254780803

254780803

hypothetical protein CLIBASIA_03470

GeneID in NCBI database:8209809Locus tag:CLIBASIA_03470
Protein GI in NCBI database:254780803Protein Accession:YP_003065216.1
Gene range:-(452684, 453181)Protein Length:165aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRTIE
cHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHcccccccccHHHHHHHHHHHHHcccccccccEEEEEEEEEHHHHccccccccccEEEEEEEEEEEEEEccccEEEEEcccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHccccccEEEEccccccEEEccEEEEEEEcccccHHHHHHHHHcccHcccccEEEEEEcccccHHHHHHHHHHHHHHHEEEEHHHEHEEccccEEEEccccccEcccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcc
MLYKRILRILVVFNFFLLINscsvypfyylknqdrteyiHPIKVLVVSKNNKNEIYRSINFLTStvrtknlyQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEisgknilyenntdvtslfdfsdqqfsqlrshKSSEEKAIQELSENIYIDIISFIRTIE
MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLvvsknnkneIYRSINfltstvrtkNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQLRSHKSSEEKAIQelseniyidIISFIRTIE
MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRTIE
******LRILVVFNFFLLINSCSVYPFYYL**********PIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQLEVNIDSFTD******FFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRTI*
MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQ**************AIQELSENIYIDIISFIRTIE
MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQL*SHKSSEEKAIQELSENIYIDIISFIRTIE
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRTIE
MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRTIE
MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRTIE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target165 hypothetical protein CLIBASIA_03470 [Candidatus Liberib
315122025170 hypothetical protein CKC_01375 [Candidatus Liberibacter 1 5e-41
222087923173 hypothetical protein Arad_4936 [Agrobacterium radiobact 1 9e-07
222150240174 hypothetical protein Avi_4382 [Agrobacterium vitis S4] 1 3e-05
195970118181 hypothetical protein SMc02803 [Sinorhizobium meliloti 1 1 6e-05
150398391181 hypothetical protein Smed_3199 [Sinorhizobium medicae W 1 2e-04
159185360163 hypothetical protein Atu2749 [Agrobacterium tumefaciens 1 2e-04
325294119182 hypothetical protein AGROH133_09159 [Agrobacterium sp. 1 2e-04
13473466189 hypothetical protein mll4075 [Mesorhizobium loti MAFF30 1 2e-04
110635539178 hypothetical protein Meso_3210 [Mesorhizobium sp. BNC1] 1 6e-04
209551496173 hypothetical protein Rleg2_3925 [Rhizobium leguminosaru 1 9e-04
>gi|315122025|ref|YP_004062514.1| hypothetical protein CKC_01375 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 170 Back     alignment and organism information
 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 117/151 (77%)

Query: 15  FFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQL 74
           FFL+     +YP YY KN+D T YI+PIK+LV SK+N  EIYR++NFLTS + TKN YQL
Sbjct: 19  FFLVSCDYKIYPLYYSKNKDNTTYINPIKILVSSKDNIQEIYRNLNFLTSAILTKNKYQL 78

Query: 75  EVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQ 134
            VN+ S T+++I N FF NIGRI LKA Y  KE+S   ILY+N+T VTSL+ F++Q F++
Sbjct: 79  NVNVISNTENSIDNIFFNNIGRIVLKANYSLKELSTGKILYKNHTVVTSLYSFTNQNFAK 138

Query: 135 LRSHKSSEEKAIQELSENIYIDIISFIRTIE 165
           +R+ K++E KAI+EL+ENI+IDI+SFI+ ++
Sbjct: 139 MRTIKNTETKAIKELAENIHIDIVSFIKNVD 169


