254780798

254780798

possible lolA type protein

GeneID in NCBI database:8209804Locus tag:CLIBASIA_03445
Protein GI in NCBI database:254780798Protein Accession:YP_003065211.1
Gene range:+(460883, 461497)Protein Length:204aa
Gene description:possible lolA type protein
COG prediction:none
KEGG prediction:possible LolA type protein
SEED prediction:outer membrane lipoprotein carrier protein LolA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN
cHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccEEEEEEEEEcccccEEEEEEEEEcccEEEEEEcccccEEEEEcccEEEEEEcccccEEEEEHHHcHHHHHHcccccccHHHEEEEEccccEEEEEEcccccccEEEEEEEccccEEEEEEEEcccccEEEEEEccEEccccccHHHcccccHHHcccc
cccEccccHcHEEEEEEHEEcccccccccHHHHHHHHHHHHHHHccccEEEEEEEcccccEEcEEEEEEcccEEEEEEcccccEEEEEcccEEEEEcccccccccccccccHHHHHHcccccccccEEEEEcccccEEEEEEEccccccEEEEEEcccccEEEEEEEEcccccEEEEEEEEccccccccccHcEccHHHHHHcc
MAFLLYKSVIGVVILFFYSaifpfnaaypitkdQSVKKAIEHFLSIQTMQgtflqedagyvmkgeffmarpskfyfkysspssvslisdgsnIAVYNAKldtwsvyplrYMAFSVIFSNNQHVIQESIQRVESNNSFITIFfkddfmgnmiSVTFDRLSYRLLNWKIMDSSRRYSIIKILKykentvldpkvfeipydkihnin
MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWkimdssrrYSIIKIlkykentvldpkvfeipydkihnin
MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARpskfyfkysspssVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN
*******SVIGVVILFFYSAIFPFNAAYPIT**QSVKKAIEHFLSIQTMQGTFLQ******MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD***GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK*****
MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN
*AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN
MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN
MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target204 possible lolA type protein [Candidatus Liberibacter asi
315122020207 possible lolA type protein [Candidatus Liberibacter sol 1 3e-58
222150121220 possible lolA type protein [Agrobacterium vitis S4] Len 1 2e-24
255597485222 conserved hypothetical protein [Ricinus communis] Lengt 1 2e-23
150398247220 outer membrane lipoprotein carrier protein LolA [Sinorh 1 2e-23
227823662220 putative outer membrane lipoproteins carrier protein [S 1 6e-23
15966945220 hypothetical protein SMc03809 [Sinorhizobium meliloti 1 1 8e-23
325294130224 outer-membrane lipoprotein carrier protein [Agrobacteri 1 2e-22
159185367224 hypothetical protein Atu2760 [Agrobacterium tumefaciens 1 3e-22
209551338222 outer membrane lipoprotein carrier protein LolA [Rhizob 1 4e-22
163757410233 hypothetical protein HPDFL43_18407 [Hoeflea phototrophi 1 4e-22
>gi|315122020|ref|YP_004062509.1| possible lolA type protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 207 Back     alignment and organism information
 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (81%), Gaps = 3/180 (1%)

Query: 27  AYPIT--KDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSS 83
           AY I   K+ +V+KAI+HFLSIQT+QG F+QED  G V+KGEFFM RPSKFYFKYSSPSS
Sbjct: 27  AYSIVDIKEHAVQKAIDHFLSIQTIQGIFVQEDTVGNVIKGEFFMTRPSKFYFKYSSPSS 86

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
            SL+SDG N+A+YNAKLD W+VYPL   AF +IFSN ++ +Q+SIQR+E+NN+FIT+FF+
Sbjct: 87  GSLVSDGRNVAIYNAKLDAWTVYPLPNTAFGIIFSNKRNEMQQSIQRIETNNAFITLFFR 146

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           +    NMIS+TFDRLSYRLLNW+I DSS    ++KILKYKEN  L  ++F IPYDKIHNI
Sbjct: 147 EVLTKNMISLTFDRLSYRLLNWEITDSSGTSILVKILKYKENITLKSELFVIPYDKIHNI 206


