254780795

254780795

homoserine kinase

GeneID in NCBI database:8209801Locus tag:CLIBASIA_03430
Protein GI in NCBI database:254780795Protein Accession:YP_003065208.1
Gene range:-(463035, 463985)Protein Length:316aa
Gene description:homoserine kinase
COG prediction:[R] Putative homoserine kinase type II (protein kinase fold)
KEGG prediction:homoserine kinase (EC:2.7.1.39); K02204 homoserine kinase type II [EC:2.7.1.39]
SEED prediction:Homoserine kinase (EC 2.7.1.39)
Pathway involved in KEGG:Glycine, serine and threonine metabolism [PATH:las00260]
Subsystem involved in SEED:Threonine and Homoserine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTRFHKQISSISEYGF
ccccccccHHHHHHHHHHcccccHHHEEEcccccEEcEEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHcccccccEEEcccccEEEEEcccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccccccEEEccccEEEEEEcHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHHHHHHHHHHHHccc
ccEEccccHHHHHHHHHcccccHHHHccccccccccccEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHcccccEEcccccccEEEccccEEEEEEEcccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcHHHccc
mavythppqkEIQSFVQEYAIGqlnsvqpiihgvensnfviqtskGTFILTIYEKRMNEKDLPVFIELLHYIsrnklpcpipiprndgklygflckkpanifsfikgsplnhisdihCEEIGSMLASMHQKTKNFHlyrkntlsplnlKFLWAKCFDKVDEDLKKEIDHEFcflkeswpknlptgiihadlfpdnvlfyNNKIMGLIDFYFSCNDFLMYDLSICInawcfdenntynpsrgfsiLNGYNKVRKISENELQSLPTLLRGAALRFFLTRlydsqnmpcnaltitkdpmEYILKTRFHKQISSISEYGF
mavythppqkEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTRFhkqissiseygf
MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTRFHKQISSISEYGF
MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTRFHKQISSI*EYGF
MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTRFHKQISSISEYGF
MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTRFHKQISSIS*Y*F
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTRFHKQISSISEYGF
MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTRFHKQISSISEYGF
MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYILKTRFHKQISSISEYGF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target316 homoserine kinase [Candidatus Liberibacter asiaticus st
315122017316 homoserine kinase [Candidatus Liberibacter solanacearum 1 1e-138
227821113326 homoserine kinase [Sinorhizobium fredii NGR234] Length 1 1e-96
15964666326 homoserine kinase [Sinorhizobium meliloti 1021] Length 1 3e-96
150395752326 homoserine kinase [Sinorhizobium medicae WSM419] Length 1 6e-96
15888118322 homoserine kinase [Agrobacterium tumefaciens str. C58] 1 2e-92
86356608321 homoserine kinase [Rhizobium etli CFN 42] Length = 321 1 3e-92
325292159324 homoserine kinase [Agrobacterium sp. H13-3] Length = 32 1 6e-92
222085132321 homoserine kinase protein [Agrobacterium radiobacter K8 1 1e-91
163760341326 putative homoserine kinase [Hoeflea phototrophica DFL-4 1 4e-91
190890678321 homoserine kinase [Rhizobium etli CIAT 652] Length = 32 1 1e-90
>gi|315122017|ref|YP_004062506.1| homoserine kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 316 Back     alignment and organism information
 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 236/316 (74%), Positives = 274/316 (86%)

Query: 1   MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSKGTFILTIYEKRMNEK 60
           MAVYT+P QKEI+ F+QEYAIGQL+SV+PI++GV+NSNF+I TS GTFILT+YE+R++E 
Sbjct: 1   MAVYTYPTQKEIKHFIQEYAIGQLDSVEPIMNGVDNSNFIIHTSSGTFILTLYEERIDEN 60

Query: 61  DLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSFIKGSPLNHISDIHCEE 120
           DLP FIELL ++S NKL CP PIPRNDGKLYGFL K+PANIFS+IKGS LN I+DIHCEE
Sbjct: 61  DLPFFIELLQHLSLNKLSCPQPIPRNDGKLYGFLSKRPANIFSYIKGSFLNDITDIHCEE 120

Query: 121 IGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDLKKEIDHEFCFLKESWPK 180
           +GS LA MHQK K+F  YRKNTLS  + K LW KCFDKVD +LKKEID EF FL++ WPK
Sbjct: 121 VGSALALMHQKIKSFQSYRKNTLSLPDWKILWKKCFDKVDVNLKKEIDSEFHFLEQFWPK 180

Query: 181 NLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLSICINAWCFDENNTYNPSR 240
           NLPTGIIHADLFPDNVLF+NN+I GLIDFYF+CNDFLMYDLSICINAWCFD+N TYN  +
Sbjct: 181 NLPTGIIHADLFPDNVLFHNNRIAGLIDFYFACNDFLMYDLSICINAWCFDKNATYNHFK 240

Query: 241 GFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDSQNMPCNALTITKDPMEYIL 300
           G +I NGY++V+KISENEL +LP LLRGAALRFFLTRLYDSQN+   AL ITKDPMEY+ 
Sbjct: 241 GHAIFNGYDRVQKISENELLALPILLRGAALRFFLTRLYDSQNIQYGALAITKDPMEYLC 300

Query: 301 KTRFHKQISSISEYGF 316
