254780799

254780799

DNA translocase FtsK

GeneID in NCBI database:8209805Locus tag:CLIBASIA_03450
Protein GI in NCBI database:254780799Protein Accession:YP_003065212.1
Gene range:+(457508, 459928)Protein Length:806aa
Gene description:DNA translocase FtsK
COG prediction:[D] DNA segregation ATPase FtsK/SpoIIIE and related proteins
KEGG prediction:ftsK; DNA translocase FtsK; K03466 DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
SEED prediction:Cell division protein FtsK
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division;
Bacterial RNA-metabolizing Zn-dependent hydrolases;
Bacterial Cytoskeleton
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED6 TM-Helix
HMMTOP5 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800------
MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMASSLLKYLCNMFRVWIGRFLGFAFFISFVKKCLGDSNISVDDYRKKIEPTLDVSFHDAIDINSITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYIDIKDKILLNEEMRFSENSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEECHE
cccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHcccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHcccccccccccccccccccccccccHHHHHHHcccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEccccccEEEccccccEEEEHHHHHcccccccccccEEEEEEEcccccEEEEEccccccEEEEccccccHHHHHHHHHHHHHHcccHHHEEEEEEEcccccHHHHccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccccccccHHHHHHHcccEEEEEEccHHHHHHHHccccHHHHccccEEEEEcccccEEEEEEccccHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccEEEEccHHHHcc
ccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHccccccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccccccccccccccccccccccccccHHHHHHHcccccccccccccccccHHccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEccccccEHHHHHcHHHHHHHHHHHHcEEEEEEccccEEEEEcccccccEEEHHHHHccHHccccccccEEEEccccccccEEEEHccccEEEEEccccccHHHHHHHHHHHHHHHccHHHEEEEEEcccHEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHcHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccEEEEEEEEEccccEEEEEEEcccccHHHccccHHHHHHccccEEEccccccEEEEccccccHHHHHHHHHHHHHcccccHHHHHccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHcccEcccccccccEEEccccccccc
MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALgtwdvydpsfsyitlrspknflgyggaifADVAIQFFGiasvfflppptmWALSLLFDKKIYCFSKRATAWLINILVSAtffasfspsqswpiqngfggiIGDLIIrlpflffesyprkLGILFFQMILFLAMSWLLIYsssaifqgkrrvpynmadclisdesktQLEDVMASSLLKYLCNMFRVWIGRFLGFAFFISFVKKclgdsnisvddyrkkieptldvsfhdaidinsiTEYQLNADIVQNIsqsnlinhgtgtfvlpskeilstsqspvnqmtfspkvmqnnactLKSVlsdfgiqgeivnvrpgpvitlyelepapgikssriigLSDDIARSMSAISARVAVIprrnaigielpndirETVMLRDLIVSRVFEKNQCDLAINlgksiegkpiiadlarmphlliagttgsgksVAINTMILSLLYRMTPAQCRLIMIDPKMLElsvydgipnlltpvvtnpqKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNtgkkfnrtvqtgfdrktgeaiyetehfdfqhmpYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHvimatqrpsvdvitgtikanfptrisfqvsskidsrtilgeqgaeqllgqgdmlymtgggrvqrihgpfvsdIEVEKVVSHLKTQGEAKYIDIKDKILLneemrfsenssvadDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIEnmeekgvigpasstgkREILISSMEECHE
MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMASSLLKYLCNMFRVWIGRFLGFAFFISFVKKCLGDSNISVDDYRKKIEPTLDVSFHDAIDINSITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYelepapgiksSRIIGLSDDIARSMSAISarvaviprrnaigielpndiretVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIagttgsgksvAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLltpvvtnpqKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYhntgkkfnrtvqtgfdRKTGEAIYEtehfdfqhMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGihvimatqrpsVDVITGTIKanfptrisfqvsskidsRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHGPFVSDIEVEKVVShlktqgeakyidikDKILLNEEMRFsenssvaddLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIEnmeekgvigpasstgkreiLISSMEECHE
MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMASSLLKYLCNMFRVWIGRFLGFAFFISFVKKCLGDSNISVDDYRKKIEPTLDVSFHDAIDINSITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTIlgeqgaeqllgqgDMLYMTGGGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYIDIKDKILLNEEMRFSENSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEECHE
*************************MKIVAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQL*****SSLLKYLCNMFRVWIGR*L***********************************************************************LPSKEIL*******************NACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYH*T*KKFNRTVQTGFDRKT******TEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYID***********************YKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGV**********************
MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMASSLLKYLCNMFRVWIGRFLGFAFFISFVKKCLGDSNISVDDYRKKIEPTLDVSFHDAIDINSITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYIDIKDKILLNEEMRFSENSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILI********
*****SFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMASSLLKYLCNMFRVWIGRFLGFAFFISFVKKCLGDSNISVDDY*************************************NLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYIDIKDK***************ADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPA**T**R************
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMASSLLKYLCNMFRVWIGRFLGFAFFISFVKKCLGDSNISVDDYRKKIEPTLDVSFHDAIDINSITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYIDIKDKILLNEEMRFSENSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEECHE
MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMASSLLKYLCNMFRVWIGRFLGFAFFISFVKKCLGDSNISVDDYRKKIEPTLDVSFHDAIDINSITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYIDIKDKILLNEEMRFSENSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEECHE
MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMASSLLKYLCNMFRVWIGRFLGFAFFISFVKKCLGDSNISVDDYRKKIEPTLDVSFHDAIDINSITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYIDIKDKILLNEEMRFSENSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEECHE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
254780606744 cell division protein [Candidatus Liberibacter asi 1e-178
>gi|254780606|ref|YP_003065019.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 744 Back     alignment
 Score =  615 bits (1587), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 311/528 (58%), Positives = 396/528 (75%), Gaps = 30/528 (5%)

Query: 273 HDAIDINSITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVM 332
           H     N++TE+     + Q+ SQ   I  G   +  P    L   QS VN    + +++
Sbjct: 239 HKPSSSNTMTEH-----MFQDTSQE--IAKGQKQYEQPCSSFLQV-QSNVNLQGITHEIL 290

Query: 333 QNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAIS 392
           + NA +L+++L +FGI+GEI+NV PGPV+TLYE EPAPGIKSSR+IGL+DDIARSMS++S
Sbjct: 291 EKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLADDIARSMSSLS 350

Query: 393 ARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLA 452
           ARVAVIP+RNAIGIELPN+ RETV LR +I SR F  ++ +LA+ LGK+I G+ +IADLA
Sbjct: 351 ARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLA 410

