254780796

254780796

ribonuclease H

GeneID in NCBI database:8209802Locus tag:CLIBASIA_03435
Protein GI in NCBI database:254780796Protein Accession:YP_003065209.1
Gene range:-(462587, 463045)Protein Length:152aa
Gene description:ribonuclease H
COG prediction:[L] Ribonuclease HI
KEGG prediction:rnhA; ribonuclease H (EC:3.1.26.4); K03469 ribonuclease HI [EC:3.1.26.4]
SEED prediction:Ribonuclease HI (EC 3.1.26.4)
Pathway involved in KEGG:DNA replication [PATH:las03030]
Subsystem involved in SEED:Ribonuclease H;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MDSKHLREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVSFKNKI
ccccccccEEEEEcccccccccccEEEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHcc
ccHHHcccEEEEEEEEEccccEEEEEEEEEEEccEEEEEEEEEEEEcHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHcHHHHHHcccEcccccEcccHHHHHHHHHHHcccEEEEEEccHHHccHHHHHHHHHHHHHHccHcccc
mdskhlrevhaytdgacsgnpgpggwgVLLRYKGkekiisggekettNNRMELMAAIKALTALKYPCKVLLytdssyvhkGFSQWIKKWQqngwktsdkktVKNIDLWMKFVEASAQHKVDLYWIkghagnqeneKVDRIARNAAVSFKNKI
MDSKHLREVHAytdgacsgnpgpGGWGVLLRYKGKEKIisggekettnnRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKwqqngwktsdkKTVKNIDLWMKFVEASAQHKVDLYWIKGHagnqenekvdrIARNAAVSFKNKI
MDSKHLREVHAYTDGACSGNPGPGGWGVLLRYkgkekiisggekeTTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVSFKNKI
*****LR**HAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAV******
********VHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVSFKNKI
*D*KHLREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSKHLREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVSFKNKI
MDSKHLREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVSFKNKI
MDSKHLREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVSFKNKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target152 ribonuclease H [Candidatus Liberibacter asiaticus str.
222085133146 ribonuclease H protein [Agrobacterium radiobacter K84] 1 3e-48
86356609151 ribonuclease H [Rhizobium etli CFN 42] Length = 151 1 3e-48
17987740154 ribonuclease H [Brucella melitensis bv. 1 str. 16M] Len 1 4e-48
307294522148 ribonuclease H [Sphingobium chlorophenolicum L-1] Lengt 1 5e-48
218462362151 ribonuclease H [Rhizobium etli Kim 5] Length = 151 1 6e-48
315122018138 ribonuclease H [Candidatus Liberibacter solanacearum CL 1 2e-47
190890679151 ribonuclease H protein [Rhizobium etli CIAT 652] Length 1 2e-47
294012805148 ribonuclease HI [Sphingobium japonicum UT26S] Length = 1 3e-47
327192538151 ribonuclease H protein [Rhizobium etli CNPAF512] Length 1 4e-47
13476236177 ribonuclease H [Mesorhizobium loti MAFF303099] Length = 1 6e-47
>gi|222085133|ref|YP_002543663.1| ribonuclease H protein [Agrobacterium radiobacter K84] Length = 146 Back     alignment and organism information
 Score =  194 bits (493), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 90/146 (61%), Positives = 110/146 (75%)

Query: 6   LREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKY 65
           +++V  +TDGACSGNPGPGGWG +LRY  KEK + GGE ETTNNRMELMAAI +L ALK 
Sbjct: 1   MKQVDIFTDGACSGNPGPGGWGAVLRYGDKEKELFGGEAETTNNRMELMAAISSLNALKS 60

Query: 66  PCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWI 125
           PC+V LYTDS YV  G S+WI  W++NGWKT+DKK VKN +LW    EA  +H+V L+W+
Sbjct: 61  PCEVNLYTDSKYVMDGISKWIFGWKKNGWKTADKKPVKNAELWQALEEARNRHQVTLHWV 120

Query: 126 KGHAGNQENEKVDRIARNAAVSFKNK 151
           KGHAG+ ENE+ D +AR     FK K
Sbjct: 121 KGHAGHPENERADELARKGMEPFKRK 146