           K RFHK +SSIS+YGF
Sbjct: 301 KIRFHKTMSSISQYGF 316


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821113|ref|YP_002825083.1| homoserine kinase [Sinorhizobium fredii NGR234] Length = 326 Back     alignment and organism information
>gi|15964666|ref|NP_385019.1| homoserine kinase [Sinorhizobium meliloti 1021] Length = 326 Back     alignment and organism information
>gi|150395752|ref|YP_001326219.1| homoserine kinase [Sinorhizobium medicae WSM419] Length = 326 Back     alignment and organism information
>gi|15888118|ref|NP_353799.1| homoserine kinase [Agrobacterium tumefaciens str. C58] Length = 322 Back     alignment and organism information
>gi|86356608|ref|YP_468500.1| homoserine kinase [Rhizobium etli CFN 42] Length = 321 Back     alignment and organism information
>gi|325292159|ref|YP_004278023.1| homoserine kinase [Agrobacterium sp. H13-3] Length = 324 Back     alignment and organism information
>gi|222085132|ref|YP_002543662.1| homoserine kinase protein [Agrobacterium radiobacter K84] Length = 321 Back     alignment and organism information
>gi|163760341|ref|ZP_02167423.1| putative homoserine kinase [Hoeflea phototrophica DFL-43] Length = 326 Back     alignment and organism information
>gi|190890678|ref|YP_001977220.1| homoserine kinase [Rhizobium etli CIAT 652] Length = 321 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target316 homoserine kinase [Candidatus Liberibacter asiaticus st
PRK05231319 PRK05231, PRK05231, homoserine kinase; Provisional 1e-104
TIGR00938307 TIGR00938, thrB_alt, homoserine kinase, Neisseria type 2e-85
COG2334331 COG2334, COG2334, Putative homoserine kinase type II (p 3e-64
cd05153296 cd05153, HomoserineK_II, Homoserine Kinase, type II 5e-89
pfam01636239 pfam01636, APH, Phosphotransferase enzyme family 4e-29
cd05120155 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransf 9e-14
COG3173321 COG3173, COG3173, Predicted aminoglycoside phosphotrans 6e-06
cd05157235 cd05157, ETNK_euk, Ethanolamine kinase (ETNK) in eukary 1e-05
cd05155235 cd05155, APH_ChoK_like_1, Uncharacterized bacterial pro 1e-04
cd05151170 cd05151, ChoK, Choline Kinase (ChoK) 0.002
pfam01633208 pfam01633, Choline_kinase, Choline/ethanolamine kinase 0.004
cd05154223 cd05154, ACAD10_11_like, Acyl-CoA dehydrogenase (ACAD) 0.004
>gnl|CDD|179968 PRK05231, PRK05231, homoserine kinase; Provisional Back     alignment and domain information
>gnl|CDD|162121 TIGR00938, thrB_alt, homoserine kinase, Neisseria type Back     alignment and domain information
>gnl|CDD|32485 COG2334, COG2334, Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>gnl|CDD|88616 cd05153, HomoserineK_II, Homoserine Kinase, type II Back     alignment and domain information
>gnl|CDD|145007 pfam01636, APH, Phosphotransferase enzyme family Back     alignment and domain information
>gnl|CDD|88612 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>gnl|CDD|32986 COG3173, COG3173, Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|88620 cd05157, ETNK_euk, Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>gnl|CDD|88618 cd05155, APH_ChoK_like_1, Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>gnl|CDD|88614 cd05151, ChoK, Choline Kinase (ChoK) Back     alignment and domain information
>gnl|CDD|145005 pfam01633, Choline_kinase, Choline/ethanolamine kinase Back     alignment and domain information
>gnl|CDD|88617 cd05154, ACAD10_11_like, Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 316 homoserine kinase [Candidatus Liberibacter asiaticus st
PRK05231319 homoserine kinase; Provisional 100.0
TIGR00938312 thrB_alt homoserine kinase; InterPro: IPR005280 Homoser 100.0
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoserine k 100.0
COG2334331 Putative homoserine kinase type II (protein kinase fold 100.0
PRK06149 972 hypothetical protein; Provisional 100.0
PRK06148 1015 hypothetical protein; Provisional 100.0
PRK11768326 serine/threonine protein kinase; Provisional 99.97
TIGR02906321 spore_CotS spore coat protein, CotS family; InterPro: I 100.0
PTZ00296439 choline kinase; Provisional 99.68
KOG4720391 consensus 99.56
COG3178351 Predicted phosphotransferase related to Ser/Thr protein 99.22
TIGR02905325 spore_yutH spore coat protein YutH; InterPro: IPR014254 99.17
PRK10593297 hypothetical protein; Provisional 97.76
TIGR02569279 TIGR02569_actnb conserved hypothetical protein TIGR0256 91.43
