254780802

254780802

leucyl-tRNA synthetase

GeneID in NCBI database:8209808Locus tag:CLIBASIA_03465
Protein GI in NCBI database:254780802Protein Accession:YP_003065215.1
Gene range:-(453171, 455780)Protein Length:869aa
Gene description:leucyl-tRNA synthetase
COG prediction:[J] Leucyl-tRNA synthetase
KEGG prediction:leuS; leucyl-tRNA synthetase (EC:6.1.1.4); K01869 leucyl-tRNA synthetase [EC:6.1.1.4]
SEED prediction:Leucyl-tRNA synthetase (EC 6.1.1.4)
Pathway involved in KEGG:Valine, leucine and isoleucine biosynthesis [PATH:las00290]
Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Leu
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------87
METRSYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV
cccccccHHHHHHHHHHHHHHccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccEEEccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccEEEccEEEEEcccccccccHHHHHccccccccccccEEcccEEEEEcHHHHHHHHHHHHccccccHHHHHHHHHccccccccEEEEEcccccccccccEEEEEEccccccccEEEEEEcccHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHccccccccEEEEccccccccccEEEcccccccccccEEEEcccccccHHHHHHHccccccccccccccccccHHHHHccccccEEEcHHHHcccHHHHHHHHHHHHHHHccccccccccHHHHHHccccccHHHHHccccccEEEccccccccccccHHHHHHHHHccccccccHHHHcHHHccccccccccccEEEccEEEEEEcccccHHHcccccccccccHHHHHHHccccEEEcccccEEEEEEEHHHHHHHHHHHccccccccHHHHHHcccEEcccccccccccccEEcHHHHHHcccccccccccEEccccccccccHHHHHHHcccccHHHHHHHccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccccccccHHHHcccccHHHHHccccccccccccccccHHHHHHHHHccHHHHHHHcccccEEEEEEcccEEEEEc
ccHHHccHHHHHHHHHHHHHHccEEEEccccccccEEEEcccccccccEcccccccccHHHHHHHHHHHcccccccccccHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccEEEEccEEEccccccccccEcHcHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccEEEEEEcccccccccccEEEEEccccccHcHEEEEEccccHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEcccccccEEEEEEEHEEHHHcccccEEEcccccHHHHHHHHHcccccEEEEEcccccccccHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccccccccccccEEEccccccccccHHcccEEccccccccccccccHccccHccccccccccccccccccccHHHcccEEEEEcccccccccccHHHHHccccHcHEccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccEEEEcHEEEccccccEEEcccHEEEEcccccEEEEEcccccEEEccccccccccccccccHHHHHHHccHHHHHHHHHccccccccEEEccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccHHHHHcccEEEEEEEccEEEEEEEEcccccHHHHHHHHHHcHHHHHHHccccEEEEEEEcccEEEEEc
metrsyspqetdsiwqsawydsnifkaengknkkKYFVLEmfpypsgnihmghlrNYVIGDVVARFMRasgysvlhpmgwdafgmpaenaarehnvhpkmwtYQNIKVMRKQLQSIGlsidwskdfatcdvdyyhcQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEqvingrgwrsdapveqrslpqwfFKISDLSQELLDSIETLSEWPEKVKIMQKnwigrsegMEIRWEIVSNTIDQIEEILvyttrpetifgASFIAIAVDHSiseklscdntdikefcdeekqkgtslsvldktekkgiytgihvkhplnpnvviPVYIANFVFmnygtgaifgcpfadqrdmdfakkyglpiipimkrsinhsqdieegkafsgdgiminssfldgmtNTEALQAVMSHLEkqniknspigkrkinfRLRDWCISrqrswgcpipvihcqkcgivelpkedlpvqlpedldftlpgnplenhptwkkiFCVKCgsealretdtmdtfvdsSWYYMRymtphakdpinkelvrqwfpvdqyiggIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGikkkylkpdeVILRNiegencafrlsdnskvvigplekmskskknvidpmkviksygadtarlfvlsdsppdrdiiwsnkgvdsTYQFIQQIWRLIYNAkdelqtsstkkdiSLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAglvaqqkwpkldpilevntdiilpiqvngkkRACITVSMNTDDDFIKKTVLELNVIKNilqgkspkkiIIISKRIVNIVV
metrsyspqetdsiwqsawYDSNIFkaengknkkKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETlsewpekvkimqknwigrsegMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEfcdeekqkgtslsvldkteKKGIYTgihvkhplnpnVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHlekqniknspigkrkinFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNplenhptwkKIFCVKCGsealretdtmdTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIegencafrlsdnskvvigplekmskskknvidPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKdelqtsstkkdisliSKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEiakkksnadriSTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDiilpiqvngkkRACITVSMNTDDDFIKKTVLELNVIknilqgkspkkiiiiskrivnivv
METRSYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPkkiiiiskrivnivv
****SYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTS*SVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAK************SLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLME********DRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV
***********DSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV
METRSYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METRSYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV
METRSYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV
METRSYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target869 leucyl-tRNA synthetase [Candidatus Liberibacter asiatic
254780933947 valyl-tRNA synthetase [Candidatus Liberibacter asi 1e-25
255764461511 methionyl-tRNA synthetase [Candidatus Liberibacter 8e-13
255764461511 methionyl-tRNA synthetase [Candidatus Liberibacter 4e-10
254780445963 isoleucyl-tRNA synthetase [Candidatus Liberibacter 1e-11
254780445963 isoleucyl-tRNA synthetase [Candidatus Liberibacter 2e-08
254780285586 arginyl-tRNA synthetase [Candidatus Liberibacter a 8e-04
>gi|254780933|ref|YP_003065346.1| valyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 947 Back     alignment
 Score =  110 bits (275), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 191/866 (22%), Positives = 317/866 (36%), Gaps = 234/866 (27%)