Query: 453 RMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPV 512
            MPH+L+AGTTGSGKSVAINTMI+SLLYR+ P +CR+IM+DPKMLELSVYDGIP+LLTPV
Sbjct: 411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPV 470

Query: 513 VTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDR 572
           VTNP+KAV  LKW V EMEERY+KMS + VRNI  +N +++  +  G+K          +
Sbjct: 471 VTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMY--GEK---------PQ 519

Query: 573 KTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMAT 632
             G+        D + MPYIV+++DEMADLMMVA K+IE A+QRLAQMARA+GIH+IMAT
Sbjct: 520 GCGD--------DMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMAT 571

Query: 633 QRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRI 692
           QRPSVDVITGTIKANFP RISFQV+SKIDSRTILGE GAEQLLG+GDMLYM+GGGR+QR+
Sbjct: 572 QRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRV 631

Query: 693 HGPFVSDIEVEKVVSHLKTQGEAKYIDIKDKILLNEEM--RF-SENSSVADDLYKQAVDI 749
           HGP VSDIE+EKVV HLK QG  +Y++        ++    F SE      +LY +AVD+
Sbjct: 632 HGPLVSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDL 691

Query: 750 VLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREIL 797
           V+ + + S S+IQRRL IGYNRAA ++E ME++G++  A   GKR + 
Sbjct: 692 VIDNQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVF 739

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
315122021816 DNA translocase FtsK [Candidatus Liberibacter solanacea 1 0.0
163757411857 putative transmembrane DNA translocase [Hoeflea phototr 1 0.0
110635564840 DNA translocase FtsK [Mesorhizobium sp. BNC1] Length = 1 0.0
17986452797 cell division protein FTSK [Brucella melitensis bv. 1 s 1 0.0
256045504817 DNA translocase ftsK [Brucella melitensis bv. 1 str. Re 1 0.0
326409896797 DNA translocase ftsK [Brucella melitensis M28] Length = 1 0.0
225853332817 DNA translocase ftsK [Brucella melitensis ATCC 23457] L 1 0.0
265991926837 DNA translocase ftsK [Brucella melitensis bv. 1 str. Re 1 0.0
319899430806 cell division transmembrane protein FtsK [Bartonella cl 1 0.0
49474728812 cell division protein ftsK [Bartonella quintana str. To 1 0.0
>gi|315122021|ref|YP_004062510.1| DNA translocase FtsK [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 816 Back     alignment and organism information
 Score = 1217 bits (3150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/819 (74%), Positives = 685/819 (83%), Gaps = 20/819 (2%)

Query: 1   MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLALGTWDVYDPSFSYITL 60
           MSEN+SF+I +KN+ FLLS+W K+K+K  AGLILL  +F+I L+L TW+VYDPSFSYITL
Sbjct: 1   MSENISFVIEDKNKRFLLSNWYKRKVKFFAGLILLFMLFSIVLSLATWNVYDPSFSYITL 60

Query: 61  RSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINI 120
             PKNFLGYGGAIFAD+AIQF GIASVF L PPT W+L LLFDK  Y FS+R  AW+ N 
Sbjct: 61  NPPKNFLGYGGAIFADIAIQFLGIASVFCLIPPTAWSLVLLFDKIFYRFSQRFIAWIANF 120

Query: 121 LVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSW 180
           LVS  FFASF PSQ WPIQNGFGGIIGD+I+RLP LF ES P++ GI  F+++LF AM W
Sbjct: 121 LVSTAFFASFKPSQLWPIQNGFGGIIGDVIMRLPILFAESSPKESGIFLFKVVLFFAMIW 180

Query: 181 LLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMAS---SLLKYLCNMFRVWIGRFL 237
           LL+++S AI  G   V ++  D  I +E K Q +D+  S   ++L+YLCN+ + WI    
Sbjct: 181 LLLFASGAISNGSY-VIHDAEDNPI-NEQKKQSKDIQESILLNILQYLCNISKNWISHVF 238

Query: 238 GFAFFISFVKKCLGDSNISVDDYRKKIEPTLDVSFHDAIDINSITEYQ----------LN 287
           G + F+S +KK   + N+S     +KIEPTLD+SF D +D + + E             N
Sbjct: 239 GLSVFLSLMKKKPENCNLSFHVSNEKIEPTLDMSFSDIMDFDHVIESHKDIAYPEDNLFN 298

Query: 288 ADI---VQN-ISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVL 343
            DI   VQN I  SN IN GTGTF LPS++ILSTS+S VN   FSP V+++NAC L+SVL
Sbjct: 299 TDICPDVQNTIPSSNSINSGTGTFSLPSEKILSTSKSLVNNRAFSPDVIRSNACMLQSVL 358

Query: 344 SDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRRNA 403
           SDFGIQGEIVN+ PGPV+TLYELEPAPGIKSSRIIGL+DDIARSMSAISARVAVIP RNA
Sbjct: 359 SDFGIQGEIVNICPGPVVTLYELEPAPGIKSSRIIGLADDIARSMSAISARVAVIPGRNA 418

Query: 404 IGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTT 463
           IGIELPND+RETV+LRDLI S VFEKN+ DLAI+LGK+I G+PI+ADLA+MPHLLIAGTT
Sbjct: 419 IGIELPNDVRETVVLRDLIFSNVFEKNKSDLAISLGKNIAGEPIVADLAKMPHLLIAGTT 478

Query: 464 GSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVL 523
           GSGKSVAINTMILSLLYRM P QCRLIMIDPKMLELSVYDGIPNLLTPVVT+P+KAV  L
Sbjct: 479 GSGKSVAINTMILSLLYRMRPDQCRLIMIDPKMLELSVYDGIPNLLTPVVTDPKKAVVAL 538

Query: 524 KWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEH 583
           KWLVCEMEERYQKMSKIGVRNIDGFNLK+AQYHN GK FNRTVQTGFDR+TGEAIYETEH
Sbjct: 539 KWLVCEMEERYQKMSKIGVRNIDGFNLKIAQYHNAGKSFNRTVQTGFDRETGEAIYETEH 598

Query: 584 FDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGT 643
            DFQHMPYIVVVIDEMADLMMVARKDIE  VQRLAQMARASGIHVIMATQRPSVDVITGT
Sbjct: 599 LDFQHMPYIVVVIDEMADLMMVARKDIEGTVQRLAQMARASGIHVIMATQRPSVDVITGT 658

Query: 644 IKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHGPFVSDIEVE 703
           IKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGR+QRIHGPFVSD+EVE
Sbjct: 659 IKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRIQRIHGPFVSDMEVE 718

Query: 704 KVVSHLKTQGEAKYIDIKDKILLNEEMRFSENSSVADDLYKQAVDIVLRDNKASISYIQR 763
           KVVSHLK QGEA+YIDI DK++  E M F EN SV+DDLYKQAVDIVLRDNKASISYIQR
Sbjct: 719 KVVSHLKKQGEAQYIDINDKMMAKENMSFLEN-SVSDDLYKQAVDIVLRDNKASISYIQR 777

Query: 764 RLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSME 802
           RLGIGYNRAAS+IE+ME KGVI PASSTGKREIL+ S E
Sbjct: 778 RLGIGYNRAASLIESMEAKGVISPASSTGKREILLFSTE 816


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163757411|ref|ZP_02164500.1| putative transmembrane DNA translocase [Hoeflea phototrophica DFL-43] Length = 857 Back     alignment and organism information
>gi|110635564|ref|YP_675772.1| DNA translocase FtsK [Mesorhizobium sp. BNC1] Length = 840 Back     alignment and organism information
>gi|17986452|ref|NP_539086.1| cell division protein FTSK [Brucella melitensis bv. 1 str. 16M] Length = 797 Back     alignment and organism information
>gi|256045504|ref|ZP_05448387.1| DNA translocase ftsK [Brucella melitensis bv. 1 str. Rev.1] Length = 817 Back     alignment and organism information
>gi|326409896|gb|ADZ66961.1| DNA translocase ftsK [Brucella melitensis M28] Length = 797 Back     alignment and organism information
>gi|225853332|ref|YP_002733565.1| DNA translocase ftsK [Brucella melitensis ATCC 23457] Length = 817 Back     alignment and organism information
>gi|265991926|ref|ZP_06104483.1| DNA translocase ftsK [Brucella melitensis bv. 1 str. Rev.1] Length = 837 Back     alignment and organism information
>gi|319899430|ref|YP_004159527.1| cell division transmembrane protein FtsK [Bartonella clarridgeiae 73] Length = 806 Back     alignment and organism information
>gi|49474728|ref|YP_032770.1| cell division protein ftsK [Bartonella quintana str. Toulouse] Length = 812 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisional 1e-139
COG1674858 COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and 1e-129
pfam01580202 pfam01580, FtsK_SpoIIIE, FtsK/SpoIIIE family 6e-54
pfam0939767 pfam09397, Ftsk_gamma, Ftsk gamma domain 3e-23
smart0084363 smart00843, Ftsk_gamma, This domain directs oriented DN 7e-23
pfam10412386 pfam10412, TrwB_AAD_bind, Type IV secretion-system coup 0.001
>gnl|CDD|182344 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|31860 COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|144975 pfam01580, FtsK_SpoIIIE, FtsK/SpoIIIE family Back     alignment and domain information
>gnl|CDD|150161 pfam09397, Ftsk_gamma, Ftsk gamma domain Back     alignment and domain information
>gnl|CDD|129076 smart00843, Ftsk_gamma, This domain directs oriented DNA translocation and forms a winged helix structure Back     alignment and domain information
>gnl|CDD|150993 pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
PRK102631355 DNA translocase FtsK; Provisional 100.0
COG1674858 FtsK DNA segregation ATPase FtsK/SpoIIIE and related pr 100.0
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 100.0
PRK13898800 type IV secretion system ATPase VirB4; Provisional 96.88
PRK13853789 type IV secretion system protein VirB4; Provisional 96.52
PRK13830818 conjugal transfer protein TrbE; Provisional 96.06
PRK13721864 conjugal transfer ATP-binding protein TraC; Provisional 95.24
smart0084363 Ftsk_gamma This domain directs oriented DNA translocati 99.89
pfam0939767 Ftsk_gamma Ftsk gamma domain. This domain directs orien 99.89
COG1674 858 FtsK DNA segregation ATPase FtsK/SpoIIIE and related pr 99.09
PRK06871324 DNA polymerase III subunit delta'; Validated 95.51
pfam05872504 DUF853 Bacterial protein of unknown function (DUF853). 94.41
KOG2655366 consensus 93.15
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 98.03
TIGR02759613 TraD_Ftype type IV conjugative transfer system coupling 97.48
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 97.29
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.48
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 96.36
PRK00440318 rfc replication factor C small subunit; Reviewed 96.16
PRK13851343 type IV secretion system protein VirB11; Provisional 95.68
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 95.66
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 95.62
PRK13900332 type IV secretion system ATPase VirB11; Provisional 95.62
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 95.37
smart00487201 DEXDc DEAD-like helicases superfamily. 95.15
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 94.53
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 94.28
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 94.15
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 92.79
PTZ00301210 uridine kinase; Provisional 92.72
PRK04195403 replication factor C large subunit; Provisional 91.3
COG5019373 CDC3 Septin family protein [Cell division and chromosom 91.26
KOG0735 952 consensus 90.85
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 90.62
PRK08233182 hypothetical protein; Provisional 90.29
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 90.25
COG0433520 HerA helicase [Replication, recombination, and repair] 97.96
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 97.76
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.9
pfam02534468 TraG TraG/TraD family. These proteins contain a P-loop 95.99
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 94.43
PRK13897628 type IV secretion system component VirD4; Provisional 92.73
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 90.54
smart00382148 AAA ATPases associated with a variety of cellular activ 97.6
PRK13700732 conjugal transfer protein TraD; Provisional 97.36
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 96.98
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 96.95
pfam06745231 KaiC KaiC. This family represents a conserved region wi 94.89
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 94.81
PRK04328250 hypothetical protein; Provisional 94.75
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 93.66
COG4185187 Uncharacterized protein conserved in bacteria [Function 93.25
PRK09112352 DNA polymerase III subunit delta'; Validated 90.58
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 90.5
COG3451796 VirB4 Type IV secretory pathway, VirB4 components [Intr 97.25
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 90.82
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 96.88
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 95.94
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 93.91
PRK13873815 conjugal transfer ATPase TrbE; Provisional 96.64
PRK10263 1355 DNA translocase FtsK; Provisional 96.5
TIGR02746900 TraC-F-type type-IV secretion system protein TraC; Inte 96.38
PRK13891852 conjugal transfer protein TrbE; Provisional 96.3
PRK08187606 pyruvate kinase; Validated 94.02
PRK13833323 conjugal transfer protein TrbB; Provisional 96.27
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 94.66
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 94.17
PRK13894320 conjugal transfer ATPase TrbB; Provisional 93.5
TIGR00929931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 94.97
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 94.64
pfam04157219 EAP30 EAP30/Vps36 family. This family includes EAP30 as 94.6
pfam06814287 Lung_7-TM_R Lung seven transmembrane receptor. This fam 94.51
TIGR01667724 YCCS_YHJK integral membrane protein, YccS/YhfK family; 92.01
TIGR02163263 napH_ ferredoxin-type protein, NapH/MauN family; InterP 91.34
KOG2568518 consensus 90.54
COG3596296 Predicted GTPase [General function prediction only] 94.23
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 93.93
pfam05621302 TniB Bacterial TniB protein. This family consists of se 93.67
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 93.24
TIGR00099270 Cof-subfamily Cof-like hydrolase; InterPro: IPR000150 T 93.08
pfam09726680 Macoilin Transmembrane protein. This entry is a highly 92.88
TIGR01666713 YCCS hypothetical membrane protein, TIGR01666; InterPro 92.66
KOG2927372 consensus 91.16
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 91.09
TIGR01271 1534 CFTR_protein cystic fibrosis transmembrane conductor re 90.51
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell moti 90.82
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 90.02
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>COG1674 FtsK DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family Back     alignment and domain information
>PRK13898 type IV secretion system ATPase VirB4; Provisional Back     alignment and domain information
>PRK13853 type IV secretion system protein VirB4; Provisional Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional Back     alignment and domain information
>smart00843 Ftsk_gamma This domain directs oriented DNA translocation and forms a winged helix structure Back     alignment and domain information
>pfam09397 Ftsk_gamma Ftsk gamma domain Back     alignment and domain information
>COG1674 FtsK DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>pfam05872 DUF853 Bacterial protein of unknown function (DUF853) Back     alignment and domain information
>KOG2655 consensus Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD; InterPro: IPR014128 The TraD protein performs an essential coupling function in conjugative type IV secretion systems Back     alignment and domain information
>pfam01935 DUF87 Domain of unknown function DUF87 Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway) Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR014155 This entry contains VirB11, a protein that is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>KOG0735 consensus Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149 This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG0433 HerA helicase [Replication, recombination, and repair] Back     alignment and domain information
>pfam10412 TrwB_AAD_bind Type IV secretion-system coupling protein DNA-binding domain Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>pfam02534 TraG TraG/TraD family Back     alignment and domain information
>pfam05707 Zot Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>pfam07693 KAP_NTPase KAP family P-loop domain Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>pfam06745 KaiC KaiC Back     alignment and domain information
>pfam00735 Septin Septin Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>pfam03796 DnaB_C DnaB-like helicase C terminal domain Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13873 conjugal transfer ATPase TrbE; Provisional Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>TIGR02746 TraC-F-type type-IV secretion system protein TraC; InterPro: IPR014117 The proteins in this entry are found in the F, P and I-like type IV secretion systems Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>PRK08187 pyruvate kinase; Validated Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>pfam00437 GSPII_E Type II/IV secretion system protein Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family; InterPro: IPR004346 This family includes the Helicobacter pylori protein CagE (see examples), which together with other proteins from the cag pathogenicity island (PAI), encodes a type IV transporter secretion system Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>pfam04157 EAP30 EAP30/Vps36 family Back     alignment and domain information
>pfam06814 Lung_7-TM_R Lung seven transmembrane receptor Back     alignment and domain information
>TIGR01667 YCCS_YHJK integral membrane protein, YccS/YhfK family; InterPro: IPR010020 This entry identifies a clade of sequences from gamma and beta proteobacteria Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family; InterPro: IPR011886 Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase Back     alignment and domain information
>KOG2568 consensus Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>pfam06414 Zeta_toxin Zeta toxin Back     alignment and domain information
>pfam05621 TniB Bacterial TniB protein Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369 GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof-like hydrolase; InterPro: IPR000150 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification Back     alignment and domain information
>pfam09726 Macoilin Transmembrane protein Back     alignment and domain information
>TIGR01666 YCCS hypothetical membrane protein, TIGR01666; InterPro: IPR010019 This entry identifies a clade of sequences from gamma and beta proteobacteria Back     alignment and domain information
>KOG2927 consensus Back     alignment and domain information
>pfam00270 DEAD DEAD/DEAH box helicase Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR); InterPro: IPR005291 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
2ius_A512 E. Coli Ftsk Motor Domain Length = 512 1e-159
2iut_A574 P. Aeruginosa Ftsk Motor Domain, Dimeric Length = 5 1e-152
2iuu_A491 P. Aeruginosa Ftsk Motor Domain, Hexamer Length = 4 1e-123
2j5p_A76 E. Coli Ftsk Gamma Domain Length = 76 2e-26
2ve8_A73 Xray Structure Of Ftsk Gamma Domain (P. Aeruginosa) 3e-25
2j5o_A72 Pseudomonas Aeruginosa Ftsk Gamma Domain Length = 7 7e-25
>gi|114794775|pdb|2IUS|A Chain A, E. Coli Ftsk Motor Domain Length = 512 Back     alignment and structure
 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 240/501 (47%), Positives = 314/501 (62%), Gaps = 11/501 (2%)