pfam01636239 APH Phosphotransferase enzyme family. This family consi 99.97
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, 99.94
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH 99.94
pfam03881287 Fructosamin_kin Fructosamine kinase. This family includ 99.88
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is part 99.88
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK 99.87
COG3173321 Predicted aminoglycoside phosphotransferase [General fu 99.87
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK 99.86
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins with 99.85
TIGR02721262 ycfN_thiK thiamine kinase; InterPro: IPR014093 Members 99.74
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is 99.74
COG3001286 Uncharacterized protein conserved in bacteria [Function 99.73
TIGR02904313 spore_ysxE spore coat protein YsxE; InterPro: IPR014253 99.72
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). The APH 99.71
pfam01633208 Choline_kinase Choline/ethanolamine kinase. Choline kin 99.71
KOG2686366 consensus 99.62
PRK01723240 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.42
COG3642204 Mn2+-dependent serine/threonine protein kinase [Signal 99.36
PRK09550398 mtnK methylthioribose kinase; Reviewed 99.33
COG0510269 ycfN Thiamine kinase and related kinases [Coenzyme tran 99.33
TIGR02172234 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous fam 99.24
COG3231266 Aph Aminoglycoside phosphotransferase [Translation, rib 99.23
pfam07914413 DUF1679 Protein of unknown function (DUF1679). The regi 99.2
KOG3021313 consensus 99.17
pfam06293206 Kdo Lipopolysaccharide kinase (Kdo/WaaP) family. These 98.78
KOG3087229 consensus 98.64
TIGR01767386 MTRK 5-methylthioribose kinase; InterPro: IPR009212 Mem 98.17
pfam04655253 APH_6_hur Aminoglycoside/hydroxyurea antibiotic resista 97.78
COG3281438 Ble Uncharacterized protein, probably involved in treha 97.18
PRK09605536 O-sialoglycoprotein endopeptidase/protein kinase; Revie 99.41
COG3570274 StrB Streptomycin 6-kinase [Defense mechanisms] 92.9
PRK12396409 5-methylribose kinase; Reviewed 99.26
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalytic do 98.89
smart00090237 RIO RIO-like kinase. 98.77
COG1718268 RIO1 Serine/threonine protein kinase involved in cell c 98.73
pfam06176229 WaaY Lipopolysaccharide core biosynthesis protein (WaaY 98.54
PRK10359232 lipopolysaccharide core biosynthesis protein; Provision 98.44
KOG2270 520 consensus 98.35
cd06614287 STKc_PAK Serine/threonine kinases (STKs), p21-activated 98.15
cd06654296 STKc_PAK1 Serine/threonine kinases (STKs), p21-activate 98.11
TIGR02457568 TreS_Cterm trehalose synthase-fused probable maltokinas 98.02
cd07865310 STKc_CDK9 The catalytic domain of the Serine/Threonine 98.01
cd06658292 STKc_PAK5 Serine/threonine kinases (STKs), p21-activate 97.98
cd06655296 STKc_PAK2 Serine/threonine kinases (STKs), p21-activate 97.96
cd06656297 STKc_PAK3 Serine/threonine kinases (STKs), p21-activate 97.96
cd06639291 STKc_myosinIIIB Serine/threonine kinases (STKs), class 97.95
cd06657292 STKc_PAK4 Serine/threonine kinases (STKs), p21-activate 97.95
cd06648285 STKc_PAK_II Serine/threonine kinases (STKs), p21-activa 97.95
cd06636282 STKc_MAP4K4_6 Serine/threonine kinases (STKs), mitogen- 97.92
cd05610 669 STKc_MASTL STKc_MASTL: Serine/Threonine Kinases (STKs), 97.82
cd06608275 STKc_myosinIII_like Serine/threonine kinases (STKs), Cl 97.79
cd07866311 STKc_BUR1 The catalytic domain of the Serine/Threonine 97.78
cd06647293 STKc_PAK_I Serine/threonine kinases (STKs), p21-activat 97.78
cd06621287 PKc_MAPKK_Pek1_like Protein kinases (PKs), MAP kinase k 97.77
cd07843293 STKc_CDC2L1 The catalytic domain of the Serine/Threonin 97.77
cd06641277 STKc_MST3 Serine/threonine kinases (STKs), mammalian St 97.75
cd06620284 PKc_MAPKK_Byr1_like Protein kinases (PKs), MAP kinase k 97.71
cd06637272 STKc_TNIK Serine/threonine kinases (STKs),Traf2- and Nc 97.71
PTZ00263329 protein kinase A catalytic subunit; Provisional 97.7
cd06640277 STKc_MST4 Serine/threonine kinases (STKs), mammalian St 97.7
cd07874355 STKc_JNK3 The catalytic domain of the Serine/Threonine 97.69
cd07844291 STKc_PCTAIRE_like The catalytic domain of PCTAIRE-like 97.69
cd06642277 STKc_STK25_YSK1 Serine/threonine kinases (STKs), STK25 97.69
cd06607307 STKc_TAO Serine/threonine kinases (STKs), thousand-and- 97.68
cd05112256 PTKc_Itk Catalytic Domain of the Protein Tyrosine Kinas 97.67
