254780805

254780805

chromosome partitioning protein B

GeneID in NCBI database:8209811Locus tag:CLIBASIA_03480
Protein GI in NCBI database:254780805Protein Accession:YP_003065218.1
Gene range:+(450712, 451614)Protein Length:300aa
Gene description:chromosome partitioning protein B
COG prediction:[K] Predicted transcriptional regulators
KEGG prediction:parB; chromosome partitioning protein B; K03497 chromosome partitioning protein, ParB family
SEED prediction:Chromosome (plasmid) partitioning protein ParB / Stage 0 sporulation protein J
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cytoskeleton;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGENDFEY
cccccccccccccHHHHHcccccccccHHHHHHcccccEEEccHHHcccccccccccccHHHHHHHHHHHHHccccccEEEEEcccccEEEEccHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccEEEEEEcccccEEEEEEccHHHHHHHHHHHccccccc
ccccHHccccccHHHHHHccccccccccHHHcccccccEEEEcHHHcccccccccccccHHHHHHHHHHHHHcccEEEEEEEEcccccEEEEEcHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEccHHHHHHHHHHHHHccccc
msnnyskrRLGRGLAALIGEvnqsidspekktetipesqdcisihsivpnphnprnyfesegLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMaslsevpviirnvdnkssLEIAIVEnvqrkdlnpleeALGYEQLISEygytqndigsivgksrsHVANILRILKLPSSVREMIRKEEISLGHartlvstsdplSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLlgendfey
msnnyskrrlGRGLAALIGevnqsidspekktetipESQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKmaslsevpviirnvdnksSLEIAIvenvqrkdlnplEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRilklpssvrEMIRKEEISlghartlvstsdplSLAQVIvskkmsvrdteelvqeqdnkkekrkkifegsrekekyltdlekkisskvglnisikhrnnKGQFCIKYETNEQLKIICSLLGENDFEY
MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGENDFEY
*****SK****RGLAALIG**********************ISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEE**************************TDLEKKISSKVGLN*S******KGQFCIKYETNEQLKIICSLLGE*****
********RLGRGLAALIGEVNQSI************SQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKM*******************KKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGENDFEY
***********RGLAALIGE***************PESQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDN*************EKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGEN****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGENDFEY
MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGENDFEY
MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGENDFEY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target300 chromosome partitioning protein B [Candidatus Liberibac
315122028298 chromosome partitioning protein B [Candidatus Liberibac 1 1e-121
86359697293 chromosome partitioning protein B [Rhizobium etli CFN 4 1 4e-86
222087925294 chromosome partitioning protein B [Agrobacterium radiob 1 8e-86
222150242292 chromosome partitioning protein [Agrobacterium vitis S4 1 1e-85
218682743293 putative chromosome partitioning protein [Rhizobium etl 1 2e-85
190893975293 chromosome partitioning protein B [Rhizobium etli CIAT 1 5e-85
327191204293 chromosome partitioning protein B [Rhizobium etli CNPAF 1 6e-85
209551498293 parB-like partition protein [Rhizobium leguminosarum bv 1 3e-84
116254459293 chromosome partitioning protein [Rhizobium leguminosaru 1 7e-84
325294198293 chromosome partitioning protein [Agrobacterium sp. H13- 1 1e-83
>gi|315122028|ref|YP_004062517.1| chromosome partitioning protein B [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 298 Back     alignment and organism information
 Score =  438 bits (1126), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 220/293 (75%), Positives = 254/293 (86%)

Query: 1   MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFES 60
           MSNN SKRRLGRGLAALIGEVNQ  DS EKKTE   E Q+ ISIHSIVPNPHNPR+ F+S
Sbjct: 1   MSNNNSKRRLGRGLAALIGEVNQPTDSYEKKTEKPSEYQNHISIHSIVPNPHNPRDCFDS 60

Query: 61  EGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKS 120
           E LE+L +SI SHGI+QP+IVR +DNGLYKIIAGERRFRAAK ASLS++PVIIR++D+K 
Sbjct: 61  EELEELSKSILSHGILQPIIVREVDNGLYKIIAGERRFRAAKKASLSKIPVIIRDIDDKH 120

Query: 121 SLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPS 180
           SLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQND+GSI+GKSRSH++NILRILKLP 
Sbjct: 121 SLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDLGSIIGKSRSHISNILRILKLPD 180

Query: 181 SVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIF 240
           SV++MI K E+SLGHAR L+ TSDPLSLA++I+SKKMSVRDTEELV+E +NK    KK F
Sbjct: 181 SVKKMILKGELSLGHARALILTSDPLSLAEIIISKKMSVRDTEELVKETENKGINLKKSF 240

Query: 241 EGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLL 293
           +    ++     LEKKISSK+GLN+SIKH NN+GQ CIKY+TNEQL +ICSLL
Sbjct: 241 KKDVVQKNDFAILEKKISSKLGLNVSIKHLNNRGQVCIKYKTNEQLDLICSLL 293