Species: Agrobacterium tumefaciens
Genus: Agrobacterium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86356609|ref|YP_468501.1| ribonuclease H [Rhizobium etli CFN 42] Length = 151 Back     alignment and organism information
>gi|17987740|ref|NP_540374.1| ribonuclease H [Brucella melitensis bv. 1 str. 16M] Length = 154 Back     alignment and organism information
>gi|307294522|ref|ZP_07574364.1| ribonuclease H [Sphingobium chlorophenolicum L-1] Length = 148 Back     alignment and organism information
>gi|218462362|ref|ZP_03502453.1| ribonuclease H [Rhizobium etli Kim 5] Length = 151 Back     alignment and organism information
>gi|315122018|ref|YP_004062507.1| ribonuclease H [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 138 Back     alignment and organism information
>gi|190890679|ref|YP_001977221.1| ribonuclease H protein [Rhizobium etli CIAT 652] Length = 151 Back     alignment and organism information
>gi|294012805|ref|YP_003546265.1| ribonuclease HI [Sphingobium japonicum UT26S] Length = 148 Back     alignment and organism information
>gi|327192538|gb|EGE59489.1| ribonuclease H protein [Rhizobium etli CNPAF512] Length = 151 Back     alignment and organism information
>gi|13476236|ref|NP_107806.1| ribonuclease H [Mesorhizobium loti MAFF303099] Length = 177 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 ribonuclease H [Candidatus Liberibacter asiaticus str.
PRK00203150 PRK00203, rnhA, ribonuclease H; Reviewed 2e-68
cd06222130 cd06222, RnaseH, RNase H (RNase HI) is an endonuclease 6e-32
pfam00075126 pfam00075, RnaseH, RNase H 3e-28
PRK06548161 PRK06548, PRK06548, ribonuclease H; Provisional 1e-15
KOG3752371 KOG3752, KOG3752, KOG3752, Ribonuclease H [Replication, 5e-15
PRK13907128 PRK13907, rnhA, ribonuclease H; Provisional 3e-04
COG0328154 COG0328, RnhA, Ribonuclease HI [DNA replication, recomb 2e-43
PRK08719147 PRK08719, PRK08719, ribonuclease H; Reviewed 8e-18
>gnl|CDD|178927 PRK00203, rnhA, ribonuclease H; Reviewed Back     alignment and domain information
>gnl|CDD|119393 cd06222, RnaseH, RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner Back     alignment and domain information
>gnl|CDD|143857 pfam00075, RnaseH, RNase H Back     alignment and domain information
>gnl|CDD|75628 PRK06548, PRK06548, ribonuclease H; Provisional Back     alignment and domain information
>gnl|CDD|38956 KOG3752, KOG3752, KOG3752, Ribonuclease H [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|139967 PRK13907, rnhA, ribonuclease H; Provisional Back     alignment and domain information
>gnl|CDD|30676 COG0328, RnhA, Ribonuclease HI [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|169558 PRK08719, PRK08719, ribonuclease H; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 152 ribonuclease H [Candidatus Liberibacter asiaticus str.
PRK00203150 rnhA ribonuclease H; Reviewed 100.0
PRK06548161 ribonuclease H; Provisional 100.0
PRK08719147 ribonuclease H; Reviewed 100.0
COG0328154 RnhA Ribonuclease HI [DNA replication, recombination, a 100.0
KOG3752371 consensus 100.0
pfam00075126 RnaseH RNase H. RNase H digests the RNA strand of an RN 100.0
PRK13907128 rnhA ribonuclease H; Provisional 99.95
cd06222130 RnaseH RNase H (RNase HI) is an endonuclease that cleav 99.94
PRK07238 375 bifunctional RNase H/acid phosphatase; Provisional 99.93
PRK07708219 hypothetical protein; Validated 99.76
pfam05380159 Peptidase_A17 Pao retrotransposon peptidase. Correspond 92.18
>PRK00203 rnhA ribonuclease H; Reviewed Back     alignment and domain information
>PRK06548 ribonuclease H; Provisional Back     alignment and domain information
>PRK08719 ribonuclease H; Reviewed Back     alignment and domain information
>COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3752 consensus Back     alignment and domain information
>pfam00075 RnaseH RNase H Back     alignment and domain information
>PRK13907 rnhA ribonuclease H; Provisional Back     alignment and domain information
>cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PRK07708 hypothetical protein; Validated Back     alignment and domain information
>pfam05380 Peptidase_A17 Pao retrotransposon peptidase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target152 ribonuclease H [Candidatus Liberibacter asiaticus str.
1rbr_A155 Structural Study Of Mutants Of Escherichia Coli Rib 5e-32
3aa3_A155 A52l E. Coli Rnase Hi Length = 155 7e-32
1lav_A155 Stabilization Of Escherichia Coli Ribonuclease Hi B 7e-32