Query: 43  PYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPA--------------- 87
           P  +G++HMGH  N  I D++ RF R  G +VL   G D  G+                 
Sbjct: 46  PNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLT 105

Query: 88  -ENAAREHNVHPKMWTY--QNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDF 144
            E+  R+  +  K+W +  ++   +  QL+ +G S DWS++  T D    +  +  F+  
Sbjct: 106 REDIGRDAFIE-KVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVL 164

Query: 145 MKHNVIVRKTAQVNWDPVEQTVLANEQVI----NGRGWRSDAPVEQRSLPQWFFKISDLS 200
            K  +I R    VNWDP  +T +++ +VI    +G  W    P+ +    +   K  D  
Sbjct: 165 YKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDD-- 222

Query: 201 QELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFG 260
                                       +   I WE+        + I+V TTRPET+FG
Sbjct: 223 ----------------------------DAKPIDWEVR-------DYIIVSTTRPETMFG 247

Query: 261 ASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNP 320
              +AIAV          D+   KE       K  +L ++ +                  
Sbjct: 248 D--VAIAV--------HPDDYRYKELI----GKYATLPIVGR------------------ 275

Query: 321 NVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIM----KRSINHSQDI 376
             +IP+    +    +G GA+   P  D  D + AK++GL  I I+    K  ++ ++  
Sbjct: 276 --LIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESF 333

Query: 377 EEGKAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKI----------- 425
            E    S +   I S F +G+    A   ++S LEK N+ +     R I           
Sbjct: 334 LENIVLSDEARNIFSEF-EGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTI 392

Query: 426 ----------------------------NFRLRDW--------------CISRQRSWGCP 443
                                       +F  + W              CISRQ  WG  
Sbjct: 393 EPCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQ 452

Query: 444 IPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCG--SEAL-RE 500
           IPV +     +     ED    L   +D+ L     +N  T K    +K G  S+ L R+
Sbjct: 453 IPVWYSPDGKLFVENTED--AALRSAIDYYLSQ---DNDMTVKVRKMIKDGNISDLLKRD 507

Query: 501 TDTMDTFVDSS-WYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAH 559
            D +DT+  S+ W +     P     +     + ++P    + G +  +L    AR    
Sbjct: 508 EDVLDTWFSSALWPFASLGWPEQTAEL-----KTYYPTSVLVTGFD--ILFFWVARMMMM 560

Query: 560 ILKKIGYIEID--EPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRL 617
            L  +   E    EPF  ++   +V                       R+  G       
Sbjct: 561 GLYFMKDAEGKGIEPFHIVYMHALV-----------------------RDKNG------- 590

Query: 618 SDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDST 677
                      +KMSKSK NV+DP+ VI  YGAD  R +    +   RDI    + +   
Sbjct: 591 -----------QKMSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGY 639

Query: 678 YQFIQQIWRLIYNAK---DELQTSSTKKDIS------LISKSTKFLERIEENYQNLSFNK 728
             FI + W  I  +K        S   +D+       +I +    +  +    +N  FN 
Sbjct: 640 RNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFND 699

Query: 729 AVANIH-----ELVNVISKPLMEIAKKKSN---ADRISTIRYILEKLIIMMSPMIPHLAE 780
             A ++     EL +   + +  I  +K +   ++ +S   Y+L  +  ++ P+IP + E
Sbjct: 700 VSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTE 759

