254780789

254780789

hypothetical protein CLIBASIA_03400

GeneID in NCBI database:8209795Locus tag:CLIBASIA_03400
Protein GI in NCBI database:254780789Protein Accession:YP_003065202.1
Gene range:+(471064, 471642)Protein Length:192aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein; K09748 hypothetical protein
SEED prediction:clustered with transcription termination protein NusA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:NusA-TFII Cluster;
Transcription factors bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MESTHFLHSKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLRASLNNYGSYAGL
ccHHHHHHHHHccHHHccccHHHHHHHHHHHHHHccccEEEEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHcccEEEEEEEEccccEEEEEEEEEEEcccEEEEEEcccccccccccEEEEEHHHHHHccEEEEHHHHHHHHHcccccccc
ccccccHHHccccHHHccccHHHHHHHHHHHHHHHcccEEEEEEEEccccEEEEEEEEcccccEEcccHHHHHHHHHHHHcccccccccEEEEEcccccccccccHHHHHHHcccEEEEEEEEEccccEEEEEEEEEEcccEEEEEEEcccccccccEEEEEEHHHHHHccEEEcHHHHHHHHccccccccc
mesthflhskyeprifgdmglagdissVIQPVIEEMSFRSVQISLLEEKNLLLQIFVerddgnmtlrdCEELSQAispildveniieghyrlevsspgidrpmvrksdflrwnGHVVACEIVLSSGDKQKLIGKimgtsetgfflekekrgekDMNELQIAISFDSLLSARLIVTDELLRASLNnygsyagl
mesthflhSKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRlevsspgidrpmVRKSDFLRWNGHVVACEIvlssgdkqkliGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLRASlnnygsyagl
MESTHFLHSKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLRASLNNYGSYAGL
********SKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLRAS**********
********SKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLRASLNNYGSYAGL
***THFLHSKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLRASLNNYGSYAGL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESTHFLHSKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLRASLNNYGSYAGL
MESTHFLHSKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLRASLNNYGSYAGL
MESTHFLHSKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLRASLNNYGSYAGL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target192 hypothetical protein CLIBASIA_03400 [Candidatus Liberib
315122011186 hypothetical protein CKC_01305 [Candidatus Liberibacter 1 5e-74
15963989205 hypothetical protein SMc02911 [Sinorhizobium meliloti 1 1 6e-42
327192407201 hypothetical protein RHECNPAF_224004 [Rhizobium etli CN 1 3e-41
190889788198 hypothetical protein RHECIAT_CH0000156 [Rhizobium etli 1 3e-41
259585712198 RecName: Full=Ribosome maturation factor rimP Length = 1 6e-41
222084329246 hypothetical protein Arad_0177 [Agrobacterium radiobact 1 8e-41
86355779198 hypothetical protein RHE_CH00119 [Rhizobium etli CFN 42 1 1e-40
227824068205 hypothetical protein NGR_c35650 [Sinorhizobium fredii N 1 3e-40
241207072201 hypothetical protein Rleg_4390 [Rhizobium leguminosarum 1 4e-40
150398624205 hypothetical protein Smed_3438 [Sinorhizobium medicae W 1 6e-40
>gi|315122011|ref|YP_004062500.1| hypothetical protein CKC_01305 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 186 Back     alignment and organism information
 Score =  280 bits (717), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 134/184 (72%), Positives = 159/184 (86%)

Query: 1   MESTHFLHSKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEEKNLLLQIFVERD 60
           MESTH   SKYEPRIFGD+GL  D+S++IQPVIEEM FR VQ+SLLEE+NL+LQI VERD
Sbjct: 1   MESTHVFCSKYEPRIFGDVGLGQDVSNIIQPVIEEMGFRIVQVSLLEERNLILQILVERD 60

Query: 61  DGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACE 120
           +G MTL DCEE+S+AISPILDVENIIE HY+LE+SSPGI+RPMVRKSDF RWNGH+VACE
Sbjct: 61  NGTMTLCDCEEVSKAISPILDVENIIEEHYQLEISSPGINRPMVRKSDFERWNGHIVACE 120