Query: 303 GTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVIT 362
              T  LPS ++L+    P          ++  A  +++ L+DF I+ ++VN  PGPVIT
Sbjct: 17  HKPTTPLPSLDLLTP--PPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVIT 74

Query: 363 LYELEPAPGIKSSRIIGLSDDIARSMSAISARV-AVIPRRNAIGIELPNDIRETVMLRDL 421
            +EL  APG+K++RI  LS D+ARS+S ++ RV  VIP +  +G+ELPN  R+TV LR++
Sbjct: 75  RFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREV 134

Query: 422 IVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYR 481
           + +  F  N   L + LGK I G+P++ADLA+MPHLL+AGTTGSG SV +N MILS+LY+
Sbjct: 135 LDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGASVGVNAMILSMLYK 194

Query: 482 MTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIG 541
             P   R IMIDPKMLELSVY+GIP+LLT VVT+ + A   L+W V EME RY+ MS +G
Sbjct: 195 AQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALG 254

Query: 542 VRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMAD 601
           VRN+ G+N K+A+     +          D          +H   +  PYIVV++DE AD
Sbjct: 255 VRNLAGYNEKIAEADRMMRPIPDPYWKPGDSMDA------QHPVLKKEPYIVVLVDEFAD 308

Query: 602 LMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKID 661
           LMM   K +E  + RLAQ ARA+GIH+++ATQRPSVDVITG IKAN PTRI+F VSSKID
Sbjct: 309 LMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKID 368

Query: 662 SRTILGEQGAEQLLGQGDMLYMTGGGR-VQRIHGPFVSDIEVEKVVSHLKTQGEAKYIDI 720
           SRTIL + GAE LLG GDMLY         R+HG FV D EV  VV   K +G  +Y+D 
Sbjct: 369 SRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARGRPQYVDG 428