Query: 781 ECWQL------LGNAGLVAQQKWPKL 800
           + +        +   GL+   +WP L
Sbjct: 760 DLYSHVSPQDDMDKQGLLCHAQWPSL 785

>gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Back     alignment
 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 88/178 (49%), Gaps = 21/178 (11%)

Query: 629 EKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDS--TYQFIQQIWR 686
           EK+SKS  NVIDP++VI+  G D  R F++ +    +D  +   G+           I  
Sbjct: 301 EKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDKDGLKKRVNADLANGIGN 360

Query: 687 LI----------YNAKDELQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHEL 736
           L+          Y+       + T+ D S++S  ++ L+ I EN QN   ++A+A +  L
Sbjct: 361 LVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQEIRENMQNQLIHRALAQVISL 420

Query: 737 VNVISKPLMEIAK----KKSNADRISTIRY----ILEKLIIMMSPMIPHLAEECWQLL 786
           V+ + +   +  K    KK+N DR ST+ Y    ++ +L I++   +P LA + + +L
Sbjct: 421 VSEVDR-YFDAQKPWELKKTNPDRASTVLYVTVEVIRQLAILLQAFVPKLANKIFDIL 477

>gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Back     alignment
 Score = 58.9 bits (141), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 77/188 (40%), Gaps = 8/188 (4%)

Query: 31  KNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENA 90
           K ++K ++     YP+   H+GH    +I DV+ARF R  G  VL   G D  G     A
Sbjct: 2   KEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKA 61

Query: 91  AREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVI 150
           A+   V  K++  QN +  R     + +S D   DF       +H    +    +     
Sbjct: 62  AQNAGVTTKVFVDQNSRNFRDMADVLDISYD---DFIRTTEKRHHDTCRILWKKISDKGD 118

Query: 151 VRKTAQVNWDPVEQTVLANEQVI----NGRGWRSDA-PVEQRSLPQWFFKISDLSQELLD 205
           + K     W  +      N+  +    +G+ + +   PV+      +FF++S    +LL 
Sbjct: 119 IYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEEGYFFRLSAYQDKLLS 178

Query: 206 SIETLSEW 213
             E+  E+
Sbjct: 179 YYESHPEF 186

>gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Back     alignment
 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 157/423 (37%), Gaps = 98/423 (23%)

Query: 384 GDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCP 443
           GDG  + S  L  +       +   +  +  I+N P           DW +SRQR+WG P
Sbjct: 457 GDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRP-----------DWLLSRQRNWGVP 505

Query: 444 IPVIHCQKCGIVELPK--EDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEA-LRE 500
           I   + +K G + L K   D  ++  +D      G+        +  F     SE  ++ 
Sbjct: 506 ICFFYNEK-GEILLDKAINDRIIKTFKD-----QGSDAWFSEGSRDFFLGDRASEPWIQS 559

Query: 501 TDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHI 560
            D +D + DS+  +   +    KDP      +  +P D Y+ G +       +  +F H 
Sbjct: 560 KDILDVWFDSACTHTILL---GKDP------KLAWPADVYLEGSDQ------HRGWFQHS 604

Query: 561 LKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDN 620
           L +        PF  L T G  V E                                   
Sbjct: 605 LLESCATRGSTPFTSLITHGFSVDENG--------------------------------- 631

Query: 621 SKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPD-----RDIIWSNKGVD 675
                   EKMSKSK NV+ P ++I   GAD  R + ++    D     ++II +N  +D
Sbjct: 632 --------EKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTN--ID 681

Query: 676 STYQFIQQI-WRLIYNAKDELQTSSTKKDISL----ISKSTKFLERIEENYQNLSFNKAV 730
           +  +    I W L   A D     S     +L    + + T+  + + E Y   +F + V
Sbjct: 682 TYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVV 741

Query: 731 ANIHELVNV-ISKPLMEIAKKKSNAD---------RISTIRYILEKLIIMMSPMIPHLAE 780
             +    N  +S    +I K     D          I+ IR +   LII ++P++P  AE
Sbjct: 742 RQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAE 801

Query: 781 ECW 783
           E W
Sbjct: 802 EAW 804

>gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Back     alignment
 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 66/168 (39%), Gaps = 30/168 (17%)

Query: 28  ENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPA 87
           E+   +K + + +  PY +G+IH+GH  N ++ DV+ R  +   ++     GWD  G+P 
Sbjct: 48  ESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPI 107