Query: 121 IVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVTDELLR 180
           +  SSGDK+KL+GKI+G S+  FFLEK++   KD    QIA+SFDSLLSA+L++TDELL 
Sbjct: 121 VASSSGDKKKLVGKIVGKSDLDFFLEKKEEDLKDAGVSQIAVSFDSLLSAKLVITDELLC 180

Query: 181 ASLN 184
           ASLN
Sbjct: 181 ASLN 184


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15963989|ref|NP_384342.1| hypothetical protein SMc02911 [Sinorhizobium meliloti 1021] Length = 205 Back     alignment and organism information
>gi|327192407|gb|EGE59367.1| hypothetical protein RHECNPAF_224004 [Rhizobium etli CNPAF512] Length = 201 Back     alignment and organism information
>gi|190889788|ref|YP_001976330.1| hypothetical protein RHECIAT_CH0000156 [Rhizobium etli CIAT 652] Length = 198 Back     alignment and organism information
>gi|259585712|sp|B9JGT7|RIMP_AGRRK RecName: Full=Ribosome maturation factor rimP Length = 198 Back     alignment and organism information
>gi|222084329|ref|YP_002542858.1| hypothetical protein Arad_0177 [Agrobacterium radiobacter K84] Length = 246 Back     alignment and organism information
>gi|86355779|ref|YP_467671.1| hypothetical protein RHE_CH00119 [Rhizobium etli CFN 42] Length = 198 Back     alignment and organism information
>gi|227824068|ref|YP_002828041.1| hypothetical protein NGR_c35650 [Sinorhizobium fredii NGR234] Length = 205 Back     alignment and organism information
>gi|241207072|ref|YP_002978168.1| hypothetical protein Rleg_4390 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 201 Back     alignment and organism information
>gi|150398624|ref|YP_001329091.1| hypothetical protein Smed_3438 [Sinorhizobium medicae WSM419] Length = 205 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target192 hypothetical protein CLIBASIA_03400 [Candidatus Liberib
PRK00092154 PRK00092, PRK00092, ribosome maturation protein RimP; R 7e-31
COG0779153 COG0779, COG0779, Uncharacterized protein conserved in 7e-26
PRK14636176 PRK14636, PRK14636, hypothetical protein; Provisional 2e-22
PRK14638150 PRK14638, PRK14638, hypothetical protein; Provisional 4e-12
PRK14632172 PRK14632, PRK14632, hypothetical protein; Provisional 1e-08
PRK14637151 PRK14637, PRK14637, hypothetical protein; Provisional 5e-07
PRK14634155 PRK14634, PRK14634, hypothetical protein; Provisional 3e-04
PRK02001152 PRK02001, PRK02001, hypothetical protein; Validated 0.003
pfam02576141 pfam02576, DUF150, Uncharacterized BCR, YhbC family COG 6e-27
PRK14647159 PRK14647, PRK14647, hypothetical protein; Provisional 2e-18
PRK14640152 PRK14640, PRK14640, hypothetical protein; Provisional 1e-12
PRK14645154 PRK14645, PRK14645, hypothetical protein; Provisional 5e-10
PRK14633150 PRK14633, PRK14633, hypothetical protein; Provisional 8e-09
PRK14646155 PRK14646, PRK14646, hypothetical protein; Provisional 0.002
PRK14639140 PRK14639, PRK14639, hypothetical protein; Provisional 1e-10
PRK14631174 PRK14631, PRK14631, hypothetical protein; Provisional 8e-09
cd0173483 cd01734, YlxS_C, YxlS is a Bacillus subtilis gene of un 3e-06
PRK14642197 PRK14642, PRK14642, hypothetical protein; Provisional 4e-08
>gnl|CDD|178857 PRK00092, PRK00092, ribosome maturation protein RimP; Reviewed Back     alignment and domain information
>gnl|CDD|88623 COG0779, COG0779, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|184775 PRK14636, PRK14636, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184777 PRK14638, PRK14638, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173095 PRK14632, PRK14632, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184776 PRK14637, PRK14637, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173097 PRK14634, PRK14634, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179358 PRK02001, PRK02001, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|111471 pfam02576, DUF150, Uncharacterized BCR, YhbC family COG0779 Back     alignment and domain information
>gnl|CDD|173110 PRK14647, PRK14647, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173103 PRK14640, PRK14640, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184780 PRK14645, PRK14645, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173096 PRK14633, PRK14633, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173109 PRK14646, PRK14646, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173102 PRK14639, PRK14639, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184773 PRK14631, PRK14631, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|99771 cd01734, YlxS_C, YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold Back     alignment and domain information
>gnl|CDD|184778 PRK14642, PRK14642, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 192 hypothetical protein CLIBASIA_03400 [Candidatus Liberib
COG0779153 Uncharacterized protein conserved in bacteria [Function 100.0
PRK00092153 hypothetical protein; Reviewed 100.0
pfam02576141 DUF150 Uncharacterized BCR, YhbC family COG0779. 100.0
PRK02001154 hypothetical protein; Validated 100.0
cd0173483 YlxS_C YxlS is a Bacillus subtilis gene of unknown func 99.89
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00092 hypothetical protein; Reviewed Back     alignment and domain information
>pfam02576 DUF150 Uncharacterized BCR, YhbC family COG0779 Back     alignment and domain information
>PRK02001 hypothetical protein; Validated Back     alignment and domain information
>cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target192 hypothetical protein CLIBASIA_03400 [Candidatus Liberib
1ib8_A164 Solution Structure And Function Of A Conserved Prot 8e-20
>gi|159162465|pdb|1IB8|A Chain A, Solution Structure And Function Of A Conserved Protein Sp14.3 Encoded By An Essential Streptococcus Pneumoniae Gene Length = 164 Back     alignment and structure
 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 74/157 (47%), Gaps = 9/157 (5%)