Query: 721 KDKILLNEEMRFSENS-SVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENM 779
                 +E      +     D L+ QAV  V    KASIS +QR+  IGYNRAA IIE M
Sbjct: 429 ITSDSESEGGAGGFDGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQM 488

Query: 780 EEKGVIGPASSTGKREILISS 800
           E +G++      G RE+L   
Sbjct: 489 EAQGIVSEQGHNGNREVLAPP 509


>gi|114794781|pdb|2IUT|A Chain A, P. Aeruginosa Ftsk Motor Domain, Dimeric Length = 574 Back     alignment and structure
>gi|114794783|pdb|2IUU|A Chain A, P. Aeruginosa Ftsk Motor Domain, Hexamer Length = 491 Back     alignment and structure
>gi|198443093|pdb|2VE8|A Chain A, Xray Structure Of Ftsk Gamma Domain (P. Aeruginosa) Length = 73 Back     alignment and structure
>gi|159164686|pdb|2J5O|A Chain A, Pseudomonas Aeruginosa Ftsk Gamma Domain Length = 72 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromosome pa 1e-146
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromosome pa 1e-141
2ve8_A73 FTSK, DNA translocase FTSK; nucleotide-binding, chromos 1e-20
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, bacte 2e-05
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA ATG; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Length = 574 Back     alignment and structure
 Score =  515 bits (1326), Expect = e-146
 Identities = 240/518 (46%), Positives = 331/518 (63%), Gaps = 19/518 (3%)

Query: 296 QSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNV 355
           Q+ L         LP   +L    + V Q ++SP+ ++  +  L+  L +FG++  + +V
Sbjct: 57  QAPLFVDTAVEGTLPPLSLLD--PAEVKQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSV 114

Query: 356 RPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARV-AVIPRRNAIGIELPNDIRE 414
            PGPVIT +E++PA G+K SRI  L+ D+ARS++ IS RV  VIP +  +GIE+PN+ R+
Sbjct: 115 HPGPVITRFEIQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPGKTTVGIEIPNEDRQ 174

Query: 415 TVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTM 474
            V   +++ S  +++++  + + LG  I G+PII DLA+MPHLL+AGTTGSGKSV +N M
Sbjct: 175 MVRFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAM 234

Query: 475 ILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERY 534
           +LS+L++ TP++ RLIMIDPKMLELS+Y+GIP+LL PVVT+ ++A   L+W V EME RY
Sbjct: 235 LLSILFKSTPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRY 294

Query: 535 QKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVV 594
           + M+ +GVRN+ GFN KV      G      +             + E      +P IVV
Sbjct: 295 RLMAAMGVRNLAGFNRKVKDAEEAGTPLTDPLFRRES-------PDDEPPQLSTLPTIVV 347

Query: 595 VIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISF 654
           V+DE AD+MM+  K +E  + R+AQ ARA+GIH+I+ATQRPSVDVITG IKAN PTRI+F
Sbjct: 348 VVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLIKANIPTRIAF 407

Query: 655 QVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRV-QRIHGPFVSDIEVEKVVSHLKTQG 713
           QVSSKIDSRTIL + GAEQLLG GDMLY+  G  +  R+HG FVSD EV +VV   K +G
Sbjct: 408 QVSSKIDSRTILDQGGAEQLLGHGDMLYLPPGTGLPIRVHGAFVSDDEVHRVVEAWKLRG 467

Query: 714 EAKYID--------IKDKILLNEEMRFSENSSVADDLYKQAVDIVLRDNKASISYIQRRL 765
              YI+                +    S   S  D LY +AV  V    +ASIS +QR+L
Sbjct: 468 APDYIEDILAGVDEXXXXXXSFDGGDGSGEGSEDDPLYDEAVRFVTESRRASISAVQRKL 527

Query: 766 GIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEE 803
            IGYNRAA +IE ME  GV+ P ++ G RE++  +   
Sbjct: 528 KIGYNRAARMIEAMEMAGVVTPMNTNGSREVIAPAPVR 565


>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Length = 512 Back     alignment and structure
>2ve8_A FTSK, DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA-binding, winged helix, bacterial cell division; HET: DNA; 1.4A {Pseudomonas aeruginosa} SCOP: a.4.5.67 PDB: 2ve9_A* 2j5o_A* Length = 73 Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Length = 437 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromosome pa 100.0
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromosome pa 100.0
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ESCRT, 100.0
2ve8_A73 FTSK, DNA translocase FTSK; nucleotide-binding, chromos 99.91
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, bacte 98.96
1cr0_A296 DNA primase/helicase; RECA-type protein fold, transfera 96.5
3bh0_A315 DNAB-like replicative helicase; ATPase, replication; 2. 96.04
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, hexame 95.89
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, unknown 95.59
2cvh_A220 DNA repair and recombination protein RADB; filament for 95.39
2w0m_A235 SSO2452; RECA, SSPF, unknown function; 2.0A {Sulfolobus 93.78
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA prote 93.0
1nlf_A279 Regulatory protein REPA; replicative DNA helicase struc 92.11
1w5s_A412 ORC2; CDC6, DNA replication initiation, DNA binding pro 91.16
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P-loop, 90.83
1q57_A503 DNA primase/helicase; dntpase, DNA replication, transfe 96.9
3bgw_A444 DNAB-like replicative helicase; ATPase, replication; 3. 96.4
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A {Therm 95.97
2r6a_A454 DNAB helicase, replicative helicase; replication, DNAB; 95.58
2qby_B384 CDC6 homolog 3, cell division control protein 6 homolog 92.71
2qby_A386 CDC6 homolog 1, cell division control protein 6 homolog 96.24
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division, GTP 95.86
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, nucle 95.82
2gza_A361 Type IV secretion system protein VIRB11; ATPase, hydrol 95.62
2eyu_A261 Twitching motility protein PILT; pilus retraction motor 95.3
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPase, se 94.95
1p9r_A418 General secretion pathway protein E; bacterial type II 94.77
2ewv_A372 Twitching motility protein PILT; pilus retraction motor 94.37
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; 94.18
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, structu 93.2
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processivity 93.14
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, trans 92.32
3lxw_A247 GTPase IMAP family member 1; immunity, structural genom 92.07
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase 91.82
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone; HET: M 90.98
3b6e_A216 Interferon-induced helicase C domain-containing protein 90.77
2xtp_A260 GTPase IMAP family member 2; immune system, G protein; 90.41
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gamma, d 90.07
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division, GTP 95.85
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV secr 95.8
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domain, he 90.7
2oap_1511 GSPE-2, type II secretion system protein; hexameric ATP 95.03
2qnr_A301 Septin-2, protein NEDD5; structural genomics consortium 94.48
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processivity 93.69
3cuq_A234 Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, alterna 92.76
2qpt_A550 EH domain-containing protein-2; protein-nucleotide comp 91.27
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA ATG; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=1479.00  Aligned_cols=504  Identities=48%  Similarity=0.758  Sum_probs=470.5