cd06659297 STKc_PAK6 Serine/threonine kinases (STKs), p21-activate 97.66
cd06649331 PKc_MEK2 MEK2 (MAPKK2 or MKK2): Protein kinases (PKs), 97.6
cd06615308 PKc_MEK MEK1/2 (MAPK kinase 1/2, MAPKK1/2 or MKK1/2): P 97.6
cd06638286 STKc_myosinIIIA Serine/threonine kinases (STKs), class 97.6
cd07845309 STKc_CDK10 The catalytic domain of the Serine/Threonine 97.59
cd05059256 PTKc_Tec_like Catalytic Domain of Tec-like Protein Tyro 97.57
cd07869303 STKc_PFTAIRE1 The catalytic domain of the Serine/Threon 97.57
cd06605265 PKc_MAPKK Protein kinases (PKs), MAP kinase kinase (MAP 97.57
cd05626 381 STKc_LATS2 STKc_LATS2: Serine/Threonine Kinases (STKs), 97.54
cd06650333 PKc_MEK1 MEK1 (MAPKK1 or MKK1): Protein kinases (PKs), 97.54
cd05113256 PTKc_Btk_Bmx Catalytic Domain of the Protein Tyrosine K 97.53
cd06616288 PKc_MKK4 Protein kinases (PKs), MAP kinase kinase 4 (MK 97.53
cd06622286 PKc_MAPKK_PBS2_like Protein kinases (PKs), MAP kinase k 97.53
cd07855336 STKc_ERK5 The catalytic domain of the Serine/Threonine 97.53
cd05625 382 STKc_LATS1 STKc_LATS1: Serine/Threonine Kinases (STKs), 97.52
cd06633313 STKc_TAO3 Serine/threonine kinases (STKs), thousand-and 97.5
cd07872309 STKc_PCTAIRE2 The catalytic domain of the Serine/Threon 97.48
cd06624268 STKc_ASK Serine/threonine kinases (STKs), apoptosis sig 97.48
cd05621370 STKc_ROCK2 STKc_ROCK2: Serine/Threonine Kinases (STKs), 97.47
cd07870291 STKc_PFTAIRE2 The catalytic domain of the Serine/Threon 97.47
PTZ00266 484 NIMA-related protein kinase; Provisional 97.46
cd07873301 STKc_PCTAIRE1 The catalytic domain of the Serine/Threon 97.45
cd07871288 STKc_PCTAIRE3 The catalytic domain of the Serine/Threon 97.44
cd07856328 STKc_Sty1_Hog1 The catalytic domain of the Serine/Threo 97.43
cd05622371 STKc_ROCK1 STKc_ROCK1: Serine/Threonine Kinases (STKs), 97.42
cd06625263 STKc_MEKK3_like Serine/threonine kinases (STKs), MAP/ER 97.39
cd05072261 PTKc_Lyn Catalytic Domain of the Protein Tyrosine Kinas 97.38
cd07849336 STKc_ERK1_2_like The catalytic domain of Extracellular 97.38
cd06634308 STKc_TAO2 Serine/threonine kinases (STKs), thousand-and 97.37
cd06618296 PKc_MKK7 Protein kinases (PKs), MAP kinase kinase 7 (MK 97.34
cd07854342 STKc_MAPK4_6 The catalytic domain of the Serine/Threoni 97.32
cd07850353 STKc_JNK The catalytic domain of the Serine/Threonine K 97.32
KOG0578550 consensus 97.31
cd05114256 PTKc_Tec_Rlk Catalytic Domain of the Protein Tyrosine K 97.31
cd07878343 STKc_p38beta_MAPK11 The catalytic domain of the Serine/ 97.31
cd07879342 STKc_p38delta_MAPK13 The catalytic domain of the Serine 97.3
cd07880343 STKc_p38gamma_MAPK12 The catalytic domain of the Serine 97.3
cd07852337 STKc_MAPK15 The catalytic domain of the Serine/Threonin 97.29
cd06635317 STKc_TAO1 Serine/threonine kinases (STKs), thousand-and 97.27
cd07851343 STKc_p38 The catalytic domain of the Serine/Threonine K 97.26
cd05068261 PTKc_Frk_like Catalytic Domain of Fyn-related kinase-li 97.26
cd05038279 PTKc_Jak_rpt2 Catalytic (Repeat 2) Domain of the Protei 97.25
cd06651266 STKc_MEKK3 Serine/threonine kinases (STKs), MAP/ERK kin 97.22
cd07858337 STKc_TEY_MAPK_plant The catalytic domain of the Serine/ 97.19
cd06652265 STKc_MEKK2 Serine/threonine kinases (STKs), MAP/ERK kin 97.05
cd05046275 PTK_CCK4 Catalytic Domain of the Protein Tyrosine Kinas 96.98
cd05070260 PTKc_Fyn_Yrk Catalytic Domain of the Protein Tyrosine K 96.98
cd07877345 STKc_p38alpha_MAPK14 The catalytic domain of the Serine 96.88
cd05596370 STKc_ROCK STKc_ROCK: Serine/Threonine Kinases (STKs), R 96.86
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (Repeat 2) Domain of the 96.79
cd05067260 PTKc_Lck_Blk Catalytic Domain of the Protein Tyrosine K 96.78
cd05057279 PTKc_EGFR_like Catalytic Domain of Epidermal Growth Fac 96.66
cd05050288 PTKc_Musk Catalytic Domain of the Protein Tyrosine Kina 96.64
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinas 96.6
cd05090283 PTKc_Ror1 Catalytic Domain of the Protein Tyrosine Kina 96.56
cd05032277 PTKc_InsR_like Catalytic Domain of Insulin Receptor-lik 96.52
cd05109279 PTKc_HER2 Catalytic Domain of the Protein Tyrosine Kina 96.32
cd05080283 PTKc_Tyk2_rpt2 Catalytic (Repeat 2) Domain of the Prote 96.18
KOG0032382 consensus 96.11
cd05079284 PTKc_Jak1_rpt2 Catalytic (Repeat 2) Domain of the Prote 95.97
cd07876359 STKc_JNK2 The catalytic domain of the Serine/Threonine 95.97