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222150121|ref|YP_002551078.1| possible lolA type protein [Agrobacterium vitis S4] Length = 220 Back     alignment and organism information
>gi|255597485|ref|XP_002536785.1| conserved hypothetical protein [Ricinus communis] Length = 222 Back     alignment and organism information
>gi|150398247|ref|YP_001328714.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium medicae WSM419] Length = 220 Back     alignment and organism information
>gi|227823662|ref|YP_002827635.1| putative outer membrane lipoproteins carrier protein [Sinorhizobium fredii NGR234] Length = 220 Back     alignment and organism information
>gi|15966945|ref|NP_387298.1| hypothetical protein SMc03809 [Sinorhizobium meliloti 1021] Length = 220 Back     alignment and organism information
>gi|325294130|ref|YP_004279994.1| outer-membrane lipoprotein carrier protein [Agrobacterium sp. H13-3] Length = 224 Back     alignment and organism information
>gi|159185367|ref|NP_355690.2| hypothetical protein Atu2760 [Agrobacterium tumefaciens str. C58] Length = 224 Back     alignment and organism information
>gi|209551338|ref|YP_002283255.1| outer membrane lipoprotein carrier protein LolA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 222 Back     alignment and organism information
>gi|163757410|ref|ZP_02164499.1| hypothetical protein HPDFL43_18407 [Hoeflea phototrophica DFL-43] Length = 233 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target204 possible lolA type protein [Candidatus Liberibacter asi
pfam03548164 pfam03548, LolA, Outer membrane lipoprotein carrier pro 1e-10
PRK00031195 PRK00031, lolA, lipoprotein chaperone; Reviewed 0.004
COG2834211 COG2834, LolA, Outer membrane lipoprotein-sorting prote 5e-14
>gnl|CDD|146274 pfam03548, LolA, Outer membrane lipoprotein carrier protein LolA Back     alignment and domain information
>gnl|CDD|178807 PRK00031, lolA, lipoprotein chaperone; Reviewed Back     alignment and domain information
>gnl|CDD|32662 COG2834, LolA, Outer membrane lipoprotein-sorting protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 204 possible lolA type protein [Candidatus Liberibacter asi
PRK00031201 lolA outer-membrane lipoprotein carrier protein; Review 100.0
TIGR00547204 lolA outer membrane lipoprotein carrier protein LolA; I 99.4
pfam03888 314 MucB_RseB MucB/RseB family. Members of this family are 98.27
COG3900262 Predicted periplasmic protein [Function unknown] 97.98
COG3026 320 RseB Negative regulator of sigma E activity [Signal tra 96.48
PRK09455 302 rseB periplasmic negative regulator of sigmaE; Provisio 95.05
COG2834211 LolA Outer membrane lipoprotein-sorting protein [Cell e 100.0
pfam03548164 LolA Outer membrane lipoprotein carrier protein LolA. 100.0
pfam09865215 DUF2092 Predicted periplasmic protein (DUF2092). This d 99.37
COG3017206 LolB Outer membrane lipoprotein involved in outer membr 94.06
>PRK00031 lolA outer-membrane lipoprotein carrier protein; Reviewed Back     alignment and domain information
>TIGR00547 lolA outer membrane lipoprotein carrier protein LolA; InterPro: IPR004564 This protein, LolA, is known so far only in the gamma subdivision of the Proteobacteria Back     alignment and domain information
>pfam03888 MucB_RseB MucB/RseB family Back     alignment and domain information
>COG3900 Predicted periplasmic protein [Function unknown] Back     alignment and domain information
>COG3026 RseB Negative regulator of sigma E activity [Signal transduction mechanisms] Back     alignment and domain information
>PRK09455 rseB periplasmic negative regulator of sigmaE; Provisional Back     alignment and domain information
>COG2834 LolA Outer membrane lipoprotein-sorting protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam03548 LolA Outer membrane lipoprotein carrier protein LolA Back     alignment and domain information
>pfam09865 DUF2092 Predicted periplasmic protein (DUF2092) Back     alignment and domain information
>COG3017 LolB Outer membrane lipoprotein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target204 possible lolA type protein [Candidatus Liberibacter asi
2w7q_A204 Structure Of Pseudomonas Aeruginosa Lola Length = 2 2e-16
3ksn_A183 Crystal Structure Of The Lipoprotein Localization F 8e-09
1iwl_A182 Crystal Structure Of The Lipoprotein Localization F 1e-08
2zpc_A190 Crystal Structure Of The R43l Mutant Of Lola In The 6e-08
>gi|282403535|pdb|2W7Q|A Chain A, Structure Of Pseudomonas Aeruginosa Lola Length = 204 Back     alignment and structure
 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 62/183 (33%), Gaps = 11/183 (6%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSS 80
           +  I    +V++        QT+   F Q              G+  + RP  F +   +
Sbjct: 14  SIAIDDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTDA 73