1rnh_A155 Structure Of Ribonuclease H Phased At 2 Angstroms R 7e-32
3aa4_A155 A52v E.Coli Rnase Hi Length = 155 7e-32
3aa2_A155 A52i E. Coli Rnase Hi Length = 155 9e-32
1rch_A155 Solution Nmr Structure Of Ribonuclease Hi From Esch 9e-32
1rbt_A155 Structural Study Of Mutants Of Escherichia Coli Rib 9e-32
1rbs_A155 Structural Study Of Mutants Of Escherichia Coli Rib 9e-32
1rdb_A155 Crystal Structures Of Ribonuclease Hi Active Site M 9e-32
1rbv_A155 Structural Study Of Mutants Of Escherichia Coli Rib 9e-32
1rbu_A155 Structural Study Of Mutants Of Escherichia Coli Rib 1e-31
1gob_A155 Cooperative Stabilization Of Escherichia Coli Ribon 1e-31
1law_A155 Stabilization Of Escherichia Coli Ribonuclease Hi B 1e-31
3aa5_X155 A52f E.Coli Rnase Hi Length = 155 1e-31
1wsh_A155 Crystal Structure Of E.Coli Rnase Hi Active Site Mu 1e-31
2z1h_A155 Crystal Structure Of E.Coli Rnase Hi Surface Charge 3e-31
1rdc_A155 Crystal Structures Of Ribonuclease Hi Active Site M 5e-31
1f21_A155 Divalent Metal Cofactor Binding In The Kinetic Fold 5e-31
1g15_A155 Co-Crystal Of E. Coli Rnase Hi With Two Mn2+ Ions B 5e-31
1kvc_A155 E. Coli Ribonuclease Hi D134n Mutant Length = 155 2e-30
1kvb_A155 E. Coli Ribonuclease Hi D134h Mutant Length = 155 2e-30
2yv0_X155 Structural And Thermodynamic Analyses Of E. Coli Ri 2e-30
2z1j_A155 Crystal Structure Of E.Coli Rnase Hi Surface Charge 2e-30
1goa_A156 Cooperative Stabilization Of Escherichia Coli Ribon 2e-30
1rda_A155 Crystal Structures Of Ribonuclease Hi Active Site M 2e-30
1goc_A156 Cooperative Stabilization Of Escherichia Coli Ribon 2e-30
1wsi_A155 Crystal Structure Of E.Coli Rnase Hi Active Site Mu 2e-30
2z1g_A155 Crystal Structure Of E.Coli Rnase Hi Surface Charge 2e-30
1wsj_A155 Crystal Structure Of E.Coli Rnase Hi Active Site Mu 2e-30
1kva_A155 E. Coli Ribonuclease Hi D134a Mutant Length = 155 2e-30
1wsf_A155 Co-Crystal Structure Of E.Coli Rnase Hi Active Site 3e-30
1jxb_A155 I53a, A Point Mutant Of The Cysteine-Free Variant O 3e-30
2z1i_A155 Crystal Structure Of E.Coli Rnase Hi Surface Charge 3e-30
1jl1_A155 D10a E. Coli Ribonuclease Hi Length = 155 2e-29
2e4l_A158 Thermodynamic And Structural Analysis Of Thermolabi 4e-29
1ril_A166 Crystal Structure Of Ribonuclease H From Thermus Th 6e-29
1jl2_A156 Crystal Structure Of Tceo Rnase H-A Chimera Combini 6e-29
2zqb_A158 Crystal Structure Of A Psychrotrophic Rnasehi Varia 1e-28
3h08_A146 Crystal Structure Of The Ribonuclease H1 From Chlor 8e-27
2qkb_A154 Human Rnase H Catalytic Domain Mutant D210n In Comp 1e-17
2qk9_A154 Human Rnase H Catalytic Domain Mutant D210n In Comp 1e-17
3hyf_A150 Crystal Structure Of Hiv-1 Rnase H P15 With Enginee 3e-09
2rpi_A112 The Nmr Structure Of The Submillisecond Folding Int 9e-09
3hst_B141 N-Terminal Rnase H Domain Of Rv2228c From Mycobacte 1e-06
3p1g_A165 Crystal Structure Of The Xenotropic Murine Leukemia 7e-04
1ikv_A560 K103n Mutant Hiv-1 Reverse Transcriptase In Complex 0.001
1ikw_A560 Wild Type Hiv-1 Reverse Transcriptase In Complex Wi 0.001
3klh_A564 Crystal Structure Of Azt-Resistant Hiv-1 Reverse Tr 0.002
3lp3_A138 P15 Hiv Rnaseh Domain With Inhibitor Mk3 Length = 1 0.002
3k2p_A136 Hiv-1 Reverse Transcriptase Isolated Rnaseh Domain 0.002
2iaj_A560 Crystal Structure Of K103nY181C MUTANT HIV-1 Revers 0.002
1s6p_A560 Crystal Structure Of Human Immunodeficiency Virus T 0.002
1hrh_A136 Crystal Structure Of The Ribonuclease H Domain Of H 0.002
1rdh_A146 Crystallographic Analyses Of An Active Hiv-1 Ribonu 0.002
1hmv_A560 The Structure Of Unliganded Reverse Transcriptase F 0.002
1hpz_A560 Human Immunodeficiency Virus Type 1 Length = 560 0.002
1mu2_A555 Crystal Structure Of Hiv-2 Reverse Transcriptase Le 0.002
3kle_A562 Crystal Structure Of Azt-Resistant Hiv-1 Reverse Tr 0.002
3jsm_A558 K65r Mutant Hiv-1 Reverse Transcriptase Cross-Linke 0.002
1hni_A558 Structure Of Hiv-1 Reverse Transcriptase In A Compl 0.002
1uwb_A558 Tyr 181 Cys Hiv-1 Rt8-Cl Tibo Length = 558 0.002
1qe1_A558 Crystal Structure Of 3tc-Resistant M184i Mutant Of 0.002
1n5y_A558 Hiv-1 Reverse Transcriptase Crosslinked To Post- Tr 0.002
2hb5_A164 Crystal Structure Of The Moloney Murine Leukemia Vi 0.003
2kq2_A147 Solution Nmr Structure Of The Apo Form Of A Ribonuc 0.003
>gi|157833638|pdb|1RBR|A Chain A, Structural Study Of Mutants Of Escherichia Coli Ribonuclease Hi With Enhanced Thermostability Length = 155 Back     alignment and structure
 Score =  140 bits (353), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 83/142 (58%), Positives = 108/142 (76%)