Query: 88  E-----------------------NAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSK 124
           E                        A R+       W    +K+  K+ Q +G+  D+  
Sbjct: 108 EWKVENEYLAKGKKKDDIPVNEFRQACRD---SASAW----VKIQSKEFQRLGIVGDFEN 160

Query: 125 DFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQV 172
            + T   +         L   + + I R    + W   EQT LA  ++
Sbjct: 161 PYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEI 208

>gi|254780285|ref|YP_003064698.1| arginyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 586 Back     alignment
 Score = 37.7 bits (86), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 45  PSGNIHMGHLRNYVIGDVVARFMRASGYSV 74
           P+G +H+GH R  V+GD +A  M  SGY V
Sbjct: 132 PTGPMHVGHCRCAVVGDTLASLMAFSGYEV 161

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target869 leucyl-tRNA synthetase [Candidatus Liberibacter asiatic
315122024824 leucyl-tRNA synthetase [Candidatus Liberibacter solanac 1 0.0
86359694876 leucyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 1 0.0
222087922876 leucyl-tRNA synthetase protein [Agrobacterium radiobact 1 0.0
116254456876 leucyl-tRNA synthetase [Rhizobium leguminosarum bv. vic 1 0.0
241206933876 leucyl-tRNA synthetase [Rhizobium leguminosarum bv. tri 1 0.0
190893972876 leucyl-tRNA synthetase [Rhizobium etli CIAT 652] Length 1 0.0
325294118876 Leucyl-tRNA synthetase [Agrobacterium sp. H13-3] Length 1 0.0
222150239876 leucyl-tRNA synthetase [Agrobacterium vitis S4] Length 1 0.0
227823849876 leucyl-tRNA synthetase [Sinorhizobium fredii NGR234] Le 1 0.0
15889997876 leucyl-tRNA synthetase [Agrobacterium tumefaciens str. 1 0.0
>gi|315122024|ref|YP_004062513.1| leucyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 824 Back     alignment and organism information
 Score = 1321 bits (3418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/824 (75%), Positives = 719/824 (87%), Gaps = 5/824 (0%)

Query: 51  MGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMR 110
           MGHLRNYVIGDV+ARFM A GYSVLHPMGWDAFGMPAENAARE+ +HPK WTY NIKVMR
Sbjct: 1   MGHLRNYVIGDVIARFMMAQGYSVLHPMGWDAFGMPAENAARENGIHPKKWTYDNIKVMR 60

Query: 111 KQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANE 170
           +QL+SIGLSIDWSK+FATCD DYYHCQQLLFLDFMK+N++VRKT+QVNWDPV+QTVLANE
Sbjct: 61  EQLKSIGLSIDWSKEFATCDDDYYHCQQLLFLDFMKNNLVVRKTSQVNWDPVDQTVLANE 120

Query: 171 QVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEG 230
           QVINGRGWRSDA VEQR+LPQWFFKISD SQELLDSIETLSEWPEKVKIMQKNWIGRSEG
Sbjct: 121 QVINGRGWRSDALVEQRNLPQWFFKISDFSQELLDSIETLSEWPEKVKIMQKNWIGRSEG 180

Query: 231 MEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEE 290
           +EIRWEIV NTID  +EI+VYTTRPETIFGASFIAIA+DH I + LS +  DIK FC +E
Sbjct: 181 VEIRWEIVPNTIDHTKEIVVYTTRPETIFGASFIAIAIDHPIVQNLSSNREDIKNFCIKE 240

Query: 291 KQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQR 350
            Q+GTSLS L KT K+GI TGI VKHPL  ++ IPVYIANFVFMNYGTGAIFGCPFADQR
Sbjct: 241 SQRGTSLSELSKTTKEGIDTGIRVKHPLILDLEIPVYIANFVFMNYGTGAIFGCPFADQR 300

Query: 351 DMDFAKKYGLPIIPIMKR-SINHSQDIEEGKAFSGDGIMINSSFLDGMTNTEALQAVMSH 409
           DMDFA KY LP++PIMK+ + N    ++E KA+   GIMINSSFL+GMT+ EA +A++ +
Sbjct: 301 DMDFASKYNLPVLPIMKQNNANSKATLKEEKAYLDSGIMINSSFLNGMTSAEAFEAIILY 360

Query: 410 LEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPED 469
           LEK+ +  SP+ KRKI+FRLRDW ISRQR WGCPIP+IHC+KCGIVE+PKEDLP++LPED
Sbjct: 361 LEKKMLLGSPVAKRKIHFRLRDWGISRQRYWGCPIPIIHCKKCGIVEVPKEDLPIKLPED 420

