254780800

254780800

hypothetical protein CLIBASIA_03455

GeneID in NCBI database:8209806Locus tag:CLIBASIA_03455
Protein GI in NCBI database:254780800Protein Accession:YP_003065213.1
Gene range:-(456637, 457215)Protein Length:192aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein; K09987 hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MCQRPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYKLKISKPKSYILESTKKKKRYTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIEKCSKNTEAKYNKAVDDISTPFSS
cccccccccccEEEEEEcccccHHHHHHHHcccHHHHHHHccHHHHcccccccccccccccHHHHHHHHccccccEEEccccccccccccccccccccHHHcccHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHcccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccc
ccccccccHcEEEEEEccccccHHHHHHHccccHHHHHHccccHHccccccccccccccccHHHHHHHHcccccEEEEEccccccccccccccccccHHHcccccHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHccccccccccccccHEHccccHHHHHHHHHHHHcccccccccccccccccccc
mcqrplmpkasavwlidntslsFDQIAEFCGLHLLEVMAIadgeslqgikgfnlissgqLSAEEIALgekdknyklkiskpksyilestkkkkrytpvskrqdrpNAILWLIRNyprlkdaqishlvgttgstiEQIRNrthwntanlvpmdpvtlgLCAQIDLDREIEKCSKNTEAKYnkavddistpfss
mcqrplmpkaSAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALgekdknyklkiskpksyilestkkkkrytpvskrqdrpnaILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHwntanlvpmdpVTLGLCAQIDLDREIEKCSknteakynkavddistpfss
MCQRPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYKLKISKPKSYILESTKKKKRYTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIEKCSKNTEAKYNKAVDDISTPFSS
********KASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIA***KDKN************************VSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDR**************************
********KASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYKLKISKPKSYILESTK***********QDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIEKCSKNTEAKYNKAVDDISTPFSS
***RPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYKLKISKPKSYIL******KRYTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIEKCSK*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCQRPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYKLKISKPKSYILESTKKKKRYTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIEKCSKNTEAKYNKAVDDISTPFSS
MCQRPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYKLKISKPKSYILESTKKKKRYTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIEKCSKNTEAKYNKAVDDISTPFSS
MCQRPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYKLKISKPKSYILESTKKKKRYTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIEKCSKNTEAKYNKAVDDISTPFSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target192 hypothetical protein CLIBASIA_03455 [Candidatus Liberib
315122022192 putative cytoplasmic protein [Candidatus Liberibacter s 1 2e-84
86359691233 hypothetical protein RHE_CH04113 [Rhizobium etli CFN 42 1 1e-70
218510860228 hypothetical protein RetlB5_27672 [Rhizobium etli Brasi 1 1e-70
150398387232 hypothetical protein Smed_3195 [Sinorhizobium medicae W 1 2e-70
209551492235 hypothetical protein Rleg2_3921 [Rhizobium leguminosaru 1 2e-70
241206929234 hypothetical protein Rleg_4246 [Rhizobium leguminosarum 1 2e-70
218463229235 hypothetical protein RetlK5_29032 [Rhizobium etli Kim 5 1 2e-70
227823844233 hypothetical protein NGR_c33340 [Sinorhizobium fredii N 1 3e-70
222150237231 hypothetical protein Avi_4378 [Agrobacterium vitis S4] 1 3e-70
116254452263 hypothetical protein RL4728 [Rhizobium leguminosarum bv 1 3e-70
>gi|315122022|ref|YP_004062511.1| putative cytoplasmic protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 192 Back     alignment and organism information
 Score =  315 bits (807), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 174/192 (90%)

Query: 1   MCQRPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQL 60
           M Q+PLMPKASAVWLIDNTSLSF QIAEFCGLHLLEV+AIADGE+LQGIKGFNL+S+GQL
Sbjct: 1   MNQKPLMPKASAVWLIDNTSLSFKQIAEFCGLHLLEVVAIADGEALQGIKGFNLVSAGQL 60

Query: 61  SAEEIALGEKDKNYKLKISKPKSYILESTKKKKRYTPVSKRQDRPNAILWLIRNYPRLKD 120
           S+EEI+ GEKD NYKL++S+ K Y+ E+TK+KKRYTPVSKRQDRPNAILWLI N+PRLKD
Sbjct: 61  SSEEISKGEKDDNYKLQMSEQKVYLPETTKRKKRYTPVSKRQDRPNAILWLINNHPRLKD 120

Query: 121 AQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIEKCSKNTEAKYN 180
            QISHLVGTT +TIEQIRNRTHWN+++L PMDPVTLGLC+QIDLD EI+K +K+T+ K N
Sbjct: 121 GQISHLVGTTSATIEQIRNRTHWNSSSLSPMDPVTLGLCSQIDLDAEIKKSAKSTDEKNN 180

Query: 181 KAVDDISTPFSS 192
           K ++++ +P SS
Sbjct: 181 KTINEMFSPSSS 192


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359691|ref|YP_471583.1| hypothetical protein RHE_CH04113 [Rhizobium etli CFN 42] Length = 233 Back     alignment and organism information
>gi|218510860|ref|ZP_03508738.1| hypothetical protein RetlB5_27672 [Rhizobium etli Brasil 5] Length = 228 Back     alignment and organism information
>gi|150398387|ref|YP_001328854.1| hypothetical protein Smed_3195 [Sinorhizobium medicae WSM419] Length = 232 Back     alignment and organism information
>gi|209551492|ref|YP_002283409.1| hypothetical protein Rleg2_3921 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 235 Back     alignment and organism information
>gi|241206929|ref|YP_002978025.1| hypothetical protein Rleg_4246 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 234 Back     alignment and organism information
>gi|218463229|ref|ZP_03503320.1| hypothetical protein RetlK5_29032 [Rhizobium etli Kim 5] Length = 235 Back     alignment and organism information
>gi|227823844|ref|YP_002827817.1| hypothetical protein NGR_c33340 [Sinorhizobium fredii NGR234] Length = 233 Back     alignment and organism information
>gi|222150237|ref|YP_002551194.1| hypothetical protein Avi_4378 [Agrobacterium vitis S4] Length = 231 Back     alignment and organism information
>gi|116254452|ref|YP_770290.1| hypothetical protein RL4728 [Rhizobium leguminosarum bv. viciae 3841] Length = 263 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target192 hypothetical protein CLIBASIA_03455 [Candidatus Liberib
pfam06242141 pfam06242, DUF1013, Protein of unknown function (DUF101 4e-62
COG3820230 COG3820, COG3820, Uncharacterized protein conserved in 6e-71
>gnl|CDD|148070 pfam06242, DUF1013, Protein of unknown function (DUF1013) Back     alignment and domain information
>gnl|CDD|33613 COG3820, COG3820, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 192 hypothetical protein CLIBASIA_03455 [Candidatus Liberib
COG3820230 Uncharacterized protein conserved in bacteria [Function 100.0
pfam06242141 DUF1013 Protein of unknown function (DUF1013). Family o 100.0
>COG3820 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam06242 DUF1013 Protein of unknown function (DUF1013) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00