Query: 6   LREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKY 65
           L++V  +TDG+C GNPGPGG+G +LRY+G+EK  S G   TTNNRMELMAAI AL ALK 
Sbjct: 2   LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKE 61

Query: 66  PCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWI 125
           PC+V+L TDS YV +G +QWI  W++ GWKT+DKK VKN+DLW +   A  QH++   W+
Sbjct: 62  PCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWV 121

Query: 126 KGHAGNQENEKVDRIARNAAVS 147
           KGHAG+ ENE+ D +AR AA++
Sbjct: 122 KGHAGHPENERCDELARAAAMN 143


>gi|308198440|pdb|3AA3|A Chain A, A52l E. Coli Rnase Hi Length = 155 Back     alignment and structure
>gi|157831759|pdb|1LAV|A Chain A, Stabilization Of Escherichia Coli Ribonuclease Hi By Cavity- Filling Mutations Within A Hydrophobic Core Length = 155 Back     alignment and structure
>gi|157833712|pdb|1RNH|A Chain A, Structure Of Ribonuclease H Phased At 2 Angstroms Resolution By Mad Analysis Of The Selenomethionyl Protein Length = 155 Back     alignment and structure
>gi|308198441|pdb|3AA4|A Chain A, A52v E.Coli Rnase Hi Length = 155 Back     alignment and structure
>gi|308198439|pdb|3AA2|A Chain A, A52i E. Coli Rnase Hi Length = 155 Back     alignment and structure
gi|157833653|pdb|1RCH|A Chain A, Solution Nmr Structure Of Ribonuclease Hi From Escherichia Coli, 8 Structures Length = 155 Back     alignment and structure
>gi|157833640|pdb|1RBT|A Chain A, Structural Study Of Mutants Of Escherichia Coli Ribonuclease Hi With Enhanced Thermostability Length = 155 Back     alignment and structure
>gi|157833639|pdb|1RBS|A Chain A, Structural Study Of Mutants Of Escherichia Coli Ribonuclease Hi With Enhanced Thermostability Length = 155 Back     alignment and structure
>gi|157833659|pdb|1RDB|A Chain A, Crystal Structures Of Ribonuclease Hi Active Site Mutants From Escherichia Coli Length = 155 Back     alignment and structure
>gi|157833642|pdb|1RBV|A Chain A, Structural Study Of Mutants Of Escherichia Coli Ribonuclease Hi With Enhanced Thermostability Length = 155 Back     alignment and structure
>gi|157833641|pdb|1RBU|A Chain A, Structural Study Of Mutants Of Escherichia Coli Ribonuclease Hi With Enhanced Thermostability Length = 155 Back     alignment and structure
>gi|157831220|pdb|1GOB|A Chain A, Cooperative Stabilization Of Escherichia Coli Ribonuclease Hi By Insertion Of Gly-80b And Gly-77-> Ala Substitution Length = 155 Back     alignment and structure
>gi|157831760|pdb|1LAW|A Chain A, Stabilization Of Escherichia Coli Ribonuclease Hi By Cavity- Filling Mutations Within A Hydrophobic Core Length = 155 Back     alignment and structure
>gi|308198442|pdb|3AA5|X Chain X, A52f E.Coli Rnase Hi Length = 155 Back     alignment and structure
>gi|56966975|pdb|1WSH|A Chain A, Crystal Structure Of E.Coli Rnase Hi Active Site Mutant (E48aK87A) Length = 155 Back     alignment and structure
>gi|160286375|pdb|2Z1H|A Chain A, Crystal Structure Of E.Coli Rnase Hi Surface Charged Mutant(Q4rT92KQ105KQ113RQ115KN143KT145K) Length = 155 Back     alignment and structure
>gi|157833660|pdb|1RDC|A Chain A, Crystal Structures Of Ribonuclease Hi Active Site Mutants From Escherichia Coli Length = 155 Back     alignment and structure
>gi|12084647|pdb|1F21|A Chain A, Divalent Metal Cofactor Binding In The Kinetic Folding Trajectory Of E. Coli Ribonuclease Hi Length = 155 Back     alignment and structure
>gi|13787086|pdb|1G15|A Chain A, Co-Crystal Of E. Coli Rnase Hi With Two Mn2+ Ions Bound In The The Active Site Length = 155 Back     alignment and structure
>gi|157831636|pdb|1KVC|A Chain A, E. Coli Ribonuclease Hi D134n Mutant Length = 155 Back     alignment and structure
>gi|157831635|pdb|1KVB|A Chain A, E. Coli Ribonuclease Hi D134h Mutant Length = 155 Back     alignment and structure
>gi|170292440|pdb|2YV0|X Chain X, Structural And Thermodynamic Analyses Of E. Coli Ribonuclease Hi Variant With Quintuple Thermostabilizing Mutations Length = 155 Back     alignment and structure
>gi|160286380|pdb|2Z1J|A Chain A, Crystal Structure Of E.Coli Rnase Hi Surface Charged Mutant(Q4rT40EQ72HQ76KQ80ET92KQ105KQ113RQ115KN143K T145K) Length = 155 Back     alignment and structure
>gi|157831219|pdb|1GOA|A Chain A, Cooperative Stabilization Of Escherichia Coli Ribonuclease Hi By Insertion Of Gly-80b And Gly-77-> Ala Substitution Length = 156 Back     alignment and structure
>gi|157833658|pdb|1RDA|A Chain A, Crystal Structures Of Ribonuclease Hi Active Site Mutants From Escherichia Coli Length = 155 Back     alignment and structure
>gi|157831221|pdb|1GOC|A Chain A, Cooperative Stabilization Of Escherichia Coli Ribonuclease Hi By Insertion Of Gly-80b And Gly-77-> Ala Substitution Length = 156 Back     alignment and structure
>gi|56966979|pdb|1WSI|A Chain A, Crystal Structure Of E.Coli Rnase Hi Active Site Mutant (E48aK87AD134N) Length = 155 Back     alignment and structure
>gi|160286373|pdb|2Z1G|A Chain A, Crystal Structure Of E.Coli Rnase Hi Surface Charged Mutant(Q4rT40EQ72HQ76KQ80ET92KQ105K) Length = 155 Back     alignment and structure
>gi|56966983|pdb|1WSJ|A Chain A, Crystal Structure Of E.Coli Rnase Hi Active Site Mutant (K87aH124A) Length = 155 Back     alignment and structure
>gi|157831634|pdb|1KVA|A Chain A, E. Coli Ribonuclease Hi D134a Mutant Length = 155 Back     alignment and structure
>gi|61680233|pdb|1WSF|A Chain A, Co-Crystal Structure Of E.Coli Rnase Hi Active Site Mutant (D134a) With Mn2+ Length = 155 Back     alignment and structure
>gi|20150576|pdb|1JXB|A Chain A, I53a, A Point Mutant Of The Cysteine-Free Variant Of E. Coli Rnase Hi Length = 155 Back     alignment and structure
>gi|160286377|pdb|2Z1I|A Chain A, Crystal Structure Of E.Coli Rnase Hi Surface Charged Mutant(Q4rT40EQ72HQ76KQ80ET92KQ105KQ113RQ115K) Length = 155 Back     alignment and structure
>gi|20150465|pdb|1JL1|A Chain A, D10a E. Coli Ribonuclease Hi Length = 155 Back     alignment and structure
gi|146386464|pdb|2E4L|A Chain A, Thermodynamic And Structural Analysis Of Thermolabile Rnase Hi From Shewanella Oneidensis Mr-1 Length = 158 Back     alignment and structure
gi|157833693|pdb|1RIL|A Chain A, Crystal Structure Of Ribonuclease H From Thermus Thermophilus Hb8 Refined At 2.8 Angstroms Resolution Length = 166 Back     alignment and structure