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359697|ref|YP_471589.1| chromosome partitioning protein B [Rhizobium etli CFN 42] Length = 293 Back     alignment and organism information
>gi|222087925|ref|YP_002546463.1| chromosome partitioning protein B [Agrobacterium radiobacter K84] Length = 294 Back     alignment and organism information
>gi|222150242|ref|YP_002551199.1| chromosome partitioning protein [Agrobacterium vitis S4] Length = 292 Back     alignment and organism information
>gi|218682743|ref|ZP_03530344.1| putative chromosome partitioning protein [Rhizobium etli CIAT 894] Length = 293 Back     alignment and organism information
>gi|190893975|ref|YP_001980517.1| chromosome partitioning protein B [Rhizobium etli CIAT 652] Length = 293 Back     alignment and organism information
>gi|327191204|gb|EGE58247.1| chromosome partitioning protein B [Rhizobium etli CNPAF512] Length = 293 Back     alignment and organism information
>gi|209551498|ref|YP_002283415.1| parB-like partition protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 293 Back     alignment and organism information
>gi|116254459|ref|YP_770297.1| chromosome partitioning protein [Rhizobium leguminosarum bv. viciae 3841] Length = 293 Back     alignment and organism information
>gi|325294198|ref|YP_004280062.1| chromosome partitioning protein [Agrobacterium sp. H13-3] Length = 293 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target300 chromosome partitioning protein B [Candidatus Liberibac
TIGR00180187 TIGR00180, parB_part, ParB-like partition proteins 3e-40
TIGR03734 554 TIGR03734, PRTRC_parB, PRTRC system ParB family protein 1e-26
PRK13832 520 PRK13832, PRK13832, plasmid partitioning protein; Provi 2e-13
pfam0219590 pfam02195, ParBc, ParB-like nuclease domain 1e-19
smart0047089 smart00470, ParB, ParB-like nuclease domain 3e-19
TIGR03454325 TIGR03454, partition_RepB, plasmid partitioning protein 2e-07
PRK13866336 PRK13866, PRK13866, plasmid partitioning protein RepB; 8e-05
TIGR00763 775 TIGR00763, lon, ATP-dependent protease La 2e-04
pfam0853593 pfam08535, KorB, KorB domain 0.004
COG1475240 COG1475, Spo0J, Predicted transcriptional regulators [T 7e-34
>gnl|CDD|161748 TIGR00180, parB_part, ParB-like partition proteins Back     alignment and domain information
>gnl|CDD|163446 TIGR03734, PRTRC_parB, PRTRC system ParB family protein Back     alignment and domain information
>gnl|CDD|184353 PRK13832, PRK13832, plasmid partitioning protein; Provisional Back     alignment and domain information
>gnl|CDD|145381 pfam02195, ParBc, ParB-like nuclease domain Back     alignment and domain information
>gnl|CDD|128746 smart00470, ParB, ParB-like nuclease domain Back     alignment and domain information
>gnl|CDD|163272 TIGR03454, partition_RepB, plasmid partitioning protein RepB Back     alignment and domain information
>gnl|CDD|172387 PRK13866, PRK13866, plasmid partitioning protein RepB; Provisional Back     alignment and domain information
>gnl|CDD|162028 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|149550 pfam08535, KorB, KorB domain Back     alignment and domain information
>gnl|CDD|31664 COG1475, Spo0J, Predicted transcriptional regulators [Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 300 chromosome partitioning protein B [Candidatus Liberibac
COG1475240 Spo0J Stage 0 sporulation protein J (antagonist of Soj) 100.0
PRK13698323 plasmid-partitioning protein; Provisional 99.76
TIGR03454325 partition_RepB plasmid partitioning protein RepB. Membe 100.0
PRK13866336 plasmid partitioning protein RepB; Provisional 99.95
TIGR00180192 parB_part ParB-like partition proteins; InterPro: IPR00 99.94
PRK13832 518 plasmid partitioning protein; Provisional 99.95
pfam0219590 ParBc ParB-like nuclease domain. 99.9
smart0047089 ParB ParB-like nuclease domain. Plasmid RK2 ParB prefer 99.87
COG5119119 Uncharacterized protein, contains ParB-like nuclease do 96.17
KOG3388136 consensus 95.17
pfam08857162 ParBc_2 Putative ParB-like nuclease. This domain is pro 92.72
pfam0853593 KorB KorB domain. This family consists of several KorB 98.23
pfam07506185 RepB RepB plasmid partitioning protein. This family inc 97.67
pfam02001100 DUF134 Protein of unknown function DUF134. This family 94.7
COG134299 Predicted DNA-binding proteins [General function predic 94.65
COG2522119 Predicted transcriptional regulator [General function p 94.23
PRK04217110 hypothetical protein; Provisional 93.86
pfam09862113 DUF2089 Protein of unknown function(DUF2089). This doma 92.5
PRK06811185 RNA polymerase factor sigma-70; Validated 92.09
PRK09706135 transcriptional repressor DicA; Reviewed 91.74
smart0053056 HTH_XRE Helix-turn-helix XRE-family like proteins. 91.7
COG2390 321 DeoR Transcriptional regulator, contains sigma factor-r 91.17
pfam0138155 HTH_3 Helix-turn-helix. This large family of DNA bindin 90.64
PHA0197667 helix-turn-helix protein 95.17
TIGR02957287 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family; 94.88
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and related 94.48
pfam04814177 HNF-1_N Hepatocyte nuclear factor 1 (HNF-1), N terminus 93.85
PRK12529178 RNA polymerase sigma factor; Provisional 93.31
PRK12525168 RNA polymerase sigma factor; Provisional 92.6
PRK0972688 DNA-binding transcriptional regulator HipB; Provisional 92.4
TIGR0307058 couple_hipB transcriptional regulator, y4mF family. Mem 91.92
PRK12528167 RNA polymerase sigma factor; Provisional 91.48
PRK12523172 RNA polymerase sigma factor; Reviewed 91.3
COG147668 Predicted transcriptional regulators [Transcription] 90.18
TIGR02980229 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subf 94.93
pfam06250 320 DUF1016 Protein of unknown function (DUF1016). Family o 92.85
TIGR02846228 spore_sigmaK RNA polymerase sigma-K factor; InterPro: I 92.68
pfam11300130 DUF3102 Protein of unknown function (DUF3102). This fam 92.03
pfam0323599 DUF262 Protein of unknown function DUF262. 90.34
>COG1475 Spo0J Stage 0 sporulation protein J (antagonist of Soj) containing ParB-like nuclease domain [Transcription] Back     alignment and domain information
>PRK13698 plasmid-partitioning protein; Provisional Back     alignment and domain information
>TIGR03454 partition_RepB plasmid partitioning protein RepB Back     alignment and domain information
>PRK13866 plasmid partitioning protein RepB; Provisional Back     alignment and domain information
>TIGR00180 parB_part ParB-like partition proteins; InterPro: IPR004437 This group of chromosomal and plasmid partition proteins are related to ParB, including Spo0J, RepB, and SopB Back     alignment and domain information
>PRK13832 plasmid partitioning protein; Provisional Back     alignment and domain information
>pfam02195 ParBc ParB-like nuclease domain Back     alignment and domain information
>smart00470 ParB ParB-like nuclease domain Back     alignment and domain information
>COG5119 Uncharacterized protein, contains ParB-like nuclease domain [General function prediction only] Back     alignment and domain information
>KOG3388 consensus Back     alignment and domain information
>pfam08857 ParBc_2 Putative ParB-like nuclease Back     alignment and domain information
>pfam08535 KorB KorB domain Back     alignment and domain information
>pfam07506 RepB RepB plasmid partitioning protein Back     alignment and domain information
>pfam02001 DUF134 Protein of unknown function DUF134 Back     alignment and domain information
>COG1342 Predicted DNA-binding proteins [General function prediction only] Back     alignment and domain information
>COG2522 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>pfam09862 DUF2089 Protein of unknown function(DUF2089) Back     alignment and domain information
>PRK06811 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK09706 transcriptional repressor DicA; Reviewed Back     alignment and domain information
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>pfam01381 HTH_3 Helix-turn-helix Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family; InterPro: IPR014303 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>pfam04814 HNF-1_N Hepatocyte nuclear factor 1 (HNF-1), N terminus Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09726 DNA-binding transcriptional regulator HipB; Provisional Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>COG1476 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; InterPro: IPR014322 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>pfam06250 DUF1016 Protein of unknown function (DUF1016) Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor; InterPro: IPR014209 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>pfam11300 DUF3102 Protein of unknown function (DUF3102) Back     alignment and domain information
>pfam03235 DUF262 Protein of unknown function DUF262 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target300 chromosome partitioning protein B [Candidatus Liberibac
1vz0_A230 Chromosome Segregation Protein Spo0j From Thermus T 7e-16
>gi|51247949|pdb|1VZ0|A Chain A, Chromosome Segregation Protein Spo0j From Thermus Thermophilus Length = 230 Back     alignment and structure
 Score = 89.0 bits (218), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 88/209 (42%), Positives = 126/209 (60%), Gaps = 18/209 (8%)