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087923|ref|YP_002546461.1| hypothetical protein Arad_4936 [Agrobacterium radiobacter K84] Length = 173 Back     alignment and organism information
>gi|222150240|ref|YP_002551197.1| hypothetical protein Avi_4382 [Agrobacterium vitis S4] Length = 174 Back     alignment and organism information
>gi|195970118|ref|NP_387438.2| hypothetical protein SMc02803 [Sinorhizobium meliloti 1021] Length = 181 Back     alignment and organism information
>gi|150398391|ref|YP_001328858.1| hypothetical protein Smed_3199 [Sinorhizobium medicae WSM419] Length = 181 Back     alignment and organism information
>gi|159185360|ref|NP_355679.2| hypothetical protein Atu2749 [Agrobacterium tumefaciens str. C58] Length = 163 Back     alignment and organism information
>gi|325294119|ref|YP_004279983.1| hypothetical protein AGROH133_09159 [Agrobacterium sp. H13-3] Length = 182 Back     alignment and organism information
>gi|13473466|ref|NP_105033.1| hypothetical protein mll4075 [Mesorhizobium loti MAFF303099] Length = 189 Back     alignment and organism information
>gi|110635539|ref|YP_675747.1| hypothetical protein Meso_3210 [Mesorhizobium sp. BNC1] Length = 178 Back     alignment and organism information
>gi|209551496|ref|YP_002283413.1| hypothetical protein Rleg2_3925 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 173 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target165 hypothetical protein CLIBASIA_03470 [Candidatus Liberib
pfam09927120 pfam09927, DUF2159, Predicted secreted (periplasmic) pr 4e-06
COG5468172 COG5468, COG5468, Predicted secreted (periplasmic) prot 7e-11
>gnl|CDD|150583 pfam09927, DUF2159, Predicted secreted (periplasmic) protein (DUF2159) Back     alignment and domain information
>gnl|CDD|35027 COG5468, COG5468, Predicted secreted (periplasmic) protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 165 hypothetical protein CLIBASIA_03470 [Candidatus Liberib
COG5468172 Predicted secreted (periplasmic) protein [Function unkn 99.93
PRK10796196 LPS-assembly lipoprotein RlpB; Provisional 98.76
COG2980178 RlpB Rare lipoprotein B [Cell envelope biogenesis, oute 98.72
pfam09927120 DUF2159 Predicted secreted (periplasmic) protein (DUF21 99.88
pfam04390145 RplB Rare lipoprotein B family. The Escherichia coli fa 98.13
PRK11627192 hypothetical protein; Provisional 94.87
pfam05643215 DUF799 Putative bacterial lipoprotein (DUF799). This fa 94.12
PRK10802173 peptidoglycan-associated outer membrane lipoprotein; Pr 93.24
PRK12700230 flgH flagellar basal body L-ring protein; Reviewed 92.07
PRK13731243 conjugal transfer surface exclusion protein TraT; Provi 90.63
>COG5468 Predicted secreted (periplasmic) protein [Function unknown] Back     alignment and domain information
>PRK10796 LPS-assembly lipoprotein RlpB; Provisional Back     alignment and domain information
>COG2980 RlpB Rare lipoprotein B [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam09927 DUF2159 Predicted secreted (periplasmic) protein (DUF2159) Back     alignment and domain information
>pfam04390 RplB Rare lipoprotein B family Back     alignment and domain information
>PRK11627 hypothetical protein; Provisional Back     alignment and domain information
>pfam05643 DUF799 Putative bacterial lipoprotein (DUF799) Back     alignment and domain information
>PRK10802 peptidoglycan-associated outer membrane lipoprotein; Provisional Back     alignment and domain information
>PRK12700 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information
>PRK13731 conjugal transfer surface exclusion protein TraT; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target165 hypothetical protein CLIBASIA_03470 [Candidatus Liberib
2jxp_A155 Putative lipoprotein B; uncharacterized lipoprotein B, 98.33
2r76_A152 RARE lipoprotein B; alpha-beta protein, structural geno 98.16
3bf2_A152 Putative lipoprotein; NESG, MR36A, structural genomics, 98.03
>2jxp_A Putative lipoprotein B; uncharacterized lipoprotein B, structure, northeast structural genomics consortium, NESG, PSI-2; NMR {Nitrosomonas europaea atcc 19718} Back     alignment and structure
Probab=98.33  E-value=7.1e-05  Score=48.09  Aligned_cols=135  Identities=8%  Similarity=0.014  Sum_probs=85.2

Q ss_pred             CCCEEEEECCCCCCCEEEEEEEEECC-CCHHHHHHHHHHHHHCC----CCCCCCCEEEEEEECCCEEE--CCCCCCCCCE
Q ss_conf             85143341577672022325784077-74144899999997314----77776716899971000000--0024676504
Q gi|254780803|r   22 CSVYPFYYLKNQDRTEYIHPIKVLVV-SKNNKNEIYRSINFLTS----TVRTKNLYQLEVNIDSFTDH--AISNAFFKNI   94 (165)
Q Consensus        22 CGf~PlY~~~~~~~~~~l~~I~i~~~-~~r~~~~i~n~L~~~~~----~~~~~~~y~l~i~~~~~~~~--~i~~~~~~~~   94 (165)
                      .||++= |... ..  .+..|.|..+ .......++..|.....    ...+...+.|.+........  .++.+|.+..
T Consensus         1 ~GF~LR-G~~~-~~--~~~~i~i~~~~~~~~~~~l~~~L~~~~~~~v~~~~~~A~~~L~I~~~~~~rr~~Sv~s~g~~~E   76 (155)
T 2jxp_A            1 MGFKLR-GQVS-EL--PFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVRE   76 (155)
T ss_dssp             CCCCCC-CCSS-CC--SCCEEEEECSSCCHHHHHHHHHHHHHSSCEEESSGGGCSEEEEEEEEEEEEEECCEETTTEECE
T ss_pred             CCEEEC-CCCC-CC--CCCEEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCCCCEEEEEEEEEEEEEEEEECCCCEEEE
T ss_conf             975035-8999-98--8656999768984899999999986598497437666768999975142179997747884444