>gi|18655792|pdb|1JL2|A Chain A, Crystal Structure Of Tceo Rnase H-A Chimera Combining The Folding Core From T. Thermophilus Rnase H And The Remaining Region Of E. Coli Rnase H Length = 156 Back     alignment and structure
>gi|241913131|pdb|2ZQB|A Chain A, Crystal Structure Of A Psychrotrophic Rnasehi Variant With Sextuple Thermostabilizing Mutations Length = 158 Back     alignment and structure
>gi|237640632|pdb|3H08|A Chain A, Crystal Structure Of The Ribonuclease H1 From Chlorobium Tepidum Length = 146 Back     alignment and structure
>gi|160285882|pdb|2QKB|A Chain A, Human Rnase H Catalytic Domain Mutant D210n In Complex With 20-Mer RnaDNA HYBRID Length = 154 Back     alignment and structure
>gi|160285878|pdb|2QK9|A Chain A, Human Rnase H Catalytic Domain Mutant D210n In Complex With 18-Mer RnaDNA HYBRID Length = 154 Back     alignment and structure
>gi|261824988|pdb|3HYF|A Chain A, Crystal Structure Of Hiv-1 Rnase H P15 With Engineered E. Coli Loop And Active Site Inhibitor Length = 150 Back     alignment and structure
>gi|226192573|pdb|2RPI|A Chain A, The Nmr Structure Of The Submillisecond Folding Intermediate Of The Thermus Thermophilus Ribonuclease H Length = 112 Back     alignment and structure
>gi|295321673|pdb|3HST|B Chain B, N-Terminal Rnase H Domain Of Rv2228c From Mycobacterium Tube As A Fusion Protein With Maltose Binding Protein Length = 141 Back     alignment and structure
>gi|308388210|pdb|3P1G|A Chain A, Crystal Structure Of The Xenotropic Murine Leukemia Virus-Related Virus (Xmrv) Rnase H Domain Length = 165 Back     alignment and structure
>gi|14488552|pdb|1IKV|A Chain A, K103n Mutant Hiv-1 Reverse Transcriptase In Complex With Efivarenz Length = 560 Back     alignment and structure
>gi|14488554|pdb|1IKW|A Chain A, Wild Type Hiv-1 Reverse Transcriptase In Complex With Efavirenz Length = 560 Back     alignment and structure
>gi|307568197|pdb|3KLH|A Chain A, Crystal Structure Of Azt-Resistant Hiv-1 Reverse Transcriptase Crosslinked To Post-Translocation Aztmp-Terminated Dna (Complex P) Length = 564 Back     alignment and structure
>gi|297787684|pdb|3LP3|A Chain A, P15 Hiv Rnaseh Domain With Inhibitor Mk3 Length = 138 Back     alignment and structure
>gi|288563039|pdb|3K2P|A Chain A, Hiv-1 Reverse Transcriptase Isolated Rnaseh Domain With The Inhibitor Beta-Thujaplicinol Bound At The Active Site Length = 136 Back     alignment and structure
>gi|122920579|pdb|2IAJ|A Chain A, Crystal Structure Of K103nY181C MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Atp Length = 560 Back     alignment and structure
>gi|49258902|pdb|1S6P|A Chain A, Crystal Structure Of Human Immunodeficiency Virus Type 1 Reverse Transcriptase (Rt) In Complex With Janssen-R100943 Length = 560 Back     alignment and structure
>gi|230011|pdb|1HRH|A Chain A, Crystal Structure Of The Ribonuclease H Domain Of Hiv-1 Reverse Transcriptase Length = 136 Back     alignment and structure
>gi|576255|pdb|1RDH|A Chain A, Crystallographic Analyses Of An Active Hiv-1 Ribonuclease H Domain Show Structural Features That Distinguish It From The Inactive Form Length = 146 Back     alignment and structure
>gi|999814|pdb|1HMV|A Chain A, The Structure Of Unliganded Reverse Transcriptase From The Human Immunodeficiency Virus Type 1 Length = 560 Back     alignment and structure
>gi|14488665|pdb|1HPZ|A Chain A, Human Immunodeficiency Virus Type 1 Length = 560 Back     alignment and structure
>gi|24987805|pdb|1MU2|A Chain A, Crystal Structure Of Hiv-2 Reverse Transcriptase Length = 555 Back     alignment and structure
>gi|307568157|pdb|3KLE|A Chain A, Crystal Structure Of Azt-Resistant Hiv-1 Reverse Transcriptase Crosslinked To A Dsdna With A Bound Excision Product, Aztppppa Length = 562 Back     alignment and structure
>gi|260100193|pdb|3JSM|A Chain A, K65r Mutant Hiv-1 Reverse Transcriptase Cross-Linked To Ds- Dna And Complexed With Tenofovir-Diphosphate As The Incoming Nucleotide Substrate Length = 558 Back     alignment and structure
>gi|1065287|pdb|1HNI|A Chain A, Structure Of Hiv-1 Reverse Transcriptase In A Complex With The Nonnucleoside Inhibitor Alpha-Apa R 95845 At 2.8 Angstroms Resolution Length = 558 Back     alignment and structure
>gi|2194007|pdb|1UWB|A Chain A, Tyr 181 Cys Hiv-1 Rt8-Cl Tibo Length = 558 Back     alignment and structure
>gi|5822251|pdb|1QE1|A Chain A, Crystal Structure Of 3tc-Resistant M184i Mutant Of Hiv-1 Reverse Transcriptase Length = 558 Back     alignment and structure
>gi|28373910|pdb|1N5Y|A Chain A, Hiv-1 Reverse Transcriptase Crosslinked To Post- Translocation Aztmp-Terminated Dna (Complex P) Length = 558 Back     alignment and structure
>gi|114794305|pdb|2HB5|A Chain A, Crystal Structure Of The Moloney Murine Leukemia Virus Rnase H Domain Length = 164 Back     alignment and structure
>gi|291190980|pdb|2KQ2|A Chain A, Solution Nmr Structure Of The Apo Form Of A Ribonuclease H Domain Of Protein Dsy1790 From Desulfitobacterium Hafniense, Northeast Structural Genomics Target Dhr1a Length = 147 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target152 ribonuclease H [Candidatus Liberibacter asiaticus str.
1jl1_A155 Ribonuclease HI; RNAse HI, protein stability, thermosta 5e-39
2e4l_A158 Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 7e-30
3h08_A146 RNH (ribonuclease H); RNAse H, 3D-structure, endonuclea 9e-30
1ril_A166 Ribonuclease H; hydrolase(endoribonuclease); 2.80A {The 1e-29
1mu2_A555 HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase 3e-29
1zbf_A142 Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid 3e-28
2kq2_A147 Ribonuclease H-related protein; PSI, NESG, protein stru 8e-28
3p1g_A165 Xenotropic murine leukemia virus-related virus (X H dom 8e-27
3hyf_A150 Reverse transcriptase/rnaseh; HIV-1, hydrolase, DI-vale 1e-26
2zd1_A557 Reverse transcriptase/ribonuclease H; P51/P66, hetero d 1e-25
3hst_B141 Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-term 1e-23
2qkb_A154 Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 3e-22
2hb5_A164 Reverse transcriptase/ribonuclease H; RNAse H, hydrolas 2e-19
2ehg_A149 Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, 6e-17
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 0.004
>1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 1rbv_A 1rbt_A 1rbs_A 1kva_A 1kvb_A ... Length = 155 Back     alignment and structure
 Score =  154 bits (391), Expect = 5e-39
 Identities = 79/140 (56%), Positives = 102/140 (72%)