Query: 1   MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFES 60
           MS   S   LGRGL AL+                       + + SI PNP  PR  F  
Sbjct: 1   MSRKPS--GLGRGLEALLP--------------KTGAGVVRLPLASIRPNPRQPRKRFAE 44

Query: 61  EGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKS 120
           E L++L  SI+  G++QPL+VR   +G Y+++AGERR+RAA MA L EVP +++++ ++ 
Sbjct: 45  ESLKELADSIREKGLLQPLLVRPQGDG-YELVAGERRYRAALMAGLQEVPAVVKDLTDRE 103

Query: 121 SLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPS 180
           +LE+A+VEN+QR+DL+P+EEA GY+ L  E G TQ ++   VGK+RS VAN LR+L+LP 
Sbjct: 104 ALELALVENLQREDLSPVEEARGYQAL-LEMGLTQEEVARRVGKARSTVANALRLLQLPP 162

Query: 181 SVREMIRKEEISLGHARTLVSTSDPLSLA 209
              E + + EI+ GHAR L+       L 
Sbjct: 163 EALEALERGEITAGHARALLMLEPEDRLW 191


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target300 chromosome partitioning protein B [Candidatus Liberibac
1vz0_A230 PARB, chromosome partitioning protein PARB; nuclear pro 6e-40
1vk1_A242 Conserved hypothetical protein; reductive methylation, 2e-31
1r71_A178 Transcriptional repressor protein KORB; INCP, plasmid p 1e-30
3mky_B189 Protein SOPB; partition, F plasmid, centromere, DNA bin 3e-26
1zx4_A192 P1 PARB, plasmid partition PAR B protein, PARB; transla 7e-17
1yzs_A121 Sulfiredoxin; PARB domain fold, oxidoreductase; NMR {Ho 7e-11
1xw3_A110 Sulfiredoxin; retroreduction, sulfinic acid, peroxiredo 2e-09
>1vz0_A PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} SCOP: a.4.14.1 d.268.1.1 Length = 230 Back     alignment and structure
 Score =  159 bits (404), Expect = 6e-40
 Identities = 91/234 (38%), Positives = 139/234 (59%), Gaps = 18/234 (7%)

Query: 7   KRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFESEGLEDL 66
              LGRGL AL+ +    +                + + SI PNP  PR  F  E L++L
Sbjct: 5   PSGLGRGLEALLPKTGAGVVR--------------LPLASIRPNPRQPRKRFAEESLKEL 50

Query: 67  CQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAI 126
             SI+  G++QPL+VR   +G Y+++AGERR+RAA MA L EVP +++++ ++ +LE+A+
Sbjct: 51  ADSIREKGLLQPLLVRPQGDG-YELVAGERRYRAALMAGLQEVPAVVKDLTDREALELAL 109

Query: 127 VENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREMI 186
           VEN+QR+DL+P+EEA GY+  + E G TQ ++   VGK+RS VAN LR+L+LP    E +
Sbjct: 110 VENLQREDLSPVEEARGYQA-LLEMGLTQEEVARRVGKARSTVANALRLLQLPPEALEAL 168

Query: 187 RKEEISLGHARTLVSTSDP--LSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKK 238
            + EI+ GHAR L+       L   + I+ K +SVR  E L +      ++  +
Sbjct: 169 ERGEITAGHARALLMLEPEDRLWGLKEILEKGLSVRQAEALRERLAMAPKRSAE 222