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESIQRVESNN 135
           P+   LIS+G  + +Y+  L+  ++  L           +    ++     +I   E  N
Sbjct: 74  PNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPALLLSGDISKISESFAITYKEGGN 133

Query: 136 SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               +           ++     S ++ + +++D   + + I     K N  LD K F  
Sbjct: 134 VVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQMIDGVGQRTNILFFDVKMNEALDAKQFTF 193

Query: 196 PYD 198
              
Sbjct: 194 DVP 196


>gi|308198522|pdb|3KSN|A Chain A, Crystal Structure Of The Lipoprotein Localization Factor, Lola Length = 183 Back     alignment and structure
>gi|34811363|pdb|1IWL|A Chain A, Crystal Structure Of The Lipoprotein Localization Factor, Lola Length = 182 Back     alignment and structure
>gi|195927393|pdb|2ZPC|A Chain A, Crystal Structure Of The R43l Mutant Of Lola In The Closed Form Length = 190 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target204 possible lolA type protein [Candidatus Liberibacter asi
2w7q_A204 Outer-membrane lipoprotein carrier protein; periplasmic 7e-14
1iwl_A182 P20, outer-membrane lipoproteins carrier protein; unclo 4e-11
>2w7q_A Outer-membrane lipoprotein carrier protein; periplasmic chaperone, lipoprotein transport, transport, periplasm, chaperone; 1.88A {Pseudomonas aeruginosa} Length = 204 Back     alignment and structure
 Score = 72.1 bits (176), Expect = 7e-14
 Identities = 30/181 (16%), Positives = 61/181 (33%), Gaps = 11/181 (6%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYS 79
            +  I    +V++        QT+   F Q              G+  + RP  F +   
Sbjct: 13  GSIAIDDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTD 72

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIF-----SNNQHVIQESIQRVESN 134
           +P+   LIS+G  + +Y+  L+  ++  L                ++     +I   E  
Sbjct: 73  APNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPALLLSGDISKISESFAITYKEGG 132

Query: 135 NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           N    +           ++     S ++ + +++D   + + I     K N  LD K F 
Sbjct: 133 NVVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQMIDGVGQRTNILFFDVKMNEALDAKQFT 192

Query: 195 I 195
            
Sbjct: 193 F 193


>1iwl_A P20, outer-membrane lipoproteins carrier protein; unclosed beta barrel, protein transport; 1.65A {Escherichia coli} SCOP: b.125.1.1 PDB: 1ua8_A 2zpd_A 2zpc_A Length = 182 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target204 possible lolA type protein [Candidatus Liberibacter asi
2w7q_A204 Outer-membrane lipoprotein carrier protein; periplasmic 100.0
1iwl_A182 P20, outer-membrane lipoproteins carrier protein; unclo 100.0
2yzy_A200 Putative uncharacterized protein TTHA1012; uncharacteri 99.79
3buu_A229 Uncharacterized LOLA superfamily protein NE2245; PSI-2, 98.98
3bk5_A237 Putative outer membrane lipoprotein-sorting protein; pu 97.81
3m4w_A 295 Sigma-E factor regulatory protein RSEB; RSEA, RSEB, RSE 97.66
>2w7q_A Outer-membrane lipoprotein carrier protein; periplasmic chaperone, lipoprotein transport, transport, periplasm, chaperone; 1.88A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=100.00  E-value=1.1e-32  Score=202.05  Aligned_cols=180  Identities=16%  Similarity=0.209  Sum_probs=141.8