Query: 6   LREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKY 65
           L++V  +T G+  GNPGPGG+G +LRY+G+EK  S G   TTNNRMELMAAI AL ALK 
Sbjct: 2   LKQVEIFTAGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKE 61

Query: 66  PCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWI 125
             +V+L TDS YV +G +QWI  W++ GWKT+DKK VKN+DLW +   A  QH++   W+
Sbjct: 62  HAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWV 121

Query: 126 KGHAGNQENEKVDRIARNAA 145
           KGHAG+ ENE+ D +AR AA
Sbjct: 122 KGHAGHPENERADELARAAA 141


>2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis mr-1} PDB: 2zqb_A Length = 158 Back     alignment and structure
>3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} Length = 146 Back     alignment and structure
>1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A Length = 166 Back     alignment and structure
>1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B Length = 555 Back     alignment and structure
>1zbf_A Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans c-125} SCOP: c.55.3.1 PDB: 1zbi_A 2g8u_A 2g8i_A 2g8h_A 2g8k_A 2g8f_A 2g8v_A 2g8w_A 3ey1_A* 1zbl_A 3d0p_A* 3i8d_A* 2r7y_A* Length = 142 Back     alignment and structure
>2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A Length = 147 Back     alignment and structure
>3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 2hb5_A Length = 165 Back     alignment and structure
>3hyf_A Reverse transcriptase/rnaseh; HIV-1, hydrolase, DI-valent metal nucleic acid cleavage mechanism, DI-valent metal coordination; HET: ON1; 1.70A {Human immunodeficiency virus 1} PDB: 1o1w_A 1hrh_A 1rdh_A Length = 150 Back     alignment and structure
>2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 2ze2_A* 3bgr_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* 1tvr_A* 2hmi_A* 2vg5_A* 2vg6_A* 2vg7_A* ... Length = 557 Back     alignment and structure
>3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} Length = 141 Back     alignment and structure
>2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* Length = 154 Back     alignment and structure
>2hb5_A Reverse transcriptase/ribonuclease H; RNAse H, hydrolase; 1.59A {Moloney murine leukemia virus} Length = 164 Back     alignment and structure
>2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, double-stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii str} Length = 149 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 ribonuclease H [Candidatus Liberibacter asiaticus str.
1jl1_A155 Ribonuclease HI; RNAse HI, protein stability, thermosta 100.0
2e4l_A158 Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 100.0
1ril_A166 Ribonuclease H; hydrolase(endoribonuclease); 2.80A {The 100.0
2qkb_A154 Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 100.0
3h08_A146 RNH (ribonuclease H); RNAse H, 3D-structure, endonuclea 100.0
3hyf_A150 Reverse transcriptase/rnaseh; HIV-1, hydrolase, DI-vale 100.0
3p1g_A165 Xenotropic murine leukemia virus-related virus (X H dom 99.98
1mu2_A555 HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase 99.97
1zbf_A142 Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid 99.96
2kq2_A147 Ribonuclease H-related protein; PSI, NESG, protein stru 99.96
2zd1_A557 Reverse transcriptase/ribonuclease H; P51/P66, hetero d 99.95
3hst_B141 Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-term 99.95
2ehg_A149 Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, 99.93
1rw3_A455 POL polyprotein; RNA and DNA dependent DNA polymerase, 93.21
>1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 1rbv_A 1rbt_A 1rbs_A 1kva_A 1kvb_A ... Back     alignment and structure
Probab=100.00  E-value=1.1e-43  Score=264.50  Aligned_cols=143  Identities=55%  Similarity=0.992  Sum_probs=136.2

Q ss_pred             CCCEEEEEECCCCCCCCCCCEEEEEEECCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCCC
Q ss_conf             78889999664757999821899999618812786022276630278999999864113454037884064550325652
Q gi|254780796|r    5 HLREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQ   84 (152)
Q Consensus         5 ~~~~i~IytDGS~~~n~~~aG~g~v~~~~~~~~~~~~~~~~~Tnn~aEl~Ai~~AL~~~~~~~~i~I~tDS~yvv~~i~~   84 (152)
                      .|+.|.|||||||++|||++|||+|+..++....+++....+|||+|||.|++.||+++.....+.|+|||+|++++++.
T Consensus         1 ~~~~i~IYtDGS~~~N~g~~G~G~vi~~~~~~~~~~~~~~~~Tnn~aEl~Ai~~Al~~~~~~~~~~i~tds~~~i~~~~~   80 (155)
T 1jl1_A            1 MLKQVEIFTAGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHAEVILSTDSQYVRQGITQ   80 (155)
T ss_dssp             --CCEEEEEEEEESSTTEEEEEEEEEEETTEEEEEEEEEEEECHHHHHHHHHHHHHHTCCSCCEEEEEECCHHHHHHHHT
T ss_pred             CCCEEEEEECCCCCCCCCCEEEEEEEEECCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHH
T ss_conf             99659999836888999826999999989968999547686657999999998777765224227998416888776568


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             256776543200355642110002345410222105589801788884558999999999998
Q gi|254780796|r   85 WIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVS  147 (152)
Q Consensus        85 ~~~~W~~n~wk~~~~~~v~N~dl~~~l~~l~~~~~v~~~~V~gH~g~~~N~~AD~lA~~aa~~  147 (152)
                      |+.+|.+++|+.+.+++++|.++++.++.+...++|+|.|||||+|++||++||+||++||..
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~~~wVkgH~g~~gNe~AD~LAk~aa~~  143 (155)
T 1jl1_A           81 WIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMN  143 (155)
T ss_dssp             THHHHHHTTTBCTTSCBCTTHHHHHHHHHHTTTCEEEEEECCSSTTCHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHCCEECCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHHC
T ss_conf             998988568170556613139999999999751772169835769985079999999999718



>2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis mr-1} PDB: 2zqb_A Back     alignment and structure
>1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A Back     alignment and structure
>2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* Back     alignment and structure
>3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} Back     alignment and structure
>3hyf_A Reverse transcriptase/rnaseh; HIV-1, hydrolase, DI-valent metal nucleic acid cleavage mechanism, DI-valent metal coordination; HET: ON1; 1.70A {Human immunodeficiency virus 1} PDB: 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A Back     alignment and structure
>3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 2hb5_A Back     alignment and structure
>1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B Back     alignment and structure
>1zbf_A Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans c-125} SCOP: c.55.3.1 PDB: 1zbi_A 2g8u_A 2g8i_A 2g8h_A 2g8k_A 2g8f_A 2g8v_A 2g8w_A 3ey1_A* 1zbl_A 3d0p_A* 3i8d_A* 2r7y_A* Back     alignment and structure
>2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A Back     alignment and structure
>2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* 1tvr_A* 2hmi_A* 2vg5_A* ... Back     alignment and structure
>3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, double-stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii str} Back     alignment and structure
>1rw3_A POL polyprotein; RNA and DNA dependent DNA polymerase, reverse transcriptase, transferase, replication; 3.00A {Moloney murine leukemia virus} SCOP: e.8.1.2 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 152 ribonuclease H [Candidatus Liberibacter asiaticus str.
d1rila_147 c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus 9e-30
d1zbfa1132 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillu 3e-29
d1jl1a_152 c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [Tax 6e-29
d1s1ta1110 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse tra 2e-21
d1mu2a1126 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse tra 8e-20
>d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} Length = 147 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: Ribonuclease H
domain: RNase H (RNase HI)
species: Thermus thermophilus [TaxId: 274]
 Score =  123 bits (308), Expect = 9e-30
 Identities = 76/140 (54%), Positives = 98/140 (70%), Gaps = 1/140 (0%)