cd05110303 PTKc_HER4 Catalytic Domain of the Protein Tyrosine Kina 95.82
KOG0616355 consensus 95.47
cd05061288 PTKc_InsR Catalytic Domain of the Protein Tyrosine Kina 95.41
cd05111279 PTK_HER3 Pseudokinase Domain of the Protein Tyrosine Ki 95.13
cd05091283 PTKc_Ror2 Catalytic Domain of the Protein Tyrosine Kina 94.66
COG2112201 Predicted Ser/Thr protein kinase [Signal transduction m 94.63
KOG0594323 consensus 93.6
KOG1164322 consensus 93.59
KOG1187361 consensus 92.93
PRK09902216 hypothetical protein; Provisional 90.21
KOG0598357 consensus 90.21
PRK10271188 thiK thiamine kinase; Provisional 99.19
pfam02958293 DUF227 Domain of unknown function (DUF227). This family 99.06
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domain. su 99.04
COG2187337 Uncharacterized protein conserved in bacteria [Function 98.33
cd05119187 RIO RIO kinase family, catalytic domain. The RIO kinase 98.96
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic 98.81
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and similar pro 98.81
COG0478304 RIO-like serine/threonine protein kinase fused to N-ter 98.53
KOG2268 465 consensus 98.07
cd07836284 STKc_Pho85 The catalytic domain of the Serine/Threonine 98.04
cd06612256 STKc_MST1_2 Serine/threonine kinases (STKs), mammalian 98.03
cd07861285 STKc_CDK1_euk The catalytic domain of the Serine/Threon 97.98
cd07846286 STKc_CDKL2_3 The catalytic domain of the Serine/Threoni 97.96
cd07847286 STKc_CDKL1_4 The catalytic domain of the Serine/Threoni 97.95
cd00180256 S_TKc Serine/Threonine protein kinases, catalytic domai 97.9
cd07860284 STKc_CDK2_3 The catalytic domain of the Serine/Threonin 97.87
cd07864302 STKc_CDK12 The catalytic domain of the Serine/Threonine 97.86
cd07839284 STKc_CDK5 The catalytic domain of the Serine/Threonine 97.83
cd06609274 STKc_MST3_like Serine/threonine kinases (STKs), mammali 97.83
cd06643282 STKc_SLK Serine/threonine kinases (STKs), Ste20-like ki 97.82
cd05613290 STKc_MSK1_N STKc_MSK1_N: Serine/Threonine Kinases (STKs 97.81
cd07829282 STKc_CDK_like The catalytic domain of Cyclin-Dependent 97.8
cd07841298 STKc_CDK7 The catalytic domain of the Serine/Threonine 97.75
cd07833288 STKc_CDKL The catalytic domain of Cyclin-Dependent prot 97.74
cd06644292 STKc_STK10_LOK Serine/threonine kinases (STKs), STK10 s 97.74
cd05611260 STKc_Rim15_like STKc_Rim15_like: Serine/Threonine Kinas 97.73
cd07835283 STKc_CDK1_like The catalytic domain of Cyclin-Dependent 97.73
cd07848287 STKc_CDKL5 The catalytic domain of the Serine/Threonine 97.72
cd05572262 STKc_cGK_PKG STKc_cGK_PKG: Serine/Threonine Kinases (ST 97.71
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic domai 97.71
cd06606259 STKc_MAPKKK Serine/threonine kinases (STKs), mitogen-ac 97.71
cd07838287 STKc_CDK4_6_like The catalytic domain of Cyclin-Depende 97.7
cd05578258 STKc_Yank1 STKc_Yank1: Serine/Threonine Kinases (STKs), 97.69
cd05574315 STKc_phototropin_like STKc_phototropin_like: Serine/Thr 97.68
cd06917277 STKc_NAK1_like Serine/threonine kinases (STKs), Nak1 su 97.67
cd07831282 STKc_MOK The catalytic domain of the Serine/Threonine K 97.67
cd05122253 PKc_STE Protein Kinases (PKs), STE family, catalytic (c 97.66
cd05118283 STKc_CMGC The catalytic domain of CMGC family Serine/Th 97.66
cd07832286 STKc_CCRK The catalytic domain of the Serine/Threonine 97.65
cd05598 376 STKc_LATS STKc_LATS: Serine/Threonine Kinases (STKs), L 97.64
cd07853 372 STKc_NLK The catalytic domain of the Serine/Threonine K 97.61
cd05577277 STKc_GRK STKc_GRK: Serine/Threonine Kinases (STKs), G p 97.6
cd07840287 STKc_CDK9_like The catalytic domain of Cyclin-Dependent 97.6
cd05123250 STKc_AGC STKc_AGC: Serine/Threonine Kinases (STKs), AGC 97.6
cd05082256 PTKc_Csk Catalytic Domain of the Protein Tyrosine Kinas 97.6
pfam00069260 Pkinase Protein kinase domain. 97.6
cd06626264 STKc_MEKK4 Serine/threonine kinases (STKs), MAP/ERK kin 97.59
cd07863288 STKc_CDK4 The catalytic domain of the Serine/Threonine 97.58
cd05571323 STKc_PKB STKc_PKB: Serine/Threonine Kinases (STKs), Pro 97.57
cd05599 364 STKc_NDR_like STKc_NDR_like: Serine/Threonine Kinases ( 97.57
cd05084252 PTKc_Fes Catalytic Domain of the Protein Tyrosine Kinas 97.56
cd05617327 STKc_aPKC_zeta STKc_aPKC_zeta: Serine/Threonine Kinases 97.56
cd05629 377 STKc_NDR_like_fungal STKc_NDR_like_fungal: Serine/Threo 97.55
cd05614332 STKc_MSK2_N STKc_MSK2_N: Serine/Threonine Kinases (STKs 97.55