Q ss_pred             HHCCCCCCCHHHHHHHHHHHCCCEEEEEEEEEECC------CEEEEEEEEECCCEEEEEECCCCEEEEEEECEEEEEEEC
Q ss_conf             40344431017999999861267069999996189------559999999669869999716641577751205999713
Q gi|254780798|r   25 NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA   98 (204)
Q Consensus        25 ~a~~~~~~~~~~~~i~~~l~~~~t~~a~F~Q~~~~------~~~~G~~~~kkP~k~rw~y~~P~~~~iv~~g~~l~~~d~   98 (204)
                      .++.+...++.++++.++++++++++|+|+|+..+      ..++|+|+++||++|||+|.+|.++.+++||+++|+||+
T Consensus        12 ~~s~a~~~~~~~~kl~~~~~~~~s~~a~F~Q~~~~~~~~~~~~s~G~~~~~kP~k~r~~y~~P~~~~ii~~g~~l~~~d~   91 (204)
T 2w7q_A           12 RGSIAIDDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDP   91 (204)
T ss_dssp             -CCCSSCCHHHHHHHHHHHHTCSEEEEEEEEEEECTTSCCEEEEEEEEEEETTTEEEEEECSSSCEEEEEETTEEEEEET
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCEEEEEEEEEEEECCCEEEEEECCCCCEEEEECCCEEEEECC
T ss_conf             35344162789999999983676489999999965889747888999999809989999889850799984987999875


Q ss_pred             CCCCCCCHHHHHH----HHHHHCCHHHHHHHHCCCCCC-CCCCEEEEECCCCCCCCEEEEEEECCCCEEEEEEEEECCCC
Q ss_conf             3343210111111----233210001212221011322-35727997204666663479999369842999999967998
Q gi|254780798|r   99 KLDTWSVYPLRYM----AFSVIFSNNQHVIQESIQRVE-SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR  173 (204)
Q Consensus        99 ~~~q~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~i~l~f~~~~~~l~~~~i~D~~G~  173 (204)
                      +++++..++....    +..++.+.............. ..........+.........++|+.++..|++|++.|..|+
T Consensus        92 ~~~~v~~~~~~~~~~~~~~~~l~~~~~~l~~~~~v~~~~~~~~~~~~l~p~~~~~~~~~i~i~~~~~~l~~i~i~d~~g~  171 (204)
T 2w7q_A           92 DLEQVTIQKLDQRLTQTPALLLSGDISKISESFAITYKEGGNVVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQMIDGVGQ  171 (204)
T ss_dssp             TTTEEEEECHHHHTTTCGGGGGGSCHHHHTTTEEEEEEEETTEEEEEEEESSSCSSCSEEEEEEETTEEEEEEEECTTCC
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHCCCHHHHHHHHHHHEECCCCEEEEEECCCCCCCCEEEEEEEECCCEEEEEEEEECCCC
T ss_conf             34523012321111113355642444566654201000258618999735677764689999955981899999968999


Q ss_pred             EEEEEEEEEECCCCCCHHHCCCCCC-CCCCCC
Q ss_conf             7999997432288689655126853-134489
Q gi|254780798|r  174 YSIIKILKYKENTVLDPKVFEIPYD-KIHNIN  204 (204)
Q Consensus       174 ~t~i~f~ni~~N~~i~~~~F~f~~~-~~~~~~  204 (204)
                      .|++.|+|++.|.++++++|+|.+| ++++|+
T Consensus       172 ~t~i~f~n~~~n~~i~~~~F~f~~P~g~eVi~  203 (204)
T 2w7q_A          172 RTNILFFDVKMNEALDAKQFTFDVPPGVDVIQ  203 (204)
T ss_dssp             EEEEEEEEEEESCCCCGGGGCCCCCTTCEEEC
T ss_pred             EEEEEEEEEEECCCCCHHHEEECCCCCCEEEC
T ss_conf             99999994560899896458897959976747