>1vk1_A Conserved hypothetical protein; reductive methylation, dimethyl lysine, structural genomics, PSI, protein structure initiative; HET: MLY; 1.20A {Pyrococcus furiosus} SCOP: d.268.1.2 Length = 242 Back     alignment and structure
>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1 Length = 178 Back     alignment and structure
>3mky_B Protein SOPB; partition, F plasmid, centromere, DNA binding protein- complex; HET: DNA; 2.86A {Escherichia coli} PDB: 3mkw_B* 3mkz_A* Length = 189 Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Length = 192 Back     alignment and structure
>1yzs_A Sulfiredoxin; PARB domain fold, oxidoreductase; NMR {Homo sapiens} SCOP: d.268.1.4 PDB: 2b6f_A* Length = 121 Back     alignment and structure
>1xw3_A Sulfiredoxin; retroreduction, sulfinic acid, peroxiredoxin, ATP, oxidoreductase; 1.65A {Homo sapiens} SCOP: d.268.1.4 PDB: 1xw4_X* 3cyi_A* 2rii_X 3hy2_X* Length = 110 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target300 chromosome partitioning protein B [Candidatus Liberibac
1vz0_A230 PARB, chromosome partitioning protein PARB; nuclear pro 100.0
1vk1_A242 Conserved hypothetical protein; reductive methylation, 99.96
1r71_A178 Transcriptional repressor protein KORB; INCP, plasmid p 99.93
1vk1_A242 Conserved hypothetical protein; reductive methylation, 90.66
3mky_B189 Protein SOPB; partition, F plasmid, centromere, DNA bin 99.85
1zx4_A192 P1 PARB, plasmid partition PAR B protein, PARB; transla 99.79
1yzs_A121 Sulfiredoxin; PARB domain fold, oxidoreductase; NMR {Ho 99.83
1xw3_A110 Sulfiredoxin; retroreduction, sulfinic acid, peroxiredo 99.76
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genomics, 94.8
2a6c_A83 Helix-turn-helix motif; putative transcriptional regula 94.52
1lmb_392 Protein (lambda repressor); protein-DNA complex, double 94.25
2wiu_B88 HTH-type transcriptional regulator HIPB; transferase tr 94.12
2o38_A120 Hypothetical protein; alpha-beta, helix-turn-helix, str 94.01
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG, GFT 94.0
2w48_A 315 Sorbitol operon regulator; SORC, activator, repressor, 93.85
3cec_A104 Putative antidote protein of plasmid maintenance system 93.65
2fjr_A189 Repressor protein CI; genetic switch, regulation, coope 93.62
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; HTH- 93.58
1u78_A141 TC3 transposase, transposable element TC3 transposase; 93.56
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2, MCS 93.27
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCSG, pr 93.19
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, transcri 93.16
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1.54A 93.12
3bdn_A236 Lambda repressor; repressor, allostery; HET: DNA; 3.91A 93.11
3kz3_A80 Repressor protein CI; five helix bundle, DNA-binding, t 93.06
3ivp_A126 Putative transposon-related DNA-binding protein; APC626 93.04
1b0n_A111 Protein (SINR protein); transcription regulator, antago 92.98
3bs3_A76 Putative DNA-binding protein; XRE-family, structural ge 92.97
2auw_A170 Hypothetical protein NE0471; alpha-beta structure, stru 92.89
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B3021); h 92.82
1x57_A91 Endothelial differentiation-related factor 1; HMBF1alph 92.75
3op9_A114 PLI0006 protein; structural genomics, PSI-2, protein st 92.71
1utx_A66 CYLR2; DNA-binding protein, transcriptional repressor, 92.33
3clc_A82 Regulatory protein; protein-DNA complex, transcriptiona 92.32
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, tran 92.22
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif 92.21
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated reco 92.05
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA binding 91.93
3omt_A73 Uncharacterized protein; structural genomics, PSI-2, pr 91.86
1adr_A76 P22 C2 repressor; transcription regulation; NMR {Entero 91.83
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-turn-h 91.83
1r69_A69 Repressor protein CI; gene regulating protein; 2.00A {P 91.71
1zug_A71 Phage 434 CRO protein; gene regulating protein, transcr 91.7
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, DNA- 91.61
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-binding dom 91.6
3g5g_A99 Regulatory protein; transcriptional regulator, helix-tu 91.55
3mlf_A111 Transcriptional regulator; structural genomics, helix-t 91.39
2eby_A113 Putative HTH-type transcriptional regulator YBAQ; hypot 91.38
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding, tra 91.36
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-dependant 91.05
2p5t_A158 Putative transcriptional regulator PEZA; postsegregatio 90.77
3kxa_A141 NGO0477 protein, putative uncharacterized protein; NEW 90.58
1y9q_A192 Transcriptional regulator, HTH_3 family; transcriptiona 90.47
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-turn-h 90.21
2wte_A244 CSA3; antiviral protein, viral resistance, winged helix 90.95
>1vz0_A PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} SCOP: a.4.14.1 d.268.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=368.81  Aligned_cols=215  Identities=42%  Similarity=0.697  Sum_probs=197.4

Q ss_pred             CHHHHCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEECC
Q ss_conf             02221255868733776543342100001345660240389823578999876898899999998863100155046205
Q gi|254780805|r    5 YSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAI   84 (300)
Q Consensus         5 ~~~~~lGrgl~al~~~~~~~~~~~~~~~~~~~~~~~~i~i~~i~~~p~~pR~~~~~~~l~eLa~SI~~~G~lqPi~Vr~~   84 (300)
                      .+.++|||||+||+|...              .++.+|||+.|+|||+|||+.|+++.+++|++||+.+|++|||+|+|.
T Consensus         3 ~~~~~~~~~l~~l~~~~~--------------~~~~~Ipl~~I~~~p~npR~~~~~~~i~eLa~SI~~~G~l~Pi~v~~~   68 (230)
T 1vz0_A            3 RKPSGLGRGLEALLPKTG--------------AGVVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLLQPLLVRPQ   68 (230)
T ss_dssp             ----------------------------------CEEEEGGGEECCCCCHHHHHHHHHHHHHHHHHHHHCCSSCEEEEEE
T ss_pred             CCCCCCCCCHHHHCCCCC--------------CCEEEEEHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             887878767788668987--------------865885799876698999986999999999999998188576389850


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             65445333575677777642100135433346411234556665431022104899999998521011104679999743
Q gi|254780805|r   85 DNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGK  164 (300)
Q Consensus        85 ~~g~y~ii~G~rR~rAa~~~g~~~ip~iv~~~~d~~~~~~~l~EN~~R~dl~p~e~A~~~~~l~~~~~~t~~~lA~~~G~  164 (300)
                      ++ .|+||+|||||+||+.+|+++|||+|++++|.++..++++||+||++|+|+|+|.+|+++.+ +|+|++++|+++|+
T Consensus        69 ~~-~y~ii~G~rR~~Aa~~lg~~~ip~~V~~~~d~~~~~~~l~eN~~R~~lsp~e~a~~~~~l~~-~g~t~~~iA~~lg~  146 (230)
T 1vz0_A           69 GD-GYELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQREDLSPVEEARGYQALLE-MGLTQEEVARRVGK  146 (230)
T ss_dssp             TT-EEEEEECHHHHHHHHHHTCSEEEEEECCCCHHHHHHHHHHHHHHSTTCCHHHHHHHHHHHHH-TTCCHHHHHHHHTC
T ss_pred             CC-EEEEECHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHH-HCCCHHHHHHHHCC
T ss_conf             98-48996209999999987998016698418819999999998866058988999999999988-41899999988099


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCH--HHHHHHHHHHCCCCHHHHHHHHHHHHCCCCC
Q ss_conf             3787786565654358999987642101677777640100--4689999742224778999999764102222
Q gi|254780805|r  165 SRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSD--PLSLAQVIVSKKMSVRDTEELVQEQDNKKEK  235 (300)
Q Consensus       165 s~s~V~~~LrLl~L~~~i~~~l~~~~is~ghar~Ll~~~~--~~~la~~Ii~~~LSVRe~E~lVk~~~~~~~~  235 (300)
                      |++||+++|+|++||+++++++.+|.|+.+||++|..+++  |..++..|+.++||+|++|++++++......
T Consensus       147 s~~~V~~~l~L~~Lp~~i~~~~~~g~it~~~a~~l~~l~~~~q~~~~~~i~~~~ls~rq~e~l~~~l~~~pk~  219 (230)
T 1vz0_A          147 ARSTVANALRLLQLPPEALEALERGEITAGHARALLMLEPEDRLWGLKEILEKGLSVRQAEALRERLAMAPKR  219 (230)
T ss_dssp             CHHHHHHHHHGGGSCHHHHHHHHTTSSCHHHHHHHHTSCGGGHHHHHHHHHHTCCCHHHHCC-----------
T ss_pred             CHHHHHHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCC
T ss_conf             9999999998751899999999859999899999872998999999999998499999999999986418998