cd05618329 STKc_aPKC_iota STKc_aPKC_iota: Serine/Threonine Kinases 97.54
cd07867317 STKc_CDC2L6 The catalytic domain of Cyclin-Dependent pr 97.53
cd06619279 PKc_MKK5 Protein kinases (PKs), MAP kinase kinase 5 (MK 97.52
cd07830283 STKc_MAK_like The catalytic domain of Male germ cell-As 97.52
cd06610266 STKc_OSR1_SPAK Serine/threonine kinases (STKs), oxidati 97.51
cd06613261 STKc_MAP4K3_like Serine/threonine kinases (STKs), mitog 97.5
cd05601330 STKc_CRIK STKc_CRIK: Serine/Threonine Kinases (STKs), C 97.5
cd06645267 STKc_MAP4K3 Serine/threonine kinases (STKs), mitogen-ac 97.48
cd05041251 PTKc_Fes_like Catalytic Domain of Fes-like Protein Tyro 97.47
cd05594324 STKc_PKB_alpha STKc_PKB_alpha: Serine/Threonine Kinases 97.47
cd07875364 STKc_JNK1 The catalytic domain of the Serine/Threonine 97.47
cd05589324 STKc_PKN STKc_PKN: Serine/Threonine Kinases (STKs), Pro 97.47
cd07868317 STKc_CDK8 The catalytic domain of the Serine/Threonine 97.47
smart00221225 STYKc Protein kinase; unclassified specificity. Phospho 97.47
cd05612291 STKc_PRKX_like STKc_PRKX_like: Serine/Threonine Kinases 97.46
cd05052263 PTKc_Abl Catalytic Domain of the Protein Tyrosine Kinas 97.45
cd06627254 STKc_Cdc7_like Serine/threonine kinases (STKs), cell di 97.45
cd05580290 STKc_PKA STKc_PKA: Serine/Threonine Kinases (STKs), cAM 97.44
cd05582318 STKc_RSK_N STKc_RSK_N: Serine/Threonine Kinases (STKs), 97.44
cd05588329 STKc_aPKC STKc_aPKC: Serine/Threonine Kinases (STKs), A 97.44
cd05600333 STKc_Sid2p_Dbf2p STKc_Sid2p_Dbf2p: Serine/Threonine Kin 97.44
cd06611280 STKc_SLK_like Serine/threonine kinases (STKs), Ste20-li 97.43
cd06646267 STKc_MAP4K5 Serine/threonine kinases (STKs), mitogen-ac 97.43
cd06632258 STKc_MEKK1_plant Serine/threonine kinases (STKs), plant 97.42
cd05583288 STKc_MSK_N STKc_MSK_N: Serine/Threonine Kinases (STKs), 97.4
cd05581279 STKc_PDK1 STKc_PDK1: Serine/Threonine Kinases (STKs), P 97.4
cd05609305 STKc_MAST STKc_MAST: Serine/Threonine Kinases (STKs), M 97.4
cd05605285 STKc_GRK4_like STKc_GRK4_like: Serine/Threonine Kinases 97.39
cd05573 354 STKc_ROCK_NDR_like STKc_ROCK_NDR_like: Serine/Threonine 97.39
cd05585312 STKc_YPK1_like STKc_YPK1_like: Serine/Threonine Kinases 97.39
cd05627 360 STKc_NDR2 STKc_NDR2: Serine/Threonine Kinases (STKs), N 97.37
cd06623264 PKc_MAPKK_plant_like Protein kinases (PKs), MAP kinase 97.37
cd05593325 STKc_PKB_gamma STKc_PKB_gamma: Serine/Threonine Kinases 97.37
cd05085250 PTKc_Fer Catalytic Domain of the Protein Tyrosine Kinas 97.36
cd06631265 STKc_YSK4 Serine/threonine kinases (STKs), yeast Sps1/S 97.35
cd05570318 STKc_PKC STKc_PKC: Serine/Threonine Kinases (STKs), Pro 97.34
PRK13184 933 pknD serine/threonine-protein kinase; Reviewed 97.33
cd05633279 STKc_GRK3 STKc_GRK3: Serine/Threonine Kinases (STKs), G 97.32
cd05595323 STKc_PKB_beta STKc_PKB_beta: Serine/Threonine Kinases ( 97.31
cd05608280 STKc_GRK1 STKc_GRK1: Serine/Threonine Kinases (STKs), G 97.31
cd06653264 STKc_MEKK3_like_1 Serine/threonine kinases (STKs), MAP/ 97.3
cd05591321 STKc_nPKC_epsilon STKc_nPKC_epsilon: Serine/Threonine K 97.3
cd05584323 STKc_p70S6K STKc_p70S6K: Serine/Threonine Kinases (STKs 97.3
cd07862290 STKc_CDK6 The catalytic domain of the Serine/Threonine 97.29
pfam07714258 Pkinase_Tyr Protein tyrosine kinase. 97.29
cd05592316 STKc_nPKC_theta_delta STKc_nPKC_theta_delta: Serine/Thr 97.28
cd05587324 STKc_cPKC STKc_cPKC: Serine/Threonine Kinases (STKs), C 97.28
cd05039256 PTKc_Csk_like Catalytic Domain of C-terminal Src kinase 97.25
cd05623332 STKc_MRCK_alpha STKc_MRCK_alpha: Serine/Threonine Kinas 97.25
cd05603321 STKc_SGK2 STKc_SGK2: Serine/Threonine Kinases (STKs), S 97.23
cd06628267 STKc_MAPKKK_Byr2_like Serine/threonine kinases (STKs), 97.23
cd05083254 PTKc_Chk Catalytic Domain of the Protein Tyrosine Kinas 97.22
KOG0592 604 consensus 97.21
cd05624331 STKc_MRCK_beta STKc_MRCK_beta: Serine/Threonine Kinases 97.2
cd05034261 PTKc_Src_like Catalytic Domain of Src kinase-like Prote 97.2
cd05586330 STKc_Sck1_like STKc_Sck1_like: Serine/Threonine Kinases 97.16
cd05606278 STKc_beta_ARK STKc_beta_ARK: Serine/Threonine Kinases ( 97.14
cd07834330 STKc_MAPK The catalytic domain of the Serine/Threonine 97.14
cd00192261 PTKc Catalytic Domain of Protein Tyrosine Kinases. Prot 97.11
cd05615323 STKc_cPKC_alpha STKc_cPKC_alpha: Serine/Threonine Kinas 97.1
cd05604325 STKc_SGK3 STKc_SGK3: Serine/Threonine Kinases (STKs), S 97.09