Query: 21  LAGDISSVIQPVIEEMSFRSVQISLLE-EKNLLLQIFVERDDGNMTLRDCEELSQAISPI 79
           +   +  V++PVIE   F  V I   +   +++L IFV++ +  +TL D  +L++ ISP+
Sbjct: 10  IVELVREVVEPVIEA-PFELVDIEYGKIGSDMILSIFVDKPE-GITLNDTADLTEMISPV 67

Query: 80  LD--VENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMG 137
           LD    +     Y LE++SPG++RP+  K       G  +   +  +   ++   G ++ 
Sbjct: 68  LDTIKPDPFPEQYFLEITSPGLERPLKTKDAVAGAVGKYIHVGLYQAIDKQKVFEGTLLA 127

Query: 138 TSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIV 174
             E    +E   +  K      + I +  +  ARL V
Sbjct: 128 FEEDELTMEYMDKTRKK----TVQIPYSLVSKARLAV 160


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target192 hypothetical protein CLIBASIA_03400 [Candidatus Liberib
1ib8_A164 Conserved protein SP14.3; nucleic acid binding protein, 5e-21
>1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 Length = 164 Back     alignment and structure
 Score = 95.7 bits (238), Expect = 5e-21
 Identities = 41/153 (26%), Positives = 74/153 (48%), Gaps = 9/153 (5%)

Query: 25  ISSVIQPVIEEMSFRSVQISLLEE-KNLLLQIFVERDDGNMTLRDCEELSQAISPILDV- 82
           +  V++PVIE   F  V I   +   +++L IFV++ +G +TL D  +L++ ISP+LD  
Sbjct: 14  VREVVEPVIE-APFELVDIEYGKIGSDMILSIFVDKPEG-ITLNDTADLTEMISPVLDTI 71

Query: 83  -ENIIEGHYRLEVSSPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSET 141
             +     Y LE++SPG++RP+  K       G  +   +  +   ++   G ++   E 
Sbjct: 72  KPDPFPEQYFLEITSPGLERPLKTKDAVAGAVGKYIHVGLYQAIDKQKVFEGTLLAFEED 131