>1vk1_A Conserved hypothetical protein; reductive methylation, dimethyl lysine, structural genomics, PSI, protein structure initiative; HET: MLY; 1.20A {Pyrococcus furiosus} SCOP: d.268.1.2 Back     alignment and structure
>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1 Back     alignment and structure
>1vk1_A Conserved hypothetical protein; reductive methylation, dimethyl lysine, structural genomics, PSI, protein structure initiative; HET: MLY; 1.20A {Pyrococcus furiosus} SCOP: d.268.1.2 Back     alignment and structure
>3mky_B Protein SOPB; partition, F plasmid, centromere, DNA binding protein- complex; HET: DNA; 2.86A {Escherichia coli} PDB: 3mkw_B* 3mkz_A* Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>1yzs_A Sulfiredoxin; PARB domain fold, oxidoreductase; NMR {Homo sapiens} SCOP: d.268.1.4 PDB: 2b6f_A* Back     alignment and structure
>1xw3_A Sulfiredoxin; retroreduction, sulfinic acid, peroxiredoxin, ATP, oxidoreductase; 1.65A {Homo sapiens} SCOP: d.268.1.4 PDB: 1xw4_X* 3cyi_A* 2rii_X 3hy2_X* Back     alignment and structure
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli CFT073} SCOP: a.35.1.3 PDB: 2icp_A Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, bacterial persistence, serine kinase, mercury derivative, SAD; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.83A {Rhodopseudomonas palustris CGA009} SCOP: a.35.1.13 Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3cec_A Putative antidote protein of plasmid maintenance system; ZP_00107635.1, structural genomics, joint center for structural genomics; HET: MSE; 1.60A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomics; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile 630} Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein structure initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1 Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Back     alignment and structure
>1utx_A CYLR2; DNA-binding protein, transcriptional repressor, regulation of cytolysin operon, helix-turn-helix; 1.90A {Enterococcus faecalis} SCOP: a.35.1.3 PDB: 2gzu_A Back     alignment and structure
>3clc_A Regulatory protein; protein-DNA complex, transcriptional regulator, helix-turn- helix, DNA-bending, plasmid, transcription regulator/DNA complex; 2.80A {Enterobacter SP} Back     alignment and structure
>3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional activator, human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response element family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor A3} Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} Back     alignment and structure
>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A Back     alignment and structure
>2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, helix-turn-helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 300 chromosome partitioning protein B [Candidatus Liberibac
d1vk1a_232 d.268.1.2 (A:) Hypothetical protein PF0380 {Pyrococcus 4e-35
d1vz0a293 d.268.1.1 (A:23-115) Putative partitioning protein ParB 1e-17
d1xw3a1110 d.268.1.4 (A:28-137) Sulfiredoxin {Human (Homo sapiens) 2e-10
d1r71a_114 a.4.14.1 (A:) Transcriptional repressor protein KorB DN 6e-17
d1vz0a193 a.4.14.1 (A:116-208) Putative partitioning protein ParB 2e-15
>d1vk1a_ d.268.1.2 (A:) Hypothetical protein PF0380 {Pyrococcus furiosus [TaxId: 2261]} Length = 232 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ParB/Sulfiredoxin
superfamily: ParB/Sulfiredoxin
family: Hypothetical protein PF0380
domain: Hypothetical protein PF0380
species: Pyrococcus furiosus [TaxId: 2261]
 Score =  142 bits (359), Expect = 4e-35
 Identities = 35/214 (16%), Positives = 72/214 (33%), Gaps = 22/214 (10%)

Query: 42  ISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAI--DNGLYKIIAGERRFR 99
           +    I  +   P        LED  +S+   GI    ++ A       Y I+ G  R+ 
Sbjct: 6   VEYVFIELDKMKPHEQLVQRELEDFIESVTGSGIFWKPMLLAKIPGTDEYLIVDGHHRWA 65

Query: 100 AAKMASLSEVPVIIRNVDNKS-----------SLEIAIVENVQRKDLNPLEEALGYEQLI 148
             +       P +I +  ++                 ++E ++ + L  +E+    E+  
Sbjct: 66  GLQKLGAKRAPSVILDYFDEGVKVYTWYPAFKGDVNKVIERLKAEGLEVIEDEKAEEKAE 125

Query: 149 SEYGYTQNDIGSIVGKSRSHVANILRILKLPSSV-REMIRKEEISLGHARTLVSTSDPL- 206
                      +++G+    +   L   K  S V  EM + +EI L +          + 
Sbjct: 126 -----KGEIAFALIGEKSFAIPGGLEEQKKVSKVLDEMDQAKEIELVYYGLKEDAKADME 180

Query: 207 --SLAQVIVSKKMSVRDTEELVQEQDNKKEKRKK 238
              +  V + K  +  +  ELV+  +    K  +
Sbjct: 181 KGEIDYVFIRKAPTKEEVMELVKRGEVFSPKTTR 214


>d1vz0a2 d.268.1.1 (A:23-115) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Length = 93 Back     information, alignment and structure
>d1xw3a1 d.268.1.4 (A:28-137) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} Length = 114 Back     information, alignment and structure
>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Length = 93 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target300 chromosome partitioning protein B [Candidatus Liberibac
d1vk1a_232 Hypothetical protein PF0380 {Pyrococcus furiosus [TaxId 100.0
d1vz0a293 Putative partitioning protein ParB/Spo0J {Thermus therm 99.94
d1xw3a1110 Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d2hwja1201 Hypothetical protein Atu1540 {Agrobacterium tumefaciens 90.72
d1vz0a193 Putative partitioning protein ParB/Spo0J {Thermus therm 99.92
d1r71a_114 Transcriptional repressor protein KorB DNA-binding doma 99.68
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas palustri 95.08
d1ic8a294 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo s 94.82
d2icta187 Antitoxin HigA {Escherichia coli [TaxId: 562]} 94.44
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 94.25
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 94.07
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nitrosom 93.91
d1y7ya169 Restriction-modification controller protein C.AhdI {Aer 93.78
d1lmb3_87 lambda C1 repressor, DNA-binding domain {Bacteriophage 93.13
d1x57a178 Endothelial differentiation-related factor 1, EDF1 {Hum 93.12
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tumefaci 93.08
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [TaxId 92.94
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subtilis [ 92.89
d2r1jl166 P22 C2 repressor, DNA-binding domain {Salmonella bacter 92.55
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 92.49
d1y9qa179 Probable transcriptional regulator VC1968, N-terminal d 92.01
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophage 434 91.99
d1utxa_66 Putative transcription regulator CylR2 {Enterococcus fa 91.94
d1hlva166 DNA-binding domain of centromere binding protein B (CEN 91.72
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 91.19
>d1vk1a_ d.268.1.2 (A:) Hypothetical protein PF0380 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ParB/Sulfiredoxin
superfamily: ParB/Sulfiredoxin
family: Hypothetical protein PF0380
domain: Hypothetical protein PF0380
species: Pyrococcus furiosus [TaxId: 2261]
Probab=100.00  E-value=1e-37  Score=259.42  Aligned_cols=190  Identities=18%  Similarity=0.184  Sum_probs=161.9