Query: 7   REVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYP 66
           + V  +TDGAC GNPGPGGW  LLR+   EK++SGGE  TTNNRMEL AAI+ L ALK P
Sbjct: 2   KRVALFTDGACLGNPGPGGWAALLRFHAHEKLLSGGEACTTNNRMELKAAIEGLKALKEP 61

Query: 67  CKVLLYTDSSYVHKGFSQWIKKWQQ-NGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWI 125
           C+V LYTDS Y+ K F++   +  +  GW+T++ K VKN DLW   + A A H+V  +++
Sbjct: 62  CEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFV 121

Query: 126 KGHAGNQENEKVDRIARNAA 145
           KGH G+ ENE+VDR AR  A
Sbjct: 122 KGHTGHPENERVDREARRQA 141


>d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} Length = 132 Back     information, alignment and structure
>d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} Length = 152 Back     information, alignment and structure
>d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} Length = 110 Back     information, alignment and structure
>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Length = 126 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 ribonuclease H [Candidatus Liberibacter asiaticus str.
d1rila_147 RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} 100.0
d1jl1a_152 RNase H (RNase HI) {Escherichia coli [TaxId: 562]} 100.0
d1mu2a1126 HIV RNase H (Domain of reverse transcriptase) {Human im 99.97
d1zbfa1132 BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 99.97
d1s1ta1110 HIV RNase H (Domain of reverse transcriptase) {Human im 99.93
>d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: Ribonuclease H
domain: RNase H (RNase HI)
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=8.4e-45  Score=269.48  Aligned_cols=143  Identities=55%  Similarity=1.001  Sum_probs=133.4

Q ss_pred             CEEEEEECCCCCCCCCCCEEEEEEECCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCCC-H
Q ss_conf             889999664757999821899999618812786022276630278999999864113454037884064550325652-2
Q gi|254780796|r    7 REVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQ-W   85 (152)
Q Consensus         7 ~~i~IytDGS~~~n~~~aG~g~v~~~~~~~~~~~~~~~~~Tnn~aEl~Ai~~AL~~~~~~~~i~I~tDS~yvv~~i~~-~   85 (152)
                      +.|+|||||||++|||++|||+|+...+....+++....+|||+|||.|++.||++++....+.|+|||+|++++++. +
T Consensus         2 ~~i~iytDGs~~~N~g~~G~g~vi~~~~~~~~~~~~~~~~Tnn~aEl~Ai~~AL~~~~~~~~i~i~tds~~~~~~~~~~~   81 (147)
T d1rila_           2 KRVALFTDGACLGNPGPGGWAALLRFHAHEKLLSGGEACTTNNRMELKAAIEGLKALKEPCEVDLYTDSHYLKKAFTEGW   81 (147)
T ss_dssp             CCCCEEEEEEESSTTEEEEEEEEECBTTBCCEECCEEEEECHHHHHHHHHHHHHHSCCSCCEEEEECCCHHHHHHHHSSH
T ss_pred             CEEEEEECCCCCCCCCCCEEEEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCC
T ss_conf             88999973178899996089999997991069842336663788999999887644047853999605466542521323


Q ss_pred             HHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             5677654320035564211000234541022210558980178888455899999999999887
Q gi|254780796|r   86 IKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVSFK  149 (152)
Q Consensus        86 ~~~W~~n~wk~~~~~~v~N~dl~~~l~~l~~~~~v~~~~V~gH~g~~~N~~AD~lA~~aa~~~k  149 (152)
                      ...|++++|.++.++||+|.|||++++.++..++|+|.|||||+|++||++||+||++||.+..
T Consensus        82 ~~~~~~~~~~~~~~~~v~n~dL~~~l~~~~~~~~v~~~wVkgHsg~~gNe~AD~LAk~aa~~~~  145 (147)
T d1rila_          82 LEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVKGHTGHPENERVDREARRQAQSQA  145 (147)
T ss_dssp             HHHHHHTTSBCTTSSBCTTHHHHHHHHHHHTTSEEECCCCCGGGSCTHHHHHHHHHHHHHTSSC
T ss_pred             HHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             2446544333424523005789999888764036535982577898055899999999988753



>d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 152 ribonuclease H [Candidatus Liberibacter asiaticus
3h08_A_146 (A:) RNH (ribonuclease H); RNAse H, 3D-structure, 2e-34
2e4l_A_158 (A:) Ribonuclease HI, RNAse HI; hydrolase, endorib 1e-31
1jl1_A_155 (A:) Ribonuclease HI; RNAse HI, protein stability, 3e-31
1ril_A_166 (A:) Ribonuclease H; hydrolase(endoribonuclease); 1e-28
1zbf_A_142 (A:) Ribonuclease H-related protein; RNAse H, RNA/ 2e-28
2qkb_A_154 (A:) Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/D 2e-24
2hb5_A_164 (A:) Reverse transcriptase/ribonuclease H; RNAse H 1e-22
1mu2_A_427-555129 (A:427-555) HIV-2 RT; HIV-2 reverse transcriptase, 1e-15
2ehg_A_149 (A:) Ribonuclease HI; RNAse HI, hyperthermophilic 7e-15
3hyf_A_150 (A:) Reverse transcriptase/rnaseh; HIV-1, hydrolas 5e-14
2zd1_A_430-557128 (A:430-557) Reverse transcriptase/ribonuclease H; 2e-12
>3h08_A (A:) RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum}Length = 146 Back     alignment and structure
 Score =  139 bits (351), Expect = 2e-34
 Identities = 72/139 (51%), Positives = 95/139 (68%), Gaps = 1/139 (0%)

Query: 8   EVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPC 67
            +  YTDGA SGNPG GGWG LL Y    K ISG +  TTNNRMELMAAIK L ALK P 
Sbjct: 4   TITIYTDGAASGNPGKGGWGALLMYGSSRKEISGYDPATTNNRMELMAAIKGLEALKEPA 63

Query: 68  KVLLYTDSSYVHKGFSQ-WIKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIK 126
           +V LY+DS+Y+    ++ W+K+W +NGWKT+ KK V+NIDLW + ++ +  H+V  + +K
Sbjct: 64  RVQLYSDSAYLVNAMNEGWLKRWVKNGWKTAAKKPVENIDLWQEILKLTTLHRVTFHKVK 123