Q ss_pred             HCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEEEEEEEECCC
Q ss_conf             00000002222357620366135332001245556325665457899999974248632899841044244444321478
Q gi|254780799|r  292 QNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPG  371 (806)
Q Consensus       292 ~~~~q~~~~~~~~~~YkLPsLdLL~~~~~~~~~~~~s~eeL~~nA~lLE~tL~dFGVe~~Vv~v~pGPVVTrYEi~PApG  371 (806)
                      .+..+.+.......+|+|||++||+.+..  +....|+++|++++++|++||++|||+++|+++.+|||||||||+|++|
T Consensus        53 ~~~~~~~l~~~~~~~y~lP~~~LL~~~~~--~~~~~~~~~l~~~a~~Le~tL~~fgI~~~V~~~~~GP~vtr~el~p~~G  130 (574)
T 2iut_A           53 LKEKQAPLFVDTAVEGTLPPLSLLDPAEV--KQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSVHPGPVITRFEIQPAAG  130 (574)
T ss_dssp             -----------------CCCGGGSCCCCC--CCCCCCHHHHHHHHHHHHHHHHHTTCCCCEEEEEECSSEEEEEECCCTT
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHCCCCCC--CCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEEEEEEEECCC
T ss_conf             32224444457788889989778389875--6667899999999999999999779737999404698589999987999


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCC-CCCCCCCEEEEEECCCCCCEEEEHHHCCCHHHHHCCCCCHHHCCCCCCCCEEEEE
Q ss_conf             639999978899998863001210-0038861255530245662387342307213430221000210456666667854
Q gi|254780799|r  372 IKSSRIIGLSDDIARSMSAISARV-AVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIAD  450 (806)
Q Consensus       372 VKvSKI~nLadDIA~aLsa~svRI-apIPGK~~VGIEiPN~~r~~V~lreil~s~~f~~s~~~L~iaLGKdI~G~pvv~D  450 (806)
                      ||||||+||+||||++|++.|||| ||||||++|||||||.+|++|+|+|++++++|++++++||++||||++|+|++.|
T Consensus       131 vkvskI~~L~~DLa~aL~a~svRI~apipGk~~vgievPn~~~~~V~l~~~~~~~~~~~~~~~l~v~lG~d~~G~~~~~d  210 (574)
T 2iut_A          131 VKVSRISNLAKDLARSLAVISVRVVEVIPGKTTVGIEIPNEDRQMVRFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITD  210 (574)
T ss_dssp             CCHHHHHHTHHHHHHHHTCSCCEEESCCTTSSCEEEEEECTTCCCCBHHHHHTSHHHHTCCCSSEEEEEEETTSCEEEEE
T ss_pred             CCHHHHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCCCCCEEEHHHHHHCCCCCCCCCCEEEEEEECCCCCEEEEE
T ss_conf             75899987889999986256526873058870589989889873665589663500024677437887752578666510


Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCHHHEEEEEECCCHHHHHHCCCCHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             10020235530477406799999999999829957847888523100111027703431223343045668999999999
Q gi|254780799|r  451 LARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEM  530 (806)
Q Consensus       451 LakMPHLLIAGtTGSGKSV~iN~iI~SlLyk~~P~evkliliDPK~vEls~Y~~iPHLl~pVvTd~~kA~~aL~w~V~EM  530 (806)
                      |+||||||||||||||||||+|+||+||||+++|+||||+||||||+||+.|++||||++|||||+++|+.+|+|+|.||
T Consensus       211 l~k~PHlLIAG~TGSGKSv~l~siI~SLl~~~sP~ev~liLIDpK~~el~~y~~iPHl~~pVitd~~~a~~~L~~~v~EM  290 (574)
T 2iut_A          211 LAKMPHLLVAGTTGSGKSVGVNAMLLSILFKSTPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEM  290 (574)
T ss_dssp             GGGSCCEEEECCTTSSHHHHHHHHHHHHHTTCCTTTEEEEEECSSSHHHHTTTTCTTBSSSCBCCHHHHHHHHHHHHHHH
T ss_pred             HHHCCEEEEECCCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             41288189971688756199999999999858954617999636622204137998555322276799999999999999


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCCHH
Q ss_conf             99999998708996899999999887447866775446776545432223322323469868776344688887321005
Q gi|254780799|r  531 EERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDI  610 (806)
Q Consensus       531 e~RY~l~a~~~vRni~~yN~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lp~ivviiDElaDlmm~~~~~v  610 (806)
                      ||||++|+++|||||.+||+|+.+..+.|.+..++.+...+++.       +...+++||||||||||||||||+++++|
T Consensus       291 erRy~ll~~~gvrnI~~yn~k~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~lP~IVviIDE~AdLm~~~~~ev  363 (574)
T 2iut_A          291 ERRYRLMAAMGVRNLAGFNRKVKDAEEAGTPLTDPLFRRESPDD-------EPPQLSTLPTIVVVVDEFADMMMIVGKKV  363 (574)
T ss_dssp             HHHHHHHHHHTCSSHHHHHHHHHHHHHTTCCCBCTTCCCCSTTC-------CCCBCCCCCEEEEEESCCTTHHHHTCHHH
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC-------CCCCCCCCCEEEEEEHHHHHHHHHHHHHH
T ss_conf             99999999838631899999998776427865674335667433-------56544567569986387899987646889


Q ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCCCCHHHHHCCCCEEEEEECCCCCCHHHCCCCCHHHHCCCCCEEEECCC-CCE
Q ss_conf             8899999986641423799996577753554355411025158764586642123388645786588754773689-832
Q gi|254780799|r  611 ESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGG-GRV  689 (806)
Q Consensus       611 e~~i~rlaq~ara~GiHli~aTqrPsvdvitg~ikan~p~riaf~v~s~~dSrtild~~gae~Llg~gdml~~~~~-~~~  689 (806)
                      |++|+||||||||+||||||||||||+|||||+||||||+||||+|+|++|||||||++|||+|+|+|||||+++| +.|
T Consensus       364 e~~i~rlAq~gRA~GIHLIlATQRPs~dvItg~IKaN~p~RIaf~v~s~~dSr~ILd~~GAE~Llg~Gdml~~~~g~~~~  443 (574)
T 2iut_A          364 EELIARIAQKARAAGIHLILATQRPSVDVITGLIKANIPTRIAFQVSSKIDSRTILDQGGAEQLLGHGDMLYLPPGTGLP  443 (574)
T ss_dssp             HHHHHHHHHHCTTTTEEEEEEESCCCTTTSCHHHHHTCCEEEEECCSCHHHHHHHHSSSCGGGCCSTTEEEEECTTCSSC
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHCCCEEEEEECCHHHHCCCCCCCCHHHCCCCCCEEEECCCCCEE
T ss_conf             99999999999974988998406776561046698627753899868743303113778976778999868962898345


Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC--------CCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEHH
Q ss_conf             58883348988999999999712897421100124556--------6677888887777038999999996598500014
Q gi|254780799|r  690 QRIHGPFVSDIEVEKVVSHLKTQGEAKYIDIKDKILLN--------EEMRFSENSSVADDLYKQAVDIVLRDNKASISYI  761 (806)
Q Consensus       690 ~r~~g~~v~~~ev~~v~~~~~~q~~~~y~~~~~~~~~~--------~~~~~~~~~~~~d~l~~~a~~~v~~~~~~s~s~l  761 (806)
                      +|+|||||||+||++||+|||+|++|+|.+++.....+        +++.++++.++.||||+||+++|+++|+||||+|
T Consensus       444 ~r~q~afvsd~ei~~vv~~~k~q~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~l~~~a~~~v~~~~~~S~s~l  523 (574)
T 2iut_A          444 IRVHGAFVSDDEVHRVVEAWKLRGAPDYIEDILAGVDEGGGGGGSFDGGDGSGEGSEDDPLYDEAVRFVTESRRASISAV  523 (574)
T ss_dssp             EEEEECBCCHHHHHHHHHHHHTTCCCCCCTTSCC----------------------------------------------
T ss_pred             EEEECCCCCHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHH
T ss_conf             78741407889999999999863999763111013432000124567777777876666799999999998297429999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHCCCCCHHHCCCCCEEEECHHHHH
Q ss_conf             2220011778999999999779868022788726731712530
Q gi|254780799|r  762 QRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEEC  804 (806)
Q Consensus       762 qr~~~igy~raar~~~~~e~~giv~~~~g~~~r~vl~~~~~~~  804 (806)
                      ||||||||||||||||+||++|||||++||||||||++++.++
T Consensus       524 qr~~~igy~raar~id~le~~givg~~~g~~~r~vl~~~~~~~  566 (574)
T 2iut_A          524 QRKLKIGYNRAARMIEAMEMAGVVTPMNTNGSREVIAPAPVRD  566 (574)
T ss_dssp             -------------------------------------------
T ss_pred             HHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCC
T ss_conf             8612465457899999999677988766897871727998510



>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, alternative splicing, coiled coil, cytoplasm, nucleus, protein transport; 2.61A {Homo sapiens} PDB: 2zme_B Back     alignment and structure
>2ve8_A FTSK, DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA-binding, winged helix, bacterial cell division; HET: DNA; 1.4A {Pseudomonas aeruginosa} SCOP: a.4.5.67 PDB: 2ve9_A* 2j5o_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, X-RAY diffraction, structural genomics, NPPSFA; HET: ADP; 2.00A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown function; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1w5s_A ORC2; CDC6, DNA replication initiation, DNA binding protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis 1330} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein transport; HET: ADP; 2.80A {Aquifex aeolicus VF5} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3lxw_A GTPase IMAP family member 1; immunity, structural genomics consortium, SGC, immune system; HET: GDP; 2.21A {Homo sapiens} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone; HET: MSE; 1.70A {Methylobacterium extorquens AM1} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing protein 1; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, structural genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolase/protein binding complex; 2.40A {Helicobacter pylori 26695} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein-protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus dsm 4304} PDB: 2oaq_1 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, cell cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cuq_A Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, alternative splicing, coiled coil, cytoplasm, nucleus, protein transport; 2.61A {Homo sapiens} PDB: 2zme_A Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
d2ve8a167 a.4.5.67 (A:745-811) DNA translocase FtsK {Pseudomonas 5e-22
d2j5pa169 a.4.5.67 (A:1261-1329) DNA translocase FtsK {Escherichi 2e-20
d1e9ra_433 c.37.1.11 (A:) Bacterial conjugative coupling protein T 8e-06
>d2ve8a1 a.4.5.67 (A:745-811) DNA translocase FtsK {Pseudomonas aeruginosa [TaxId: 287]} Length = 67 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: FtsK C-terminal domain-like
domain: DNA translocase FtsK
species: Pseudomonas aeruginosa [TaxId: 287]
 Score =  100 bits (251), Expect = 5e-22
 Identities = 30/64 (46%), Positives = 41/64 (64%)

Query: 740 DDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILIS 799
           D LY +AV  V    +ASIS +QR+L IGYNRAA +IE ME  GV+ P ++ G RE++  
Sbjct: 3   DPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAGVVTPMNTNGSREVIAP 62

Query: 800 SMEE 803
           +   
Sbjct: 63  APVR 66


>d2j5pa1 a.4.5.67 (A:1261-1329) DNA translocase FtsK {Escherichia coli [TaxId: 562]} Length = 69 Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Length = 433 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
d2j5pa169 DNA translocase FtsK {Escherichia coli [TaxId: 562]} 99.9
d2ve8a167 DNA translocase FtsK {Pseudomonas aeruginosa [TaxId: 28 99.89
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Escherichi 98.87
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain {Bac 96.45
d1nlfa_274 Hexameric replicative helicase repA {Escherichia coli [ 94.44
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. strain 94.37
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. strain 90.88
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pylori [ 97.62
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio cholerae [T 94.64
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garden pea 93.19
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia coli [ 92.91
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domain {Es 91.15
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyces cer 90.82
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyces cer 93.62
>d2j5pa1 a.4.5.67 (A:1261-1329) DNA translocase FtsK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: FtsK C-terminal domain-like
domain: DNA translocase FtsK
species: Escherichia coli [TaxId: 562]
Probab=99.90  E-value=3.9e-25  Score=204.46  Aligned_cols=69  Identities=43%  Similarity=0.650  Sum_probs=65.2