>1iwl_A P20, outer-membrane lipoproteins carrier protein; unclosed beta barrel, protein transport; 1.65A {Escherichia coli} SCOP: b.125.1.1 PDB: 1ua8_A 2zpd_A 2zpc_A Back     alignment and structure
>2yzy_A Putative uncharacterized protein TTHA1012; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; 1.60A {Thermus thermophilus HB8} Back     alignment and structure
>3buu_A Uncharacterized LOLA superfamily protein NE2245; PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.20A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>3bk5_A Putative outer membrane lipoprotein-sorting protein; putative outer membrane protein domain, PSI-2; HET: MSE; 2.00A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3m4w_A Sigma-E factor regulatory protein RSEB; RSEA, RSEB, RSEP, stress response, sigma factor, periplasm, membrane, transmembrane; 2.30A {Escherichia coli} PDB: 2p4b_A 2v43_A 2v42_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 204 possible lolA type protein [Candidatus Liberibacter asi
d1iwla_182 b.125.1.1 (A:) Outer-membrane lipoproteins carrier prot 1e-08
>d1iwla_ b.125.1.1 (A:) Outer-membrane lipoproteins carrier protein LolA {Escherichia coli [TaxId: 562]} Length = 182 Back     information, alignment and structure

class: All beta proteins
fold: LolA-like prokaryotic lipoproteins and lipoprotein localization factors
superfamily: Prokaryotic lipoproteins and lipoprotein localization factors
family: Outer-membrane lipoproteins carrier protein LolA
domain: Outer-membrane lipoproteins carrier protein LolA
species: Escherichia coli [TaxId: 562]
 Score = 53.4 bits (127), Expect = 1e-08
 Identities = 25/168 (14%), Positives = 61/168 (36%), Gaps = 11/168 (6%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
                     + +   +F Q+       A    +G+ ++ RP+ F +  + P    L+SD
Sbjct: 3   ASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSD 62

Query: 90  GSNIAVYNAKLDTWSVYPLRY---MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
           G  +  YN  ++  +   L+        ++ + NQ    +     ++ + F+      + 
Sbjct: 63  GKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNG 122

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                ++   R    +  +  ++   + S    LK ++N  +D   F 
Sbjct: 123 NLKQFTINVGR-DGTIHQFSAVEQDDQRSSY-QLKSQQNGAVDAAKFT 168


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target204 possible lolA type protein [Candidatus Liberibacter asi
d1iwla_182 Outer-membrane lipoproteins carrier protein LolA {Esche 99.98
>d1iwla_ b.125.1.1 (A:) Outer-membrane lipoproteins carrier protein LolA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: LolA-like prokaryotic lipoproteins and lipoprotein localization factors
superfamily: Prokaryotic lipoproteins and lipoprotein localization factors
family: Outer-membrane lipoproteins carrier protein LolA
domain: Outer-membrane lipoproteins carrier protein LolA
species: Escherichia coli [TaxId: 562]
Probab=99.98  E-value=2.8e-31  Score=192.72  Aligned_cols=168  Identities=14%  Similarity=0.230  Sum_probs=133.9

Q ss_pred             HHHHHHHHHHHCCCEEEEEEEEEEC------CCEEEEEEEEECCCEEEEEECCCCEEEEEEECEEEEEEECCCCCCCCHH
Q ss_conf             1799999986126706999999618------9559999999669869999716641577751205999713334321011
Q gi|254780798|r   34 QSVKKAIEHFLSIQTMQGTFLQEDA------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP  107 (204)
Q Consensus        34 ~~~~~i~~~l~~~~t~~a~F~Q~~~------~~~~~G~~~~kkP~k~rw~y~~P~~~~iv~~g~~l~~~d~~~~q~~~~~  107 (204)
                      +++++|+++++++++|+|+|+|+..      ..+++|+|+++|||++||+|.+|.++.+|+||+++|+|+|+++++..++
T Consensus         1 D~~~~l~~~~~~~~s~~a~F~Q~~~~~~~~~~~~~~G~~~~~kP~~~r~~y~~P~~~~iv~~g~~l~~~~~~~~~~~~~~   80 (182)
T d1iwla_           1 DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATW   80 (182)
T ss_dssp             CHHHHHHHHTTSCSEEEEEEEEEEEC-----CEEEEEEEEEETTTEEEEEECSSSCEEEEEESSEEEEEEGGGTEEEEEE
T ss_pred             CHHHHHHHHHHCCCEEEEEEEEEEECCCCCEEEEEEEEEEEEECCEEEEEECCCCCEEEEEECCEEEEECCCCCCCCCCC
T ss_conf             97899999984547389999999975788704789999999809979999815563047850437899535555110024