Query: 470 LDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKE 529
           ++F LPGNPL+NHPTWKK+FC +CGSEALRETDTMDTFVDSSWYYMRYM PHAK P NKE
Sbjct: 421 VNFNLPGNPLDNHPTWKKVFCTQCGSEALRETDTMDTFVDSSWYYMRYMDPHAKVPTNKE 480

Query: 530 LVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQ 589
           L+  W PVDQYIGGIEHA+LHLLYARFF+H +KKIG+ +I EPFKRLFTQGMV HETYYQ
Sbjct: 481 LIDYWLPVDQYIGGIEHAILHLLYARFFSHAMKKIGHTKIQEPFKRLFTQGMVTHETYYQ 540

Query: 590 LEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYG 649
           L+G+KK+YLKP+E+ L+ I+G+ CAFR+SDNSKV+IG LEKMSKSKKNVIDP K+I+SYG
Sbjct: 541 LDGVKKRYLKPEEIALKTIDGKVCAFRISDNSKVIIGFLEKMSKSKKNVIDPYKIIQSYG 600

Query: 650 ADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQ----TSSTKKDIS 705
           ADTARLFVLSDSPPDRDI+WSN GVDST++FIQQIWRLI NAK EL      SS +++I 
Sbjct: 601 ADTARLFVLSDSPPDRDIVWSNTGVDSTHRFIQQIWRLIDNAKTELHKISIKSSKQENIF 660

Query: 706 LISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILE 765
           LI +STK  +R EENY+ LSFNK VANIHELVN+I+ PL++IA+  S+ D   TIR ILE
Sbjct: 661 LIDQSTKIFKRAEENYKRLSFNKVVANIHELVNIINTPLIQIAQGNSSEDLKFTIRDILE 720

Query: 766 KLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACIT 825
           KLII++SPMIPH AEECWQLLGN GLV Q+KWPK + +L V+ +II+PIQVNGKKRA IT
Sbjct: 721 KLIIVISPMIPHFAEECWQLLGNTGLVVQKKWPKFNDLLTVDENIIIPIQVNGKKRAYIT 780

Query: 826 VSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV 869
           V  ++DDDFIK+T L LN IKN LQGK+PKKIII+SKRIVNIVV
Sbjct: 781 VPTDSDDDFIKQTALSLNTIKNTLQGKTPKKIIIVSKRIVNIVV 824