cd05607277 STKc_GRK7 STKc_GRK7: Serine/Threonine Kinases (STKs), G 97.09
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotransfe 97.08
cd05628 363 STKc_NDR1 STKc_NDR1: Serine/Threonine Kinases (STKs), N 97.04
cd07842315 STKc_CDK8_like The catalytic domain of Cyclin-Dependent 97.04
cd05619316 STKc_nPKC_theta STKc_nPKC_theta: Serine/Threonine Kinas 97.03
cd07837295 STKc_CdkB_plant The catalytic domain of the Serine/Thre 97.02
cd05073260 PTKc_Hck Catalytic Domain of the Protein Tyrosine Kinas 97.02
cd05631285 STKc_GRK4 STKc_GRK4: Serine/Threonine Kinases (STKs), G 97.02
cd05616323 STKc_cPKC_beta STKc_cPKC_beta: Serine/Threonine Kinases 96.99
cd05602325 STKc_SGK1 STKc_SGK1: Serine/Threonine Kinases (STKs), S 96.99
cd05590320 STKc_nPKC_eta STKc_nPKC_eta: Serine/Threonine Kinases ( 96.99
cd05632285 STKc_GRK5 STKc_GRK5: Serine/Threonine Kinases (STKs), G 96.99
cd07859338 STKc_TDY_MAPK_plant The catalytic domain of the Serine/ 96.99
cd05575323 STKc_SGK STKc_SGK: Serine/Threonine Kinases (STKs), Ser 96.97
cd05630285 STKc_GRK6 STKc_GRK6: Serine/Threonine Kinases (STKs), G 96.94
cd05579265 STKc_MAST_like STKc_MAST_like: Serine/Threonine Kinases 96.91
cd05576237 STKc_RPK118_like STKc_RPK118_like: Serine/Threonine Kin 96.86
cd05620316 STKc_nPKC_delta STKc_nPKC_delta: Serine/Threonine Kinas 96.83
PTZ00283 496 serine/threonine protein kinase; Provisional 96.82
cd05088303 PTKc_Tie2 Catalytic Domain of the Protein Tyrosine Kina 96.74
cd05148261 PTKc_Srm_Brk Catalytic Domain of the Protein Tyrosine K 96.68
cd05060257 PTKc_Syk_like Catalytic Domain of Spleen Tyrosine Kinas 96.67
cd06617280 PKc_MKK3_6 Protein kinases (PKs), MAP kinase kinase 3 ( 96.65
cd05053294 PTKc_FGFR Catalytic Domain of the Protein Tyrosine Kina 96.62
cd05049280 PTKc_Trk Catalytic Domain of the Protein Tyrosine Kinas 96.62
cd05071262 PTKc_Src Catalytic Domain of the Protein Tyrosine Kinas 96.43
cd05040257 PTKc_Ack_like Catalytic Domain of the Protein Tyrosine 96.4
cd05063268 PTKc_EphR_A2 Catalytic Domain of the Protein Tyrosine K 96.3
cd05055302 PTKc_PDGFR Catalytic Domain of the Protein Tyrosine Kin 96.24
cd05069260 PTKc_Yes Catalytic Domain of the Protein Tyrosine Kinas 96.18
cd05597331 STKc_DMPK_like STKc_DMPK_like: Serine/Threonine Kinases 95.86
cd05047270 PTKc_Tie Catalytic Domain of Tie Protein Tyrosine Kinas 95.84
cd05065269 PTKc_EphR_B Catalytic Domain of the Protein Tyrosine Ki 95.71
KOG0595 429 consensus 95.7
cd05051296 PTKc_DDR Catalytic Domain of the Protein Tyrosine Kinas 95.63
cd05044270 PTKc_c-ros Catalytic Domain of the Protein Tyrosine Kin 95.61
cd06629272 STKc_MAPKKK_Bck1_like Serine/threonine kinases (STKs), 95.54
cd05056270 PTKc_FAK Catalytic Domain of the Protein Tyrosine Kinas 95.44
KOG0610 459 consensus 95.4
cd06630268 STKc_MEKK1 Serine/threonine kinases (STKs), MAP/ERK kin 95.14
cd05092280 PTKc_TrkA Catalytic Domain of the Protein Tyrosine Kina 95.11
PTZ00024325 cyclin-dependent protein kinase; Provisional 95.02
cd05094291 PTKc_TrkC Catalytic Domain of the Protein Tyrosine Kina 94.97
cd05066267 PTKc_EphR_A Catalytic Domain of the Protein Tyrosine Ki 94.83
cd05108316 PTKc_EGFR Catalytic Domain of the Protein Tyrosine Kina 94.83
cd05115257 PTKc_Zap-70 Catalytic Domain of the Protein Tyrosine Ki 94.57
cd05093288 PTKc_TrkB Catalytic Domain of the Protein Tyrosine Kina 94.47
cd05098307 PTKc_FGFR1 Catalytic Domain of the Protein Tyrosine Kin 94.21
cd05116257 PTKc_Syk Catalytic Domain of the Protein Tyrosine Kinas 94.21
cd05089297 PTKc_Tie1 Catalytic Domain of the Protein Tyrosine Kina 94.06
cd05033266 PTKc_EphR Catalytic Domain of Ephrin Receptor Protein T 93.65
KOG0198313 consensus 93.43
cd05101304 PTKc_FGFR2 Catalytic Domain of the Protein Tyrosine Kin 93.13
KOG1989 738 consensus 91.93
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic 98.73
pfam01163186 RIO1 RIO1 family. This is a family of atypical serine k 98.56
PRK04750 540 ubiB putative ubiquinone biosynthesis protein UbiB; Rev 97.68
COG4857408 Predicted kinase [General function prediction only] 97.66
KOG1235538 consensus 97.63
COG0661 517 AarF Predicted unusual protein kinase [General function 97.57
PTZ00284467 protein kinase; Provisional 97.23
KOG0615475 consensus 96.94
KOG0605 550 consensus 96.73
TIGR01982452 UbiB 2-polyprenylphenol 6-hydroxylase; InterPro: IPR010 96.72
KOG0667 586 consensus 96.71
cd05045285 PTKc_RET Catalytic Domain of the Protein Tyrosine Kinas 96.69