Q ss_pred             HHHHHHH----HHCCHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCEEEEEEEEECCCCEEEEEEEEEE
Q ss_conf             1111233----210001212221011322357279972046666634799993698429999999679987999997432
Q gi|254780798|r  108 LRYMAFS----VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK  183 (204)
Q Consensus       108 ~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~f~~~~~~l~~~~i~D~~G~~t~i~f~ni~  183 (204)
                      +......    ++.+........ ...........+.+.+.......+.|.|+.++ .+++|++.|..|++|++.|++ +
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~l~~~~~~~~~~~i~l~~~~~~-~l~~i~~~d~~g~~t~i~f~~-~  157 (182)
T d1iwla_          81 LKDATGNTPFMLIARNQSSDWQQ-YNIKQNGDDFVLTPKASNGNLKQFTINVGRDG-TIHQFSAVEQDDQRSSYQLKS-Q  157 (182)
T ss_dssp             GGGCCCCSHHHHHHHCCHHHHTT-EEEEEETTEEEEEESSSSCSEEEEEEEECTTC-CEEEEEEEETTCCEEEEEEEE-E
T ss_pred             CCHHHHCCHHHHHHCCCHHHHHH-HCCCCCCEEEEEEECCCCCCCCEEEEEECCCC-CEEEEEEEECCCCEEEEEEEC-C
T ss_conf             00000015466652120223221-10024430599962487766538999997999-689999998898999999981-0


Q ss_pred             CCCCCCHHHCCC-CCCCCCCCC
Q ss_conf             288689655126-853134489
Q gi|254780798|r  184 ENTVLDPKVFEI-PYDKIHNIN  204 (204)
Q Consensus       184 ~N~~i~~~~F~f-~~~~~~~~~  204 (204)
                      .|+++++++|+| |++++.+|+
T Consensus       158 ~n~~i~~~~F~f~~P~~~eVid  179 (182)
T d1iwla_         158 QNGAVDAAKFTFTPPQGVTVDD  179 (182)
T ss_dssp             EESCCCGGGGSCCCCSSCEEEE
T ss_pred             CCCCCCHHHEEECCCCCCEEEE
T ss_conf             6899997678787959986870



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 204 possible lolA type protein [Candidatus Liberibacte
1iwl_A_182 (A:) P20, outer-membrane lipoproteins carrier prot 2e-12
>1iwl_A (A:) P20, outer-membrane lipoproteins carrier protein; unclosed beta barrel, protein transport; 1.65A {Escherichia coli}Length = 182 Back     alignment and structure
 Score = 66.9 bits (163), Expect = 2e-12
 Identities = 25/170 (14%), Positives = 62/170 (36%), Gaps = 11/170 (6%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
           +          + +   +F Q+       A    +G+ ++ RP+ F +  + P    L+S
Sbjct: 2   AASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVS 61

Query: 89  DGSNIAVYNAKLDTWSVYPLRY---MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           DG  +  YN  ++  +   L+        ++ + NQ    +     ++ + F+      +
Sbjct: 62  DGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASN 121

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                 ++   R    +  +  ++   + S    LK ++N  +D   F  
Sbjct: 122 GNLKQFTINVGRDGT-IHQFSAVEQDDQRSSY-QLKSQQNGAVDAAKFTF 169


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target204 possible lolA type protein [Candidatus Liberibacter asi
2w7q_A_204 Outer-membrane lipoprotein carrier protein; peripl 99.97
1iwl_A_182 P20, outer-membrane lipoproteins carrier protein; 99.96
3buu_A_229 Uncharacterized LOLA superfamily protein NE2245; P 99.81
2v43_A_1-181181 RSEB, sigma-E factor regulatory protein RSEB; sens 99.61
3bk5_A_237 Putative outer membrane lipoprotein-sorting protei 99.57
>2w7q_A (A:) Outer-membrane lipoprotein carrier protein; periplasmic chaperone, lipoprotein transport, transport, periplasm, chaperone; 1.88A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=99.97  E-value=2.3e-28  Score=178.44  Aligned_cols=185  Identities=16%  Similarity=0.193  Sum_probs=149.5