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359694|ref|YP_471586.1| leucyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 876 Back     alignment and organism information
>gi|222087922|ref|YP_002546460.1| leucyl-tRNA synthetase protein [Agrobacterium radiobacter K84] Length = 876 Back     alignment and organism information
>gi|116254456|ref|YP_770294.1| leucyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 876 Back     alignment and organism information
>gi|241206933|ref|YP_002978029.1| leucyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 876 Back     alignment and organism information
>gi|190893972|ref|YP_001980514.1| leucyl-tRNA synthetase [Rhizobium etli CIAT 652] Length = 876 Back     alignment and organism information
>gi|325294118|ref|YP_004279982.1| Leucyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 876 Back     alignment and organism information
>gi|222150239|ref|YP_002551196.1| leucyl-tRNA synthetase [Agrobacterium vitis S4] Length = 876 Back     alignment and organism information
>gi|227823849|ref|YP_002827822.1| leucyl-tRNA synthetase [Sinorhizobium fredii NGR234] Length = 876 Back     alignment and organism information
>gi|15889997|ref|NP_355678.1| leucyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 876 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target869 leucyl-tRNA synthetase [Candidatus Liberibacter asiatic
KOG0435876 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Tran 0.0
PRK00390805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 0.0
TIGR00396842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacteri 0.0
PLN02563963 PLN02563, PLN02563, aminoacyl-tRNA ligase 0.0
COG0495814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, rib 0.0
COG0525877 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribo 2e-80
TIGR00422861 TIGR00422, valS, valyl-tRNA synthetase 2e-73
COG0060933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, 3e-60
TIGR00392861 TIGR00392, ileS, isoleucyl-tRNA synthetase 4e-49
KOG0433937 KOG0433, KOG0433, KOG0433, Isoleucyl-tRNA synthetase [T 6e-45
KOG0432 995 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Trans 3e-33
PLN02943 958 PLN02943, PLN02943, aminoacyl-tRNA ligase 8e-21
cd00812314 cd00812, LeuRS_core, catalytic core domain of leucyl-tR 9e-65
cd00817382 cd00817, ValRS_core, catalytic core domain of valyl-tRN 1e-33
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain 7e-24
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translation, 8e-22
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) 8e-19
cd00814319 cd00814, MetRS_core, catalytic core domain of methionin 6e-18
cd00818338 cd00818, IleRS_core, catalytic core domain of isoleucyl 1e-17
PRK00133673 PRK00133, metG, methionyl-tRNA synthetase; Reviewed 1e-14
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 2e-14
PRK12268556 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed 3e-13
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed 2e-12
PRK13208800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 7e-54
pfam00133606 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, 9e-46
cd00812314 cd00812, LeuRS_core, catalytic core domain of leucyl-tR 2e-40
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain 8e-10
PRK12300 897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 3e-29
PRK06039975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed 2e-19
PRK05729874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 5e-24
PRK13208800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 4e-21
TIGR00395938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal 7e-17
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed 8e-17
PRK05743912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed 6e-16
PRK13804961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional 1e-15
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translation, 2e-15
PRK12267648 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed 2e-11
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 4e-11
KOG0437 1080 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Tran 6e-10
COG0215464 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, 3e-07
KOG0436578 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [T 2e-06
PLN02224616 PLN02224, PLN02224, methionine-tRNA ligase 8e-05
PTZ00419 995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; 0.002
PLN02959 1084 PLN02959, PLN02959, aminoacyl-tRNA ligase 0.002
PTZ00419 995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; 4e-23
PRK05729874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 1e-17
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 8e-15
cd07958117 cd07958, Anticodon_Ia_Leu_BEm, Anticodon-binding domain 5e-23
cd07962135 cd07962, Anticodon_Ia_Val, Anticodon-binding domain of 9e-07
cd07959117 cd07959, Anticodon_Ia_Leu_AEc, Anticodon-binding domain 2e-05
cd07961183 cd07961, Anticodon_Ia_Ile_ABEc, Anticodon-binding domai 2e-04
cd07957129 cd07957, Anticodon_Ia_Met, Anticodon-binding domain of 8e-04
TIGR00395938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal 2e-21
PTZ00427 1205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; P 1e-09
cd00802143 cd00802, class_I_aaRS_core, catalytic core domain of cl 5e-05
COG0215464 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, 3e-04
KOG0436578 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [T 0.003
cd00817382 cd00817, ValRS_core, catalytic core domain of valyl-tRN 6e-21
cd00818338 cd00818, IleRS_core, catalytic core domain of isoleucyl 3e-17
PTZ00427 1205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; P 2e-05
pfam08264148 pfam08264, Anticodon_1, Anticodon-binding domain 8e-20
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 8e-16
PLN02843974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 3e-12
KOG0434 1070 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [T 2e-07
PRK12300897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 2e-15
PRK06039975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed 2e-15
PRK13804961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional 5e-15
PLN02843974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 1e-10
PRK05743912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed 8e-10
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 6e-14
PRK12268556 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed 8e-14
PRK06039975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed 1e-10
PRK05743912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed 2e-10
cd07960180 cd07960, Anticodon_Ia_Ile_BEm, Anticodon-binding domain 1e-09
KOG0437 1080 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Tran 2e-07
KOG0434 1070 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [T 6e-07
COG0018577 COG0018, ArgS, Arginyl-tRNA synthetase [Translation, ri 4e-06
PRK12267648 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed 1e-05
PLN02959 1084 PLN02959, PLN02959, aminoacyl-tRNA ligase 3e-05
TIGR00456566 TIGR00456, argS, arginyl-tRNA synthetase 3e-05