Q ss_pred             CEEEEHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEC--CCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             024038982357899987689889999999886310015504620--565445333575677777642100135433346
Q gi|254780805|r   39 QDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRA--IDNGLYKIIAGERRFRAAKMASLSEVPVIIRNV  116 (300)
Q Consensus        39 ~~~i~i~~i~~~p~~pR~~~~~~~l~eLa~SI~~~G~lqPi~Vr~--~~~g~y~ii~G~rR~rAa~~~g~~~ip~iv~~~  116 (300)
                      +..+++..|.++++|||..|+++.+++|+.||+++|+++|++|++  .+++.|+||+|||||+||+.+|+++|||+|.|+
T Consensus         3 v~~ie~~~i~~~~l~P~~~~~~~~l~~L~~sI~~~G~~~ppivv~~~~~~~~y~Ii~G~~R~~Aak~lG~~~IP~iv~d~   82 (232)
T d1vk1a_           3 VKKVEYVFIELDKMKPHEQLVQRELEDFIESVTGSGIFWKPMLLAKIPGTDEYLIVDGHHRWAGLQKLGAKRAPSVILDY   82 (232)
T ss_dssp             EECCCCEEEEGGGEECSBCCCHHHHHHHHHHHHHHCEECSCEEEEECTTSSCEEEEECHHHHHHHHHHTCCEEEEEEECT
T ss_pred             CEECCEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCEEEEECHHHHHHHHHCCCCCCCEEEEEC
T ss_conf             43355157642128898668999999999999980987898898405899877999528999999987998567899837


Q ss_pred             CCHHHHH-----------HHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-H
Q ss_conf             4112345-----------566654310221048999999985210111046799997433787786565654358999-9
Q gi|254780805|r  117 DNKSSLE-----------IAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVR-E  184 (300)
Q Consensus       117 ~d~~~~~-----------~~l~EN~~R~dl~p~e~A~~~~~l~~~~~~t~~~lA~~~G~s~s~V~~~LrLl~L~~~i~-~  184 (300)
                      +|++...           .+++||+||++|+|+|+|.+|+++.     +++..++.+|+++++|+|.+++++++..++ .
T Consensus        83 ~de~~~~~~~~~~~~~~~~~~ien~~r~~l~~ieea~~~~~~~-----~~~~~~~~~gk~~~~i~~~lr~~~l~~~~l~~  157 (232)
T d1vk1a_          83 FDEGVKVYTWYPAFKGDVNKVIERLKAEGLEVIEDEKAEEKAE-----KGEIAFALIGEKSFAIPGGLEEQKKVSKVLDE  157 (232)
T ss_dssp             TSTTCEEECCEEEEESCHHHHHHHHHHTTCCCEECTTHHHHHH-----TTSSSEEEESSSEEEECCSHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9778887654201301467899999987565766653035665-----78899998473088774057765508999999


Q ss_pred             HHHHHHCCHHHHHHHHHCCH---HHHHHHHHHHCCCCHHHHHHHHHHHHCCC
Q ss_conf             87642101677777640100---46899997422247789999997641022
Q gi|254780805|r  185 MIRKEEISLGHARTLVSTSD---PLSLAQVIVSKKMSVRDTEELVQEQDNKK  233 (300)
Q Consensus       185 ~l~~~~is~ghar~Ll~~~~---~~~la~~Ii~~~LSVRe~E~lVk~~~~~~  233 (300)
                      +...|.++.+|++++....+   +.+++..++.+.||||++|++|++.....
T Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~lsvre~e~~vk~~~~~~  209 (232)
T d1vk1a_         158 MDQAKEIELVYYGLKEDAKADMEKGEIDYVFIRKAPTKEEVMELVKRGEVFS  209 (232)
T ss_dssp             HHHTTSSEEEEESCHHHHHHHHHTTSCSEEEECCCCCHHHHHHHHHTTCCBS
T ss_pred             HHHCCHHHHHHHHCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC
T ss_conf             9862213187552435455678765599999864799999999998356689



>d1vz0a2 d.268.1.1 (A:23-115) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xw3a1 d.268.1.4 (A:28-137) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hwja1 d.268.1.3 (A:4-204) Hypothetical protein Atu1540 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1ic8a2 a.35.1.1 (A:87-180) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 300 chromosome partitioning protein B [Candidatus Libe
1yzs_A_121 (A:) Sulfiredoxin; PARB domain fold, oxidoreductas 3e-23
1vz0_A_1-9999 (A:1-99) PARB, chromosome partitioning protein PAR 9e-23
1xw3_A_110 (A:) Sulfiredoxin; retroreduction, sulfinic acid, 2e-15
1r71_A_1-7676 (A:1-76) Transcriptional repressor protein KORB; I 1e-20
1vz0_A_100-15859 (A:100-158) PARB, chromosome partitioning protein 1e-15
1vk1_A_1-93_228-242108 (A:1-93,A:228-242) Conserved hypothetical protein; 1e-18
1zx4_A_1-8181 (A:1-81) P1 PARB, plasmid partition PAR B protein, 1e-16
1vz0_A_159-23072 (A:159-230) PARB, chromosome partitioning protein 4e-13
>1yzs_A (A:) Sulfiredoxin; PARB domain fold, oxidoreductase; NMR {Homo sapiens}Length = 121 Back     alignment and structure
 Score =  103 bits (258), Expect = 3e-23
 Identities = 16/133 (12%), Positives = 35/133 (26%), Gaps = 20/133 (15%)

Query: 6   SKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFESEGLED 65
           +    G    A  G ++            +P       +  +      P    +   ++ 
Sbjct: 2   APEGPGPSGGAQGGSIH---SGRIAAVHNVP-------LSVL--IRPLPSV-LDPAKVQS 48

Query: 66  LCQSIKSHGIIQPLIVR-----AIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNV--DN 118
           L  +I+      P I       A     +    G  R+ A +      +P  +      +
Sbjct: 49  LVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSD 108