Q ss_pred             EEEEEEEEEEEEECCCCCEEEEEEEEEEEEECCCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999980589587742579998606776157-7999999999999999999999999999
Q gi|254780803|r   95 GRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQF-SQLRSHKSSEEKAIQELSENIYIDIISF  160 (165)
Q Consensus        95 ~~~~~~~~y~L~~~~~~~~i~~~~~~~~~~Y~~~~~~f-~~~~~e~~a~erl~~~lae~I~~~i~~~  160 (165)
                      |++.+++.|++.+..+...+...+++..-+|....+.. +...-|+-..+-+.+.+|.+|..+|.+.
T Consensus        77 yeL~~~v~~~v~~~~g~~l~~~~~i~~~R~y~~d~~~~la~~~Ee~~l~~eM~~~la~qIl~rL~~l  143 (155)
T 2jxp_A           77 FELVYRVAARLLDAHNAELASLQEIRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAF  143 (155)
T ss_dssp             EEEEEEEEEEEEETTSCEEECCCEEEEEEEEECCSSCHHHHTTHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEEEEECCCCCEECCCEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8999999999995999774276689999997349678751599999999999999999999999864



>2r76_A RARE lipoprotein B; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.60A {Shewanella oneidensis mr-1} Back     alignment and structure
>3bf2_A Putative lipoprotein; NESG, MR36A, structural genomics, PSI-2, protein structure initiative; 2.60A {Neisseria meningitidis FAM18} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target165 hypothetical protein CLIBASIA_03470 [Candidatus Liberib
2jxp_A_155 Putative lipoprotein B; uncharacterized lipoprotei 99.04
2r76_A_152 RARE lipoprotein B; alpha-beta protein, structural 98.04
3bf2_A_152 Putative lipoprotein; NESG, MR36A, structural geno 97.9
>2jxp_A (A:) Putative lipoprotein B; uncharacterized lipoprotein B, structure, northeast structural genomics consortium, NESG, PSI-2; NMR {Nitrosomonas europaea atcc 19718} Back     alignment and structure
Probab=99.04  E-value=2.8e-08  Score=69.86  Aligned_cols=136  Identities=9%  Similarity=-0.000  Sum_probs=98.9

Q ss_pred             CCCEEEEECCCCCCCEEEEEEEEECC-CCHHHHHHHHHHHHHCC----CCCCCCCEEEEEEECCCE-EE-CCCCCCCCCE
Q ss_conf             85143341577672022325784077-74144899999997314----777767168999710000-00-0024676504
Q gi|254780803|r   22 CSVYPFYYLKNQDRTEYIHPIKVLVV-SKNNKNEIYRSINFLTS----TVRTKNLYQLEVNIDSFT-DH-AISNAFFKNI   94 (165)
Q Consensus        22 CGf~PlY~~~~~~~~~~l~~I~i~~~-~~r~~~~i~n~L~~~~~----~~~~~~~y~l~i~~~~~~-~~-~i~~~~~~~~   94 (165)
                      |||++= |   ......+..|.|..+ +......+++.|.....    ..+....+.|.+...... .. .+..+|.+..
T Consensus         1 CGf~lr-G---~~~p~~~~~i~v~~~~~~~l~~~L~~~l~~~g~~~iv~~~~~ad~~L~i~~~~~~~~~~s~~~~~~~~e   76 (155)
T 2jxp_A            1 MGFKLR-G---QVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVRE   76 (155)
T ss_dssp             CCCCCC-C---CSSCCSCCEEEEECSSCCHHHHHHHHHHHHHSSCEEESSGGGCSEEEEEEEEEEEEEECCEETTTEECE
T ss_pred             CCEEEC-C---CCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCCCCEEEEEECCEEEEEEEEECCCCCEEE
T ss_conf             975026-8---999988656999868986799999999986598286417767734999920474689985427872578


Q ss_pred             EEEEEEEEEEEEECCCCCEEEEEEEEEEEEECCCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999980589587742579998606776157-79999999999999999999999999997
Q gi|254780803|r   95 GRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQF-SQLRSHKSSEEKAIQELSENIYIDIISFI  161 (165)
Q Consensus        95 ~~~~~~~~y~L~~~~~~~~i~~~~~~~~~~Y~~~~~~f-~~~~~e~~a~erl~~~lae~I~~~i~~~l  161 (165)
                      |+++++++|++.+.+++.++..+.++.+.+|....+.. +....+.-+.+.+.+.+|++|..+|.+--
T Consensus        77 y~L~~~v~~~~~~~~g~~l~~~~~~~~~r~y~~~~~~~~a~~~e~~~l~~~l~~~la~qi~~rl~al~  144 (155)
T 2jxp_A           77 FELVYRVAARLLDAHNAELASLQEIRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFT  144 (155)
T ss_dssp             EEEEEEEEEEEEETTSCEEECCCEEEEEEEEECCSSCHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             EEEEEEEEEEEECCCCCEECCCEEEEEEEEEEECHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999979997752767899999975595676241999999999999999999999998640



>2r76_A (A:) RARE lipoprotein B; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.60A {Shewanella oneidensis mr-1} Back     alignment and structure
>3bf2_A (A:) Putative lipoprotein; NESG, MR36A, structural genomics, PSI-2, protein structure initiative; 2.60A {Neisseria meningitidis FAM18} Back     alignment and structure