Query: 142 GFFLEKEKRGEKDMNELQIAISFDSLLSARLIV 174
              +E   +  K      + I +  +  ARL V
Sbjct: 132 ELTMEYMDKTRKK----TVQIPYSLVSKARLAV 160


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target192 hypothetical protein CLIBASIA_03400 [Candidatus Liberib
1ib8_A164 Conserved protein SP14.3; nucleic acid binding protein, 100.0
>1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 Back     alignment and structure
Probab=100.00  E-value=3.9e-42  Score=282.10  Aligned_cols=151  Identities=26%  Similarity=0.490  Sum_probs=138.4

Q ss_pred             CCHHHHHHHHHHHHHHHCCCEEEEEEEEC-CCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCC--CCCCCCCCEEEEE
Q ss_conf             12799999999999974797799999954-99868999996587787899999999998752021--1356765079997
Q gi|254780789|r   19 MGLAGDISSVIQPVIEEMSFRSVQISLLE-EKNLLLQIFVERDDGNMTLRDCEELSQAISPILDV--ENIIEGHYRLEVS   95 (192)
Q Consensus        19 ~~i~~~i~~li~p~v~~lG~eLv~v~~~~-~~~~~LrI~ID~~dg~i~iddC~~vSr~i~~~LD~--~d~i~~~Y~LEVS   95 (192)
                      ..+.+.|+++++|+++ .||+||+|++.+ +++++||||||+++| |++|||+.+||.|++.||+  +|+++++|+||||
T Consensus         8 ~~i~e~i~~li~p~~~-~g~eL~die~~~~~~~~~lrI~ID~~~g-v~iddC~~vSr~i~~~LD~~~~d~i~~~Y~LEVS   85 (164)
T 1ib8_A            8 ATIVELVREVVEPVIE-APFELVDIEYGKIGSDMILSIFVDKPEG-ITLNDTADLTEMISPVLDTIKPDPFPEQYFLEIT   85 (164)
T ss_dssp             HHHHHHHHHHHHHHHC-SSSEEEEEEEEEETTEEEEEEEEECSSC-CCHHHHHHHHHHHGGGTTTCCSCCCCSCEEEEEE
T ss_pred             HHHHHHHHHHHHHHHH-CCCEEEEEEEEECCCCEEEEEEEECCCC-CCHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEE
T ss_conf             9999999999899986-6988999999908996799999999999-4589999999999987535446667875799996


Q ss_pred             ECCCCCCCCCHHHHHHHHCCEEEEEEECCCCCEEEEEEEEEECCCCEEEEEECCCCCCCCCCCEEEEEHHHHHHCCEECC
Q ss_conf             27887744578999987105688987226688078999985126975999963554567777269976887651725046
Q gi|254780789|r   96 SPGIDRPMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAISFDSLLSARLIVT  175 (192)
Q Consensus        96 SPGidRpL~~~~~f~r~~G~~VkV~l~~~~~g~k~~~G~L~~v~~~~i~l~~~~~~~k~~~~~~v~ip~~~I~kAkLv~~  175 (192)
                      |||++|||++++||+||+|+.|+|+|+.+.+|+++|+|+|.+++++.++|.+..+..    ..+++|||++|++|||++.
T Consensus        86 SPGldRpL~~~~~f~r~~G~~v~V~l~~~~~~~k~~~G~L~~v~~~~i~l~~~~~~~----~~~~~I~~~~I~ka~l~ve  161 (164)
T 1ib8_A           86 SPGLERPLKTKDAVAGAVGKYIHVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTR----KKTVQIPYSLVSKARLAVK  161 (164)
T ss_dssp             CCSSSSCCSSHHHHHHHCSEEEEEECSSCSSSCSEEEEEEEEEETTEEEEEEECSSC----EEEEEECSSCCSSCEEECS
T ss_pred             CCCCCCCCCCHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEEEECCEEEEEEECCCC----CEEEEEEHHHCCEEEEEEE
T ss_conf             699885437979999865957999996476993899999999749989999923777----6599970698146999999