Query: 119 KSSLEIAIVENVQ 131
                 A   ++Q
Sbjct: 109 LRVYLGASTPDLQ 121


>1vz0_A (A:1-99) PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus}Length = 99 Back     alignment and structure
>1xw3_A (A:) Sulfiredoxin; retroreduction, sulfinic acid, peroxiredoxin, ATP, oxidoreductase; 1.65A {Homo sapiens}Length = 110 Back     alignment and structure
>1r71_A (A:1-76) Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli}Length = 76 Back     alignment and structure
>1vz0_A (A:100-158) PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus}Length = 59 Back     alignment and structure
>1vk1_A (A:1-93,A:228-242) Conserved hypothetical protein; reductive methylation, dimethyl lysine, structural genomics, PSI, protein structure initiative; HET: MLY; 1.20A {Pyrococcus furiosus}Length = 108 Back     alignment and structure
>1zx4_A (A:1-81) P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_ALength = 81 Back     alignment and structure
>1vz0_A (A:159-230) PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus}Length = 72 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target300 chromosome partitioning protein B [Candidatus Liberibac
1yzs_A_121 Sulfiredoxin; PARB domain fold, oxidoreductase; NM 99.88
1vz0_A_1-9999 PARB, chromosome partitioning protein PARB; nuclea 99.84
1vk1_A_1-93_228-242108 Conserved hypothetical protein; reductive methylat 99.8
1xw3_A_110 Sulfiredoxin; retroreduction, sulfinic acid, perox 99.8
2hwj_A_205 AGR_C_2837P, hypothetical protein ATU1540; structu 96.95
1r71_A_1-7676 Transcriptional repressor protein KORB; INCP, plas 99.73
1vz0_A_100-15859 PARB, chromosome partitioning protein PARB; nuclea 99.46
2h8r_A_1-122122 Hepatocyte nuclear factor 1-beta; trasncription fa 94.82
1ic8_A_1-8585 Hepatocyte nuclear factor 1-alpha; transcription r 94.71
1zx4_A_1-8181 P1 PARB, plasmid partition PAR B protein, PARB; tr 99.65
2o38_A_120 Hypothetical protein; alpha-beta, helix-turn-helix 94.19
2kpj_A_94 SOS-response transcriptional repressor, LEXA; NESG 93.97
2fjr_A_1-7070 Repressor protein CI; genetic switch, regulation, 93.82
3f52_A_117 CLP gene regulator (CLGR); helix-turn-helix motif, 93.46
3fmy_A_73 HTH-type transcriptional regulator MQSA (YGIT/B302 93.12
2wiu_B_88 HTH-type transcriptional regulator HIPB; transfera 93.06
1zug_A_71 Phage 434 CRO protein; gene regulating protein, tr 92.48
1adr_A_76 P22 C2 repressor; transcription regulation; NMR {B 92.32
3gn5_A_72-13362 HTH-type transcriptional regulator MQSA (YGIT/B302 91.86
2p5t_A_158 Putative transcriptional regulator PEZA; postsegre 90.84
2ofy_A_86 Putative XRE-family transcriptional regulator; tra 90.73
1vz0_A_159-23072 PARB, chromosome partitioning protein PARB; nuclea 99.39
2a6c_A_83 Helix-turn-helix motif; NP_841403.1, , structural 94.06
3ivp_A_1-7373 Putative transposon-related DNA-binding protein; A 94.03
2w48_A_1-5454 Sorbitol operon regulator; SORC, activator, repres 93.74
3g5g_A_99 Regulatory protein; transcriptional regulator, hel 93.74
2r1j_L_68 Repressor protein C2; protein-DNA complex, helix-t 93.62
2p8t_A_200 Hypothetical protein PH0730; structural genomics, 93.37
1b0n_A_1-6565 Protein (SINR protein); transcription regulator, a 93.35
2ef8_A_84 C.ECOT38IS, putative transcription factor; helix-t 93.34
1lmb_3_92 Protein (lambda repressor); protein-DNA complex, d 93.26
1r69_A_69 Repressor protein CI; gene regulating protein; 2.0 93.16
1y9q_A_1-7676 Transcriptional regulator, HTH_3 family; transcrip 93.15
3eus_A_86 DNA-binding protein; structural genomics, PSI2,MCS 93.12
1x57_A_91 Endothelial differentiation-related factor 1; HMBF 93.01
3kz3_A_80 Repressor protein CI; five helix bundle, DNA-bindi 92.94
3cec_A_1-5656 Putative antidote protein of plasmid maintenance s 92.81
2ict_A_1-4646 Antitoxin HIGA; helix-turn-helix, structural genom 92.67
3b7h_A_78 Prophage LP1 protein 11; structural genomics, PSI2 92.62
3f6w_A_83 XRE-family like protein; helix-turn-helix, DNA bin 92.55
3clc_A_82 Regulatory protein; protein-DNA complex, transcrip 92.45
1y7y_A_74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 92.39
2eby_A_1-9696 Putative HTH-type transcriptional regulator YBAQ; 92.37
2jvl_A_107 TRMBF1; coactivator, helix-turn-helix, protein bin 92.35
2b5a_A_77 C.BCLI; helix-turn-helix motif, gene regulation; 1 92.23
1utx_A_66 CYLR2; DNA-binding protein, transcriptional repres 92.12
2ppx_A_1-6868 AGR_C_3184P, uncharacterized protein ATU1735; HTH- 91.82
1jko_C_52 HIN recombinase, DNA-invertase HIN; water-mediated 91.8
2ewt_A_71 BLDD, putative DNA-binding protein; the DNA-bindin 91.61
3fym_A_130 Putative uncharacterized protein; HTH DNA binding, 91.53
3bs3_A_76 Putative DNA-binding protein; XRE-family, structur 91.37
3hef_A_143 Gene 1 protein; bacteriophage SF6, terminase small 90.51
>1yzs_A (A:) Sulfiredoxin; PARB domain fold, oxidoreductase; NMR {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=4.3e-23  Score=167.97  Aligned_cols=113  Identities=12%  Similarity=0.136  Sum_probs=95.1