Q ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHHCCCEEEEEEEEEEC---C---CEEEEEEEEECCCEEEEEECCCCEEEEEEECEE
Q ss_conf             9999974034443101799999986126706999999618---9---559999999669869999716641577751205
Q gi|254780798|r   19 SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA---G---YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSN   92 (204)
Q Consensus        19 ~~~~~~~a~~~~~~~~~~~~i~~~l~~~~t~~a~F~Q~~~---~---~~~~G~~~~kkP~k~rw~y~~P~~~~iv~~g~~   92 (204)
                      ++++++.++.+..+++.++++.++++++++++|+|+|+..   +   .+++|++++++|+++||+|.+|..+.+|.||+.
T Consensus         6 ~~~~~~~~~~~~~a~~~l~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~g~~~~~~p~~~r~~~~~p~~~~~v~~G~~   85 (204)
T 2w7q_A            6 HHHLVPRGSIAIDDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTDAPNEQLLISNGEK   85 (204)
T ss_dssp             -------CCCSSCCHHHHHHHHHHHHTCSEEEEEEEEEEECTTSCCEEEEEEEEEEETTTEEEEEECSSSCEEEEEETTE
T ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCEEEEEEEEEEEECCCEEEEEECCCCEEEEEECCCE
T ss_conf             20232035445375689999999984357289999999965889757888999999759989999838870799984988


Q ss_pred             EEEEECCCCCCCCHHHHHH----HHHHHCCHHHHHHHHCCCCCCCCCCE-EEEECCCCCCCCEEEEEEECCCCEEEEEEE
Q ss_conf             9997133343210111111----23321000121222101132235727-997204666663479999369842999999
Q gi|254780798|r   93 IAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKI  167 (204)
Q Consensus        93 l~~~d~~~~q~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~i~l~f~~~~~~l~~~~i  167 (204)
                      +|+|+|+.++++..+....    +..++..................... .+...+.........++++.++..++++++
T Consensus        86 ~~~y~p~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~v~~~~~~~~~~l~l~p~~~~~~~~~~~id~~~~~p~~~~~  165 (204)
T 2w7q_A           86 VWLYDPDLEQVTIQKLDQRLTQTPALLLSGDISKISESFAITYKEGGNVVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQM  165 (204)
T ss_dssp             EEEEETTTTEEEEECHHHHTTTCGGGGGGSCHHHHTTTEEEEEEEETTEEEEEEEESSSCSSCSEEEEEEETTEEEEEEE
T ss_pred             EEEECCCCCCCEECCHHHHHHCCHHHHHCCCCCHHHHHEEEEEECCCCEEEEEECCCCCCCCEEEEEEEECCCEEEEEEE
T ss_conf             99986422511001312210005477761663000000133341257538999845787764569999955993899999


Q ss_pred             EECCCCEEEEEEEEEECCCCCCHHHCCC-CCCCCCCC
Q ss_conf             9679987999997432288689655126-85313448
Q gi|254780798|r  168 MDSSRRYSIIKILKYKENTVLDPKVFEI-PYDKIHNI  203 (204)
Q Consensus       168 ~D~~G~~t~i~f~ni~~N~~i~~~~F~f-~~~~~~~~  203 (204)
                      .|..|+.+++.|++++.|+++++++|.| |+++...|
T Consensus       166 ~~~~g~~~~i~f~~~~~n~~i~~~~F~~~~P~~~~vv  202 (204)
T 2w7q_A          166 IDGVGQRTNILFFDVKMNEALDAKQFTFDVPPGVDVI  202 (204)
T ss_dssp             ECTTCCEEEEEEEEEEESCCCCGGGGCCCCCTTCEEE
T ss_pred             EECCCCEEEEEEEEEEECCCCCHHHEEECCCCCCEEE
T ss_conf             9789899999999546089989535889795997575



>1iwl_A (A:) P20, outer-membrane lipoproteins carrier protein; unclosed beta barrel, protein transport; 1.65A {Escherichia coli} Back     alignment and structure
>3buu_A (A:) Uncharacterized LOLA superfamily protein NE2245; PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.20A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>3bk5_A (A:) Putative outer membrane lipoprotein-sorting protein; putative outer membrane protein domain, PSI-2; HET: MSE; 2.00A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure