254780790

254780790

hypothetical protein CLIBASIA_03405

GeneID in NCBI database:8209796Locus tag:CLIBASIA_03405
Protein GI in NCBI database:254780790Protein Accession:YP_003065203.1
Gene range:+(470431, 470820)Protein Length:129aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED4 TM-Helix
HMMTOP4 TM-Helix
MEMSAT4 TM-Helix
MEMSAT_SVM4 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIKK
ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEcc
MKQCIIFIINIVVVFFIDVMGFFILMkcgadpfysRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIKK
MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIKK
MKQCiifiinivvvffiDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKllltfqglqpllATVLSAVSSMLFVFLLYIRFMTRRVYFIKK
*KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIK*
MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIKK
MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIKK
iiiiHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIKK
MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIKK
MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target129 hypothetical protein CLIBASIA_03405 [Candidatus Liberib
315122012129 hypothetical protein CKC_01310 [Candidatus Liberibacter 1 2e-31
86355931124 hypothetical protein RHE_CH00273 [Rhizobium etli CFN 42 1 7e-12
190889939124 hypothetical protein [Rhizobium etli CIAT 652] Length = 1 2e-11
218508679131 hypothetical conserved membrane protein [Rhizobium etli 1 5e-11
222147132124 GtrA family protein [Agrobacterium vitis S4] Length = 1 1 6e-10
241207226125 GtrA family protein [Rhizobium leguminosarum bv. trifol 1 1e-05
116250047125 transmembrane protein [Rhizobium leguminosarum bv. vici 1 2e-05
222084545128 hypothetical protein Arad_0461 [Agrobacterium radiobact 1 8e-05
209551848125 GtrA family protein [Rhizobium leguminosarum bv. trifol 1 1e-04
170695656128 GtrA family protein [Burkholderia graminis C4D1M] Lengt 1 3e-04
>gi|315122012|ref|YP_004062501.1| hypothetical protein CKC_01310 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 129 Back     alignment and organism information
 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/112 (59%), Positives = 87/112 (77%)

Query: 18  DVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFML 77
           D+ GF +LMK G D  +SR FS+A+AFL TW P+RLF+F KLRR+SF+ETVRYG++ F  
Sbjct: 18  DLFGFVLLMKYGVDSLWSRRFSMAIAFLTTWKPNRLFVFFKLRRRSFVETVRYGIVAFFS 77

Query: 78  SILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVYFIKK 129
           SILNY  YVKLL+TF G+QPLL  ++S + +M+FVFLLY R + +  YFIKK
Sbjct: 78  SILNYVIYVKLLITFPGIQPLLVVIVSTIPTMIFVFLLYFRLIVKGSYFIKK 129


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86355931|ref|YP_467823.1| hypothetical protein RHE_CH00273 [Rhizobium etli CFN 42] Length = 124 Back     alignment and organism information
>gi|190889939|ref|YP_001976481.1| hypothetical protein [Rhizobium etli CIAT 652] Length = 124 Back     alignment and organism information
>gi|218508679|ref|ZP_03506557.1| hypothetical conserved membrane protein [Rhizobium etli Brasil 5] Length = 131 Back     alignment and organism information
>gi|222147132|ref|YP_002548089.1| GtrA family protein [Agrobacterium vitis S4] Length = 124 Back     alignment and organism information
>gi|241207226|ref|YP_002978322.1| GtrA family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 125 Back     alignment and organism information
>gi|116250047|ref|YP_765885.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 125 Back     alignment and organism information
>gi|222084545|ref|YP_002543074.1| hypothetical protein Arad_0461 [Agrobacterium radiobacter K84] Length = 128 Back     alignment and organism information
>gi|209551848|ref|YP_002283765.1| GtrA family protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 125 Back     alignment and organism information
>gi|170695656|ref|ZP_02886799.1| GtrA family protein [Burkholderia graminis C4D1M] Length = 128 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target129 hypothetical protein CLIBASIA_03405 [Candidatus Liberib
pfam04138116 pfam04138, GtrA, GtrA-like protein 0.004
>gnl|CDD|146661 pfam04138, GtrA, GtrA-like protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 129 hypothetical protein CLIBASIA_03405 [Candidatus Liberib
pfam04138116 GtrA GtrA-like protein. Members of this family are pred 99.92
COG2246139 Predicted membrane protein [Function unknown] 99.91
pfam04138116 GtrA GtrA-like protein. Members of this family are pred 98.41
COG2246139 Predicted membrane protein [Function unknown] 98.28
>pfam04138 GtrA GtrA-like protein Back     alignment and domain information
>COG2246 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam04138 GtrA GtrA-like protein Back     alignment and domain information
>COG2246 Predicted membrane protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00