Query: 127 GHAGNQENEKVDRIARNAA 145
           GH+ N  N + D +AR A 
Sbjct: 124 GHSDNPYNSRADELARLAI 142


>2e4l_A (A:) Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis mr-1} PDB: 2zqb_ALength = 158 Back     alignment and structure
>1jl1_A (A:) Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli}Length = 155 Back     alignment and structure
>1ril_A (A:) Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus}Length = 166 Back     alignment and structure
>1zbf_A (A:) Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans c-125}Length = 142 Back     alignment and structure
>2qkb_A (A:) Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A*Length = 154 Back     alignment and structure
>2hb5_A (A:) Reverse transcriptase/ribonuclease H; RNAse H, hydrolase; 1.59A {Moloney murine leukemia virus}Length = 164 Back     alignment and structure
>1mu2_A (A:427-555) HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2}Length = 129 Back     alignment and structure
>2ehg_A (A:) Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, double-stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii str}Length = 149 Back     alignment and structure
>3hyf_A (A:) Reverse transcriptase/rnaseh; HIV-1, hydrolase, DI-valent metal nucleic acid cleavage mechanism, DI-valent metal coordination; HET: ON1; 1.70A {Human immunodeficiency virus 1} PDB: 1o1w_A 1hrh_A 1rdh_ALength = 150 Back     alignment and structure
>2zd1_A (A:430-557) Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 2ze2_A* 3bgr_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* 1tvr_A* 2hmi_A* 2vg5_A* 2vg6_A* 2vg7_A* ...Length = 128 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target152 ribonuclease H [Candidatus Liberibacter asiaticus str.
1jl1_A_155 Ribonuclease HI; RNAse HI, protein stability, ther 100.0
3hyf_A_150 Reverse transcriptase/rnaseh; HIV-1, hydrolase, DI 100.0
2e4l_A_158 Ribonuclease HI, RNAse HI; hydrolase, endoribonucl 100.0
2qkb_A_154 Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy 100.0
3h08_A_146 RNH (ribonuclease H); RNAse H, 3D-structure, endon 100.0
1ril_A_166 Ribonuclease H; hydrolase(endoribonuclease); 2.80A 100.0
1zbf_A_142 Ribonuclease H-related protein; RNAse H, RNA/DNA h 99.97
2hb5_A_164 Reverse transcriptase/ribonuclease H; RNAse H, hyd 99.97
2zd1_A_430-557128 Reverse transcriptase/ribonuclease H; P51/P66, het 99.97
1mu2_A_427-555129 HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym 99.96
2ehg_A_149 Ribonuclease HI; RNAse HI, hyperthermophilic archa 99.86
>1jl1_A (A:) Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=1e-36  Score=226.31  Aligned_cols=142  Identities=56%  Similarity=1.002  Sum_probs=135.9

Q ss_pred             CCEEEEEECCCCCCCCCCCEEEEEEECCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCCCH
Q ss_conf             88899996647579998218999996188127860222766302789999998641134540378840645503256522
Q gi|254780796|r    6 LREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKETTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQW   85 (152)
Q Consensus         6 ~~~i~IytDGS~~~n~~~aG~g~v~~~~~~~~~~~~~~~~~Tnn~aEl~Ai~~AL~~~~~~~~i~I~tDS~yvv~~i~~~   85 (152)
                      |..++|||||||++||+++|+|+++..++...........+|||+|||.|++.||+++.....++|+|||+|++++++.|
T Consensus         2 ~~~~~iy~DGS~~~~~~~~G~g~~~~~~~~~~~~~~~~~~~tn~~AEl~Ai~~aL~~~~~~~~i~i~tDS~~vi~~~~~~   81 (155)
T 1jl1_A            2 LKQVEIFTAGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHAEVILSTDSQYVRQGITQW   81 (155)
T ss_dssp             -CCEEEEEEEEESSTTEEEEEEEEEEETTEEEEEEEEEEEECHHHHHHHHHHHHHHTCCSCCEEEEEECCHHHHHHHHTT
T ss_pred             CCEEEEEECCCCCCCCCCEEEEEEEEECCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHHHHCCCHH
T ss_conf             96599996247889998579999999699579997145887639999997777898530465358970338765054007


Q ss_pred             HHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             56776543200355642110002345410222105589801788884558999999999998
Q gi|254780796|r   86 IKKWQQNGWKTSDKKTVKNIDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVS  147 (152)
Q Consensus        86 ~~~W~~n~wk~~~~~~v~N~dl~~~l~~l~~~~~v~~~~V~gH~g~~~N~~AD~lA~~aa~~  147 (152)
                      ...|..++|+++.++++.+.++++.+..+....++.|.||++|+++++|+.||+|||+|+..
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~H~~~~~N~~AD~LAk~a~~~  143 (155)
T 1jl1_A           82 IHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMN  143 (155)
T ss_dssp             HHHHHHTTTBCTTSCBCTTHHHHHHHHHHTTTCEEEEEECCSSTTCHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             68888767840144522139999998754014516999826869981379999999999728



>3hyf_A (A:) Reverse transcriptase/rnaseh; HIV-1, hydrolase, DI-valent metal nucleic acid cleavage mechanism, DI-valent metal coordination; HET: ON1; 1.70A {Human immunodeficiency virus 1} PDB: 1o1w_A 1hrh_A 1rdh_A Back     alignment and structure
>2e4l_A (A:) Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis mr-1} PDB: 2zqb_A Back     alignment and structure
>2qkb_A (A:) Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* Back     alignment and structure
>3h08_A (A:) RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} Back     alignment and structure
>1ril_A (A:) Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} Back     alignment and structure
>1zbf_A (A:) Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans c-125} Back     alignment and structure
>2hb5_A (A:) Reverse transcriptase/ribonuclease H; RNAse H, hydrolase; 1.59A {Moloney murine leukemia virus} Back     alignment and structure
>2zd1_A (A:430-557) Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 2ze2_A* 3bgr_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* 1tvr_A* 2hmi_A* 2vg5_A* 2vg6_A* 2vg7_A* ... Back     alignment and structure
>1mu2_A (A:427-555) HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} Back     alignment and structure
>2ehg_A (A:) Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, double-stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii str} Back     alignment and structure