PLN02882 1159 PLN02882, PLN02882, aminoacyl-tRNA ligase 1e-04
pfam00750345 pfam00750, tRNA-synt_1d, tRNA synthetases class I (R) 4e-04
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) 9e-07
cd00814319 cd00814, MetRS_core, catalytic core domain of methionin 3e-06
PLN02882 1159 PLN02882, PLN02882, aminoacyl-tRNA ligase 3e-05
PRK00260463 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated 9e-07
PRK01611507 PRK01611, argS, arginyl-tRNA synthetase; Reviewed 9e-06
cd00671212 cd00671, ArgRS_core, catalytic core domain of arginyl-t 1e-05
cd00672213 cd00672, CysRS_core, catalytic core domain of cysteinyl 4e-04
PLN02286576 PLN02286, PLN02286, arginine-tRNA ligase 0.002
TIGR00435465 TIGR00435, cysS, cysteinyl-tRNA synthetase 0.003
PRK13804961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional 8e-05
KOG04341070 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [T 3e-04
PRK06039975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed 0.001
PTZ004271205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; P 0.001
PRK12300 897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 0.002
PRK00260463 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated 0.003
>gnl|CDD|35656 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178996 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|161857 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|30841 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30871 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161872 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161854 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|35654 KOG0433, KOG0433, KOG0433, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35653 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|166584 PLN02943, PLN02943, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|117876 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|178889 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161858 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183364 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183895 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|143905 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|180364 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|180225 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183895 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161856 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|183364 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|180231 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|184337 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183389 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161858 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|35658 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35657 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177869 PLN02224, PLN02224, methionine-tRNA ligase Back     alignment and domain information
>gnl|CDD|185605 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|178544 PLN02959, PLN02959, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|185605 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|180225 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178007 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|153412 cd07958, Anticodon_Ia_Leu_BEm, Anticodon-binding domain of bacterial and eukaryotic mitochondrial leucyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|153416 cd07962, Anticodon_Ia_Val, Anticodon-binding domain of valyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|153413 cd07959, Anticodon_Ia_Leu_AEc, Anticodon-binding domain of archaeal and eukaryotic cytoplasmic leucyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|153415 cd07961, Anticodon_Ia_Ile_ABEc, Anticodon-binding domain of archaeal, bacterial, and eukaryotic cytoplasmic isoleucyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|153411 cd07957, Anticodon_Ia_Met, Anticodon-binding domain of methionyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|161856 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|173901 cd00802, class_I_aaRS_core, catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35657 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|149360 pfam08264, Anticodon_1, Anticodon-binding domain Back     alignment and domain information
>gnl|CDD|184893 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178436 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|180364 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|184337 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178436 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|180231 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|184893 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|180364 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|180231 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|153414 cd07960, Anticodon_Ia_Ile_BEm, Anticodon-binding domain of bacterial and eukaryotic mitochondrial isoleucyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|35658 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30368 COG0018, ArgS, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183389 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178544 PLN02959, PLN02959, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|161886 TIGR00456, argS, arginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178470 PLN02882, PLN02882, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|144375 pfam00750, tRNA-synt_1d, tRNA synthetases class I (R) Back     alignment and domain information
>gnl|CDD|117876 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|178470 PLN02882, PLN02882, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|178951 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|179308 PRK01611, argS, arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|185675 cd00671, ArgRS_core, catalytic core domain of arginyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>gnl|CDD|177924 PLN02286, PLN02286, arginine-tRNA ligase Back     alignment and domain information
>gnl|CDD|161877 TIGR00435, cysS, cysteinyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|184337 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180364 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178951 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 869 leucyl-tRNA synthetase [Candidatus Liberibacter asiatic
TIGR00396916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 100.0
PRK00390822 leuS leucyl-tRNA synthetase; Validated 100.0
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 100.0
KOG0435876 consensus 100.0
TIGR00422970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 100.0
PRK06039 1042 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
TIGR00392938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 100.0
PRK05729877 valS valyl-tRNA synthetase; Reviewed 100.0
PRK05743910 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PRK13208809 valS valyl-tRNA synthetase; Reviewed 100.0
COG0060933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 100.0
PRK13804966 ileS isoleucyl-tRNA synthetase; Provisional 100.0
COG0525877 ValS Valyl-tRNA synthetase [Translation, ribosomal stru 100.0
TIGR00395 1109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 100.0
KOG0432995 consensus 100.0
KOG0433937 consensus 100.0
KOG0434 1070 consensus 100.0
KOG0437 1080 consensus 100.0
PRK12300888 leuS leucyl-tRNA synthetase; Reviewed 100.0
pfam00133606 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). O 100.0
cd00817363 ValRS_core This is the catalytic core domain of valine 100.0
cd00812376 LeuRS_core This is the catalytic core domain of leucyl 100.0
cd00818339 IleRS_core This is the catalytic core domain of isoleuc 100.0
pfam09334388 tRNA-synt_1g tRNA synthetases class I (M). This family 100.0
cd00668334 Ile_Leu_Val_MetRS_core This is the catalytic core domai 100.0
PRK12268558 methionyl-tRNA synthetase; Reviewed 100.0
PRK11893512 methionyl-tRNA synthetase; Reviewed 100.0
PRK12267644 methionyl-tRNA synthetase; Reviewed 100.0
PRK00133666 metG methionyl-tRNA synthetase; Reviewed 100.0
TIGR00398573 metG methionyl-tRNA synthetase; InterPro: IPR002304 The 100.0
COG0143558 MetG Methionyl-tRNA synthetase [Translation, ribosomal 100.0
KOG0436578 consensus 100.0
KOG1247567 consensus 100.0
cd00814319 MetRS_core This is the catalytic core domain of methion 100.0
pfam01406301 tRNA-synt_1e tRNA synthetases class I (C) catalytic dom 100.0
PRK00260460 cysS cysteinyl-tRNA synthetase; Validated 99.96
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal 99.91
PRK12418384 cysteinyl-tRNA synthetase; Provisional 99.88
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deo 99.88
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 98.64
PRK12451562 arginyl-tRNA synthetase; Reviewed 98.61
PRK04156566 gltX glutamyl-tRNA synthetase; Provisional 98.11
cd00807238 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) a 98.01
COG0008472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Transla 97.79
pfam00749314 tRNA-synt_1c tRNA synthetases class I (E and Q), cataly 97.78
cd00418223 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-t 97.75
TIGR00463600 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 97.72
PRK05347556 glutaminyl-tRNA synthetase; Provisional 97.66
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 97.61
PRK12410433 glutamyl-tRNA synthetase; Provisional 97.57
PRK12558461 glutamyl-tRNA synthetase; Provisional 97.48
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 97.15
PRK01406467 gltX glutamyl-tRNA synthetase; Reviewed 96.86
TIGR00440564 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514 Th 96.47
PRK00574489 gltX glutamyl-tRNA synthetase; Reviewed 96.34
KOG1147712 consensus 95.82
KOG1148764 consensus 95.5
cd07961183 Anticodon_Ia_Ile_ABEc Anticodon-binding domain of archa 99.94
cd07960180 Anticodon_Ia_Ile_BEm Anticodon-binding domain of bacter 99.9
cd07958117 Anticodon_Ia_Leu_BEm Anticodon-binding domain of bacter 99.9
cd07962135 Anticodon_Ia_Val Anticodon-binding domain of valyl tRNA 99.89
cd07959117 Anticodon_Ia_Leu_AEc Anticodon-binding domain of archae 99.81
cd07957129 Anticodon_Ia_Met Anticodon-binding domain of methionyl 99.36
pfam08264148 Anticodon_1 Anticodon-binding domain. This domain is fo 99.87
KOG2007586 consensus 99.79
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 99.51
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 99.05
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 98.97
PRK12451562 arginyl-tRNA synthetase; Reviewed 98.87
KOG1195567 consensus 92.82
cd07375117 Anticodon_Ia_like Anticodon-binding domain of class Ia 99.65
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 99.39
cd00672213 CysRS_core This is the catalytic core domain of cystein 98.81
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 98.78
cd00671267 ArgRS_core This is the catalytic core domain of Arginyl 98.39
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 97.56
cd00808239 GluRS_core Descriminating Glutamyl-tRNA synthetase (Glu 96.77
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 96.77
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 96.39
PRK13354405 tyrosyl-tRNA synthetase; Provisional 92.86
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 92.31
TIGR003951109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 99.18
cd00672213 CysRS_core This is the catalytic core domain of cystein 98.73
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 98.47
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 97.92
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 97.74
cd00674354 LysRS_core_class_I This is the catalytic core domain of 97.71
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 97.1
PRK12284436 tryptophanyl-tRNA synthetase; Reviewed 96.68
PRK12556328 tryptophanyl-tRNA synthetase; Provisional 96.35
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 95.88
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 95.61
PRK00927325 tryptophanyl-tRNA synthetase; Reviewed 93.4
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 98.42
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 98.39
KOG04371080 consensus 98.34
cd00674354 LysRS_core_class_I This is the catalytic core domain of 98.31
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 98.29
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 98.04
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 98.15
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 97.06
TIGR00392 938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 96.34
cd07956156 Anticodon_Ia_Arg Anticodon-binding domain of arginyl tR 96.08
KOG4426656 consensus 95.96
COG0060933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 95.38
PRK06039 1042 ileS isoleucyl-tRNA synthetase; Reviewed 94.48
PRK13208809 valS valyl-tRNA synthetase; Reviewed 92.61
PRK13804966 ileS isoleucyl-tRNA synthetase; Provisional 91.03
PRK05729877 valS valyl-tRNA synthetase; Reviewed 90.56
PRK08560333 tyrosyl-tRNA synthetase; Validated 93.79
PRK13354405 tyrosyl-tRNA synthetase; Provisional 93.43
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 92.48
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 91.0
PRK05912402 tyrosyl-tRNA synthetase; Validated 90.57
PRK12300888 leuS leucyl-tRNA synthetase; Reviewed 92.75
KOG04341070 consensus 91.32
>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0435 consensus Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0432 consensus Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>KOG0434 consensus Back     alignment and domain information
>KOG0437 consensus Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) Back     alignment and domain information
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS) Back     alignment and domain information
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) Back     alignment and domain information
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M) Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information