KOG1166974 consensus 96.48
KOG0603612 consensus 96.44
KOG0581364 consensus 96.37
cd05042269 PTKc_Aatyk Catalytic Domain of the Protein Tyrosine Kin 96.19
cd05086268 PTKc_Aatyk2 Catalytic Domain of the Protein Tyrosine Ki 95.79
cd05062277 PTKc_IGF-1R Catalytic Domain of the Protein Tyrosine Ki 95.71
cd07857332 STKc_MPK1 The catalytic domain of the Serine/Threonine 95.34
KOG0593 396 consensus 95.33
cd05095296 PTKc_DDR2 Catalytic Domain of the Protein Tyrosine Kina 95.25
cd05096304 PTKc_DDR1 Catalytic Domain of the Protein Tyrosine Kina 95.16
KOG4250 732 consensus 95.03
KOG0608 1034 consensus 94.85
cd05064266 PTKc_EphR_A10 Catalytic Domain of the Protein Tyrosine 94.68
cd05097295 PTKc_DDR_like Catalytic Domain of Discoidin Domain Rece 94.63
KOG1035 1351 consensus 94.6
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic Domain of the Protein Tyro 94.58
cd05074273 PTKc_Tyro3 Catalytic Domain of the Protein Tyrosine Kin 94.57
cd05099314 PTKc_FGFR4 Catalytic Domain of the Protein Tyrosine Kin 94.47
cd05058262 PTKc_Met_Ron Catalytic Domain of the Protein Tyrosine K 94.4
cd05075272 PTKc_Axl Catalytic Domain of the Protein Tyrosine Kinas 94.24
cd05103343 PTKc_VEGFR2 Catalytic Domain of the Protein Tyrosine Ki 94.23
KOG0596677 consensus 94.21
KOG0583370 consensus 94.08
cd05054337 PTKc_VEGFR Catalytic Domain of the Protein Tyrosine Kin 93.98
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyro 93.69
cd05043280 PTK_Ryk Pseudokinase Domain of the Receptor related to 93.39
cd05100334 PTKc_FGFR3 Catalytic Domain of the Protein Tyrosine Kin 93.08
KOG0599 411 consensus 93.02
KOG1152772 consensus 92.99
KOG0192362 consensus 92.61
cd05102338 PTKc_VEGFR3 Catalytic Domain of the Protein Tyrosine Ki 92.45
KOG0983391 consensus 92.43
KOG0659318 consensus 92.42
KOG0612 1317 consensus 92.17
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (Repeat 1) Domain of th 91.96
cd05036277 PTKc_ALK_LTK Catalytic Domain of the Protein Tyrosine K 91.89
COG4320 410 Uncharacterized protein conserved in bacteria [Function 91.77
KOG0585 576 consensus 91.57
cd05037259 PTK_Jak_rpt1 Pseudokinase (Repeat 1) Domain of the Prot 91.28
KOG0670752 consensus 91.1
KOG0660359 consensus 90.74
KOG0575 592 consensus 90.68
cd05106374 PTKc_CSF-1R Catalytic Domain of the Protein Tyrosine Ki 90.36
cd05169280 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; 90.16
cd00893289 PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type III, c 90.14
cd05107401 PTKc_PDGFR_beta Catalytic Domain of the Protein Tyrosin 90.06
PRK12274198 serine/threonine protein kinase; Provisional 96.75
KOG2269531 consensus 95.87
KOG0903847 consensus 92.89
KOG0984282 consensus 91.35
cd05167311 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), Type 90.93
pfam10009 383 DUF2252 Uncharacterized protein conserved in bacteria ( 95.17
KOG1167418 consensus 90.13
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase; InterPro: IPR005280 Homoserine kinase is required in the biosynthesis of threonine from aspartate Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family; InterPro: IPR014255 Members of this entry include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologues that are more closely related to these two than to the spore coat proteins YutH (IPR014254 from INTERPRO) and YsxE (IPR014253 from INTERPRO) Back     alignment and domain information
>PTZ00296 choline kinase; Provisional Back     alignment and domain information
>KOG4720 consensus Back     alignment and domain information
>COG3178 Predicted phosphotransferase related to Ser/Thr protein kinases [General function prediction only] Back     alignment and domain information
>TIGR02905 spore_yutH spore coat protein YutH; InterPro: IPR014254 This entry, represented by the Bacillus subtilis protein YutH, is found only in the family Bacillaceae, part of the endospore-forming group within the Firmicutes Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02569 TIGR02569_actnb conserved hypothetical protein TIGR02569; InterPro: IPR013402 This entry has so far only been found in Actinobacteria, including at least five species of Mycobacterium, three of Corynebacterium, and Nocardia farcinica - always in a single copy per genome Back     alignment and domain information
>pfam01636 APH Phosphotransferase enzyme family Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information