Q ss_pred             CCCCCCHHHHHHHHHHHHCCCEEEEHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHCCCCCEEEECHHHH
Q ss_conf             887777038999999996598500014222001177899999999977986802278872673171253
Q gi|254780799|r  735 NSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEE  803 (806)
Q Consensus       735 ~~~~~d~l~~~a~~~v~~~~~~s~s~lqr~~~igy~raar~~~~~e~~giv~~~~g~~~r~vl~~~~~~  803 (806)
                      ++++.||||++|+++|++++++|||+|||||||||||||||||+||++|||||++|+||||||++++.|
T Consensus         1 G~~~~D~ly~~a~~~V~~~~kaS~S~lQR~l~IGYnRAariid~LE~~GiVsp~~~~~~ReVL~~~~~~   69 (69)
T d2j5pa1           1 GAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEAQGIVSEQGHNGNREVLAPPPFD   69 (69)
T ss_dssp             CTTTSCTTHHHHHHHHHHTTEEEHHHHHHHHTCCHHHHHHHHHHHHHHTSBCCCCSSSEEEBCSCCSCC
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCCCCCEECCCCCCC
T ss_conf             986422899999999998086448999999712522999999999988768877799799672899887



>d2ve8a1 a.4.5.67 (A:745-811) DNA translocase FtsK {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 806 DNA translocase FtsK [Candidatus Liberibacter asia
2ius_A_136-512377 (A:136-512) DNA translocase FTSK; nucleotide-bindi 6e-61
2iut_A_183-574392 (A:183-574) DNA translocase FTSK; nucleotide-bindi 9e-55
2iut_A_1-182182 (A:1-182) DNA translocase FTSK; nucleotide-binding 6e-35
2ius_A_1-135135 (A:1-135) DNA translocase FTSK; nucleotide-binding 3e-34
2ve8_A_73 (A:) FTSK, DNA translocase FTSK; nucleotide-bindin 4e-23
1e9r_A_24-137_224-347_402-437274 (A:24-137,A:224-347,A:402-437) Conjugal transfer p 4e-23
3fho_A_1-326326 (A:1-326) ATP-dependent RNA helicase DBP5; mRNA ex 0.001
>2ius_A (A:136-512) DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A*Length = 377 Back     alignment and structure
 Score =  230 bits (586), Expect = 6e-61
 Identities = 190/382 (49%), Positives = 238/382 (62%), Gaps = 8/382 (2%)

Query: 424 SRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMT 483
           +  F  N   L + LGK I G+P++ADLA+MPHLL+AGTTGSG SV +N MILS+LY+  
Sbjct: 2   NAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGASVGVNAMILSMLYKAQ 61

Query: 484 PAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVR 543
           P   R IMIDPKMLELSVY+GIP+LLT VVT+ + A   L+W V EME RY+ MS +GVR
Sbjct: 62  PEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVR 121

Query: 544 NIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLM 603
           N+ G+N K+A+     +          D    +          +  PYIVV++DE ADLM
Sbjct: 122 NLAGYNEKIAEADRMMRPIPDPYWKPGDSMDAQHPV------LKKEPYIVVLVDEFADLM 175

Query: 604 MVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSR 663
           M   K +E  + RLAQ ARA+GIH+++ATQRPSVDVITG IKAN PTRI+F VSSKIDSR
Sbjct: 176 MTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSR 235

Query: 664 TILGEQGAEQLLGQGDMLYM-TGGGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYID-IK 721
           TIL + GAE LLG GDMLY         R+HG FV D EV  VV   K +G  +Y+D I 
Sbjct: 236 TILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARGRPQYVDGIT 295

Query: 722 DKILLNEEMRFSENSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEE 781
                       + +   D L+ QAV  V    KASIS +QR+  IGYNRAA IIE ME 
Sbjct: 296 SDSESEGGAGGFDGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEA 355

Query: 782 KGVIGPASSTGKREILISSMEE 803
           +G++      G RE+L     +
Sbjct: 356 QGIVSEQGHNGNREVLAPPPFD 377


>2iut_A (A:183-574) DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA ATG; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A*Length = 392 Back     alignment and structure
>2iut_A (A:1-182) DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA ATG; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A*Length = 182 Back     alignment and structure
>2ius_A (A:1-135) DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A*Length = 135 Back     alignment and structure
>2ve8_A (A:) FTSK, DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA-binding, winged helix, bacterial cell division; HET: DNA; 1.4A {Pseudomonas aeruginosa}Length = 73 Back     alignment and structure
>1e9r_A (A:24-137,A:224-347,A:402-437) Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli}Length = 274 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target806 DNA translocase FtsK [Candidatus Liberibacter asiaticus
2ius_A_136-512377 DNA translocase FTSK; nucleotide-binding, chromoso 100.0
2iut_A_183-574392 DNA translocase FTSK; nucleotide-binding, chromoso 100.0
2iut_A_1-182182 DNA translocase FTSK; nucleotide-binding, chromoso 100.0
2ius_A_1-135135 DNA translocase FTSK; nucleotide-binding, chromoso 100.0
2ve8_A_73 FTSK, DNA translocase FTSK; nucleotide-binding, ch 99.91
1e9r_A_24-137_224-347_402-437274 Conjugal transfer protein TRWB; coupling protein, 99.76
2qby_A_1-196196 CDC6 homolog 1, cell division control protein 6 ho 96.83
2v1u_A_1-200200 Cell division control protein 6 homolog; DNA repli 96.34
1cr0_A_24-296273 DNA primase/helicase; RECA-type protein fold, tran 96.15
2is6_A_1-106_189-283201 DNA helicase II; hydrolase/DNA complex; HET: DNA A 96.12
1ls1_A_93-277185 Signal recognition particle protein; FFH, SRP54, S 93.82
2qnr_A_301 Septin-2, protein NEDD5; structural genomics conso 92.83
2og2_A_150-349200 Putative signal recognition particle receptor; nuc 91.47
1uaa_A_1-102_185-277195 REP helicase, protein (ATP-dependent DNA helicase 95.87
2d7d_A_1-145_250-415311 Uvrabc system protein B; helicase, protein-DNA-ADP 94.76
1pjr_A_1-107_194-286200 PCRA; DNA repair, DNA replication, SOS response, h 92.88
2r6a_A_191-454264 DNAB helicase, replicative helicase; replication, 95.65
2q6t_A_179-444266 DNAB replication FORK helicase; hydrolase; 2.90A { 95.36
3bgw_A_184-444261 DNAB-like replicative helicase; ATPase, replicatio 95.19
1fnn_A_1-192192 CDC6P, cell division control protein 6; ORC1, AAA 94.51
1q57_A_231-503273 DNA primase/helicase; dntpase, DNA replication, tr 93.08
1tf7_A_1-254254 KAIC; homohexamer, hexamer, circadian clock protei 92.03
2w0m_A_235 SSO2452; RECA, SSPF, unknown function; 2.0A {Sulfo 90.47
3bh0_A_50-315266 DNAB-like replicative helicase; ATPase, replicatio 94.97