_002543827.1| transcriptional regulator protein - nodulation competitiveness determinant [Agrobacterium radiobacter K84] Length = 143 Back     alignment and organism information
>gi|51012474|gb|AAT92553.1| transcriptional regulatory protein RosR [Rhizobium leguminosarum bv. trifolii] Length = 143 Back     alignment and organism information
>gi|86356889|ref|YP_468781.1| transcriptional regulator protein - nodulation competitiveness determinant [Rhizobium etli CFN 42] Length = 143 Back     alignment and organism information
>gi|170783770|gb|ACB37369.1| RosR [Rhizobium gallicum bv. gallicum] Length = 143 Back     alignment and organism information
>gi|190890962|ref|YP_001977504.1| transcriptional regulator protein - nodulation competitiveness determinant [Rhizobium etli CIAT 652] Length = 143 Back     alignment and organism information
>gi|116251147|ref|YP_766985.1| nodulation competitiveness transcriptional regulator [Rhizobium leguminosarum bv. viciae 3841] Length = 143 Back     alignment and organism information
>gi|150395838|ref|YP_001326305.1| MucR family transcriptional regulator [Sinorhizobium medicae WSM419] Length = 143 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target149 transcription regulator protein [Candidatus Liberibacte
COG4957148 COG4957, COG4957, Predicted transcriptional regulator [ 9e-45
pfam05443130 pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator 1e-49
>gnl|CDD|34565 COG4957, COG4957, Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>gnl|CDD|147562 pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 149 transcription regulator protein [Candidatus Liberibacte
COG4957148 Predicted transcriptional regulator [Transcription] 100.0
pfam05443130 ROS_MUCR ROS/MUCR transcriptional regulator protein. Th 100.0
>COG4957 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>pfam05443 ROS_MUCR ROS/MUCR transcriptional regulator protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target149 transcription regulator protein [Candidatus Liberibacte
2jsp_A87 The Prokaryotic Cys2his2 Zinc Finger Adopts A Novel 1e-32
>gi|166007397|pdb|2JSP|A Chain A, The Prokaryotic Cys2his2 Zinc Finger Adopts A Novel Fold As Revealed By The Nmr Structure Of A. Tumefaciens Ros Dna Binding Domain Length = 87 Back     alignment and structure
 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/84 (60%), Positives = 63/84 (75%)

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
            V  E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYP
Sbjct: 1   AVNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYP 60

Query: 118 MVSREYATTRSKLAKNMGLGRGRK 141
           MV+  YA  RS+LAK MGLG+ RK
Sbjct: 61  MVAPAYAEARSRLAKEMGLGQRRK 84


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target149 transcription regulator protein [Candidatus Liberibacte
2jsp_A87 Transcriptional regulatory protein ROS; prokaryotic Cys 3e-32
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Length = 87 Back     alignment and structure
 Score =  132 bits (334), Expect = 3e-32
 Identities = 51/84 (60%), Positives = 63/84 (75%)

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
           V  E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYPM
Sbjct: 2   VNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPM 61

Query: 119 VSREYATTRSKLAKNMGLGRGRKK 142
           V+  YA  RS+LAK MGLG+ RK 
Sbjct: 62  VAPAYAEARSRLAKEMGLGQRRKA 85


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target149 transcription regulator protein [Candidatus Liberibacte
2jsp_A87 Transcriptional regulatory protein ROS; prokaryotic Cys 100.0
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
Probab=100.00  E-value=4.5e-38  Score=264.03  Aligned_cols=85  Identities=60%  Similarity=1.002  Sum_probs=80.4

Q ss_pred             CCCCCCCCCCCHHHHCCCCCEEECCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             78545899857365138884597436100025899986743999899999727379883229999999999999819981
Q gi|254780783|r   59 VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGR  138 (149)
Q Consensus        59 ~~~~~~~PAv~i~kSi~~d~iiClecGk~~K~LkRHL~t~hgLtp~eYR~kwGLp~dyPlvAp~Ys~~Rs~~Ak~~GLg~  138 (149)
                      ++.+.+.|||+|++||++|+||||||||+||||+|||++.|||||+|||+|||||+|||||||+||++||++||++|||+
T Consensus         2 ~~~e~~~Pav~i~kSi~~d~iiClecGk~~k~LkRHL~~~hgltp~eYR~kwGlp~dyPlva~~ys~~Rs~~ak~~gLg~   81 (87)
T 2jsp_A            2 VNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVAPAYAEARSRLAKEMGLGQ   81 (87)
T ss_dssp             CCSSCCBCCCCSSTTBCSSCEECTBTCCEESBHHHHHHHTTCSCHHHHHHHTTCGGGCCSBCTTTTTTTTTSSCCSSCSC
T ss_pred             CCCCCCCCCCCHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCH
T ss_conf             87566899988666468980587127830558999988871989999999809899985629999999999999837525


Q ss_pred             CHHHH
Q ss_conf             01005
Q gi|254780783|r  139 GRKKR  143 (149)
Q Consensus       139 ~~rk~  143 (149)
                      ++++.
T Consensus        82 kr~~~   86 (87)
T 2jsp_A           82 RRKAN   86 (87)
T ss_dssp             SSCCC
T ss_pred             HHHCC
T ss_conf             33222




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 149 transcription regulator protein [Candidatus Liberi
2jsp_A_1-3333 (A:1-33) Transcriptional regulatory protein ROS; p 6e-09
>2jsp_A (A:1-33) Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens}Length = 33 Back     alignment and structure
 Score = 54.7 bits (132), Expect = 6e-09
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 59 VQPERLKPAVPIRKSIENGCLYCLEDGMQFKS 90
          V  E+ KPAV +RKS+++  + CLE G  FKS
Sbjct: 2  VNVEKQKPAVSVRKSVQDDHIVCLECGGSFKS 33


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target149 transcription regulator protein [Candidatus Liberibacte
2jsp_A_1-3333 Transcriptional regulatory protein ROS; prokaryoti 99.0
>2jsp_A (A:1-33) Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
Probab=99.00  E-value=9.4e-11  Score=90.09  Aligned_cols=32  Identities=50%  Similarity=0.795  Sum_probs=29.3

Q ss_pred             CCCCCCCCCCCHHHHCCCCCEEECCCCHHHHH
Q ss_conf             78545899857365138884597436100025
Q gi|254780783|r   59 VQPERLKPAVPIRKSIENGCLYCLEDGMQFKS   90 (149)
Q Consensus        59 ~~~~~~~PAv~i~kSi~~d~iiClecGk~~K~   90 (149)
                      ++++.+.|||+||+||++|+||||||||+||+
T Consensus         2 ~~~e~~~PaVpikkSvtpDyiicLEDGkk~KS   33 (33)
T 2jsp_A            2 VNVEKQKPAVSVRKSVQDDHIVCLECGGSFKS   33 (33)
T ss_dssp             CCSSCCBCCCCSSTTBCSSCEECTBTCCEESB
T ss_pred             CCCCCCCCCCCHHHCCCCCCEEEECCCCCHHH
T ss_conf             87666899988666468980687137830658