Q ss_pred             HHHHCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEECC-
Q ss_conf             2221255868733776543342100001345660240389823578999876898899999998863100155046205-
Q gi|254780805|r    6 SKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAI-   84 (300)
Q Consensus         6 ~~~~lGrgl~al~~~~~~~~~~~~~~~~~~~~~~~~i~i~~i~~~p~~pR~~~~~~~l~eLa~SI~~~G~lqPi~Vr~~-   84 (300)
                      +.+++|+||++++++....          ....+..||+++|.|+  |||. |+++.+++|++||+++|+++|++|++. 
T Consensus         2 ~~~~~g~~l~~~~~~~~~~----------~~~~~~~ipl~~i~~~--~~r~-~~~~~~~~L~~sI~~~G~~~p~iv~~~~   68 (121)
T 1yzs_A            2 APEGPGPSGGAQGGSIHSG----------RIAAVHNVPLSVLIRP--LPSV-LDPAKVQSLVDTIREDPDSVPPIDVLWI   68 (121)
T ss_dssp             CCCCSSSCSSSCSSCCCSS----------CCCCEEEEEGGGEECC--CCCC-CCHHHHHHHHHHHHHCGGGSCCEEEEEE
T ss_pred             CCCCCCCCCCCCCCCCCCC----------CCCCEEECCHHHCCCC--CCCC-CCHHHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             8999897667789886568----------7672267689995689--9997-8989999999999975410684225501


Q ss_pred             ----CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHH--HHHHHHHHHH
Q ss_conf             ----6544533357567777764210013543334641123--4556665431
Q gi|254780805|r   85 ----DNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKSS--LEIAIVENVQ  131 (300)
Q Consensus        85 ----~~g~y~ii~G~rR~rAa~~~g~~~ip~iv~~~~d~~~--~~~~l~EN~~  131 (300)
                          ++|.|+|++|||||+|++.+|+++|||+|.+++++++  +.++++||+|
T Consensus        69 ~~~~~~~~y~ii~G~~R~~Aa~~lg~~~Ip~~v~d~~~~~~~~~~~~~~eN~q  121 (121)
T 1yzs_A           69 KGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ  121 (121)
T ss_dssp             ECTTSCEEEECCSCHHHHHHHHHTTCSEEEEEEEECCHHHHHHHHTTTCCCCC
T ss_pred             CCCCCCCEEEEEECHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHCCCCCCC
T ss_conf             23678970899636899999998398833689997999999999752372349



>1vz0_A (A:1-99) PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} Back     alignment and structure
>1vk1_A (A:1-93,A:228-242) Conserved hypothetical protein; reductive methylation, dimethyl lysine, structural genomics, PSI, protein structure initiative; HET: MLY; 1.20A {Pyrococcus furiosus} Back     alignment and structure
>1xw3_A (A:) Sulfiredoxin; retroreduction, sulfinic acid, peroxiredoxin, ATP, oxidoreductase; 1.65A {Homo sapiens} Back     alignment and structure
>2hwj_A (A:) AGR_C_2837P, hypothetical protein ATU1540; structural genomics, PSI-2, protein structure initiative; 2.61A {Agrobacterium tumefaciens str} Back     alignment and structure
>1r71_A (A:1-76) Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} Back     alignment and structure
>1vz0_A (A:100-158) PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} Back     alignment and structure
>2h8r_A (A:1-122) Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1ic8_A (A:1-85) Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} Back     alignment and structure
>1zx4_A (A:1-81) P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>2o38_A (A:) Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.83A {Rhodopseudomonas palustris CGA009} Back     alignment and structure
>2kpj_A (A:) SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>2fjr_A (A:1-70) Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A Back     alignment and structure
>3f52_A (A:) CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional activator, human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Back     alignment and structure
>3fmy_A (A:) HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>2wiu_B (B:) HTH-type transcriptional regulator HIPB; transferase transcription complex, bacterial persistence, serine kinase, mercury derivative, SAD; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>1zug_A (A:) Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} Back     alignment and structure
>1adr_A (A:) P22 C2 repressor; transcription regulation; NMR {Bacteriophage P22} Back     alignment and structure
>3gn5_A (A:72-133) HTH-type transcriptional regulator MQSA (YGIT/B3021); Zn-binding protein, HTH-XRE DNA binding motif, DNA-binding, transcription regulation; HET: MEQ; 2.15A {Escherichia coli k-12} PDB: 3gn5_B* Back     alignment and structure
>2p5t_A (A:) Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, helix-turn-helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>2ofy_A (A:) Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PSI, protein structure initiative; 1.70A {Rhodococcus SP} Back     alignment and structure
>1vz0_A (A:159-230) PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} Back     alignment and structure
>2a6c_A (A:) Helix-turn-helix motif; NP_841403.1, , structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: CIT; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>3ivp_A (A:1-73) Putative transposon-related DNA-binding protein; APC62618, structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile 630} Back     alignment and structure
>2w48_A (A:1-54) Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3g5g_A (A:) Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Back     alignment and structure
>2r1j_L (L:) Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} Back     alignment and structure
>2p8t_A (A:) Hypothetical protein PH0730; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.80A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1b0n_A (A:1-65) Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} Back     alignment and structure
>2ef8_A (A:) C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>1lmb_3 (3:) Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} Back     alignment and structure
>1r69_A (A:) Repressor protein CI; gene regulating protein; 2.00A {Phage 434} Back     alignment and structure
>1y9q_A (A:1-76) Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} Back     alignment and structure
>3eus_A (A:) DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomics; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>1x57_A (A:) Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kz3_A (A:) Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>3cec_A (A:1-56) Putative antidote protein of plasmid maintenance system; ZP_00107635.1, structural genomics, joint center for structural genomics; HET: MSE; 1.60A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>2ict_A (A:1-46) Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.63A {Escherichia coli CFT073} Back     alignment and structure
>3b7h_A (A:) Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3f6w_A (A:) XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response element family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>3clc_A (A:) Regulatory protein; protein-DNA complex, transcriptional regulator, helix-turn- helix, DNA-bending, plasmid, transcription regulator/DNA complex; 2.80A {Enterobacter SP} Back     alignment and structure
>1y7y_A (A:) C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} Back     alignment and structure
>2eby_A (A:1-96) Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} Back     alignment and structure
>2jvl_A (A:) TRMBF1; coactivator, helix-turn-helix, protein binding, transcription; NMR {Trichoderma reesei} Back     alignment and structure
>2b5a_A (A:) C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} Back     alignment and structure
>1utx_A (A:) CYLR2; DNA-binding protein, transcriptional repressor, regulation of cytolysin operon, helix-turn-helix; 1.90A {Enterococcus faecalis} Back     alignment and structure
>2ppx_A (A:1-68) AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} Back     alignment and structure
>1jko_C (C:) HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} Back     alignment and structure
>2ewt_A (A:) BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor A3} Back     alignment and structure
>3fym_A (A:) Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3bs3_A (A:) Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3hef_A (A:) Gene 1 protein; bacteriophage SF6, terminase small subunit GP1, GP1 octameric assembly, GP1 channel, DNA recognition, DNA packaging; 1.65A {Enterobacteria phage SF6} Back     alignment and structure