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 192 hypothetical protein CLIBASIA_03400 [Candidatus Liberib
d1ib8a290 d.52.4.1 (A:1-90) Hypothetical protein SP14.3 (SP0552) 1e-13
d1ib8a174 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552 7e-05
>d1ib8a2 d.52.4.1 (A:1-90) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Length = 90 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: YhbC-like, N-terminal domain
family: YhbC-like, N-terminal domain
domain: Hypothetical protein SP14.3 (SP0552)
species: Streptococcus pneumoniae [TaxId: 1313]
 Score = 70.1 bits (172), Expect = 1e-13
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 5/79 (6%)

Query: 25  ISSVIQPVIEEMSFRSVQISLL-EEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDV- 82
           +  V++PVIE   F  V I       +++L IFV++ +G +TL D  +L++ ISP+LD  
Sbjct: 14  VREVVEPVIE-APFELVDIEYGKIGSDMILSIFVDKPEG-ITLNDTADLTEMISPVLDTI 71

Query: 83  -ENIIEGHYRLEVSSPGID 100
             +     Y LE++SPG++
Sbjct: 72  KPDPFPEQYFLEITSPGLE 90


>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Length = 74 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target192 hypothetical protein CLIBASIA_03400 [Candidatus Liberib
d1ib8a290 Hypothetical protein SP14.3 (SP0552) {Streptococcus pne 99.89
d1ib8a174 Hypothetical protein SP14.3 (SP0552) {Streptococcus pne 99.52
>d1ib8a2 d.52.4.1 (A:1-90) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: YhbC-like, N-terminal domain
family: YhbC-like, N-terminal domain
domain: Hypothetical protein SP14.3 (SP0552)
species: Streptococcus pneumoniae [TaxId: 1313]
Probab=99.89  E-value=3.2e-23  Score=162.61  Aligned_cols=80  Identities=35%  Similarity=0.680  Sum_probs=73.1

Q ss_pred             CCHHHHHHHHHHHHHHHCCCEEEEEEEEC-CCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCC--CCCCCCCCEEEEE
Q ss_conf             12799999999999974797799999954-99868999996587787899999999998752021--1356765079997
Q gi|254780789|r   19 MGLAGDISSVIQPVIEEMSFRSVQISLLE-EKNLLLQIFVERDDGNMTLRDCEELSQAISPILDV--ENIIEGHYRLEVS   95 (192)
Q Consensus        19 ~~i~~~i~~li~p~v~~lG~eLv~v~~~~-~~~~~LrI~ID~~dg~i~iddC~~vSr~i~~~LD~--~d~i~~~Y~LEVS   95 (192)
                      ..+.++++++++|+++ +||+||+|++.+ +++++||||||+++| |++|||+.+||.|++.||+  +|+++++|+||||
T Consensus         8 ~~i~e~i~~li~pvv~-~G~eL~~ve~~~~~~~~~l~I~ID~~~g-v~iddC~~vSr~is~~LD~~e~d~i~~~Y~LEVS   85 (90)
T d1ib8a2           8 ATIVELVREVVEPVIE-APFELVDIEYGKIGSDMILSIFVDKPEG-ITLNDTADLTEMISPVLDTIKPDPFPEQYFLEIT   85 (90)
T ss_dssp             HHHHHHHHHHHHHHHC-SSSEEEEEEEEEETTEEEEEEEEECSSC-CCHHHHHHHHHHHGGGTTTCCSCCCCSCEEEEEE
T ss_pred             HHHHHHHHHHHHHHHH-CCCEEEEEEEEECCCCEEEEEEEECCCC-CCHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEE
T ss_conf             9999999999999986-7988999999918997799999978999-6799999999999998654555678988499964


Q ss_pred             ECCCC
Q ss_conf             27887
Q gi|254780789|r   96 SPGID  100 (192)
Q Consensus        96 SPGid  100 (192)
                      |||+|
T Consensus        86 SPGld   90 (90)
T d1ib8a2          86 SPGLE   90 (90)
T ss_dssp             CCSSS
T ss_pred             CCCCC
T ss_conf             89999



>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 192 hypothetical protein CLIBASIA_03400 [Candidatus Li
1ib8_A_1-9191 (A:1-91) Conserved protein SP14.3; nucleic acid bi 1e-14
1ib8_A_92-16473 (A:92-164) Conserved protein SP14.3; nucleic acid 5e-04
>1ib8_A (A:1-91) Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae}Length = 91 Back     alignment and structure
 Score = 74.4 bits (183), Expect = 1e-14
 Identities = 29/85 (34%), Positives = 49/85 (57%), Gaps = 5/85 (5%)

Query: 20  GLAGDISSVIQPVIEEMSFRSVQISLLEE-KNLLLQIFVERDDGNMTLRDCEELSQAISP 78
            +   +  V++PVIE   F  V I   +   +++L IFV++ +G +TL D  +L++ ISP
Sbjct: 9   TIVELVREVVEPVIE-APFELVDIEYGKIGSDMILSIFVDKPEG-ITLNDTADLTEMISP 66

Query: 79  ILDVENI--IEGHYRLEVSSPGIDR 101
           +LD          Y LE++SPG++R
Sbjct: 67  VLDTIKPDPFPEQYFLEITSPGLER 91


>1ib8_A (A:92-164) Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae}Length = 73 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target192 hypothetical protein CLIBASIA_03400 [Candidatus Liberib
1ib8_A_1-9191 Conserved protein SP14.3; nucleic acid binding pro 99.9
1ib8_A_92-16473 Conserved protein SP14.3; nucleic acid binding pro 99.47
>1ib8_A (A:1-91) Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} Back     alignment and structure
Probab=99.90  E-value=3.4e-23  Score=164.88  Aligned_cols=86  Identities=34%  Similarity=0.613  Sum_probs=76.6

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEEECC-CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCC--CCCCCCC
Q ss_conf             10014127999999999999747977999999549-98689999965877878999999999987520211--3567650
Q gi|254780789|r   14 RIFGDMGLAGDISSVIQPVIEEMSFRSVQISLLEE-KNLLLQIFVERDDGNMTLRDCEELSQAISPILDVE--NIIEGHY   90 (192)
Q Consensus        14 r~~~~~~i~~~i~~li~p~v~~lG~eLv~v~~~~~-~~~~LrI~ID~~dg~i~iddC~~vSr~i~~~LD~~--d~i~~~Y   90 (192)
                      |.+....+.++|+++++|+++ +||+||+|++.+. ++++|||+||+++| |++|||+++||+|++.||++  +|++++|
T Consensus         3 ~~~~~~~~~~~i~~l~~~v~~-~g~eL~~v~~~~~~~~~~l~V~iD~~~g-i~iddc~~~Sr~i~~~LD~e~~d~i~~~Y   80 (91)
T 1ib8_A            3 GVDAIATIVELVREVVEPVIE-APFELVDIEYGKIGSDMILSIFVDKPEG-ITLNDTADLTEMISPVLDTIKPDPFPEQY   80 (91)
T ss_dssp             SCCHHHHHHHHHHHHHHHHHC-SSSEEEEEEEEEETTEEEEEEEEECSSC-CCHHHHHHHHHHHGGGTTTCCSCCCCSCE
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-CCCEEEEEEEECCCCCCEEEEEEECCCC-CCHHHHHHHHHHHHHHHHCCCCCCCCCCE
T ss_conf             265899999999999999985-7988999999828997199999999999-67899999999998776044465667534


Q ss_pred             EEEEEECCCCC
Q ss_conf             79997278877
Q gi|254780789|r   91 RLEVSSPGIDR  101 (192)
Q Consensus        91 ~LEVSSPGidR  101 (192)
                      +|||||||++|
T Consensus        81 ~LEVSSPGl~R   91 (91)
T 1ib8_A           81 FLEITSPGLER   91 (91)
T ss_dssp             EEEEECCSSSS
T ss_pred             EEEEECCCCCC
T ss_conf             99995799987



>1ib8_A (A:92-164) Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} Back     alignment and structure