254780806

254780806

chromosome partitioning protein A

GeneID in NCBI database:8209812Locus tag:CLIBASIA_03485
Protein GI in NCBI database:254780806Protein Accession:YP_003065219.1
Gene range:+(449900, 450697)Protein Length:265aa
Gene description:chromosome partitioning protein A
COG prediction:[D] ATPases involved in chromosome partitioning
KEGG prediction:parA; chromosome partitioning protein A; K03496 chromosome partitioning protein
SEED prediction:Chromosome (plasmid) partitioning protein ParA / Sporulation initiation inhibitor protein Soj
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cytoskeleton;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQERHRKEAA
ccccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHccccccccccHHHHHcccccHHHHHcccccccEEEEEcccccccHHHHHHccHHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHHHHcccHHcccccccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHcccc
ccccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHcccHHHHEEccccHHHHEEccccccccEccccccHccEEEEEccHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHcc
MEEKKSRIITIanqkggvgkttTAINLSTALAAIGEnvllidldpqgnastglgielydrkyssYDLLIEEKNINQILIQtaipnlsiipsTMDLLGIEMILGGEKDRLFRLDKALSVQltsdfsyifldcppsfnllTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKnlggkvyntviprnvriseapsygkpaiiydlkcAGSQAYLKLASELIQQERHRKEAA
meekksriitianqkggvgkttTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSdvrknlggkvyntviprnvriseapsyGKPAIIYDLKCAGSQAYLKLASELIQQerhrkeaa
MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQERHRKEAA
****KSR**TIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASE************
MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELI**********
***KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQERHR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQERHRKEAA
MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQERHRKEAA
MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQERHRKEAA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target265 chromosome partitioning protein A [Candidatus Liberibac
254780831341 hypothetical protein CLIBASIA_03620 [Candidatus Li 1e-06
>gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Back     alignment
 Score = 44.7 bits (104), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 65/118 (55%), Gaps = 21/118 (17%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGL-----GIELYDRK 61
           + + +A+ KGGVGK+TT +N++ AL   G+NV ++D D  G +   L      +E+ D+K
Sbjct: 96  KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKK 155

Query: 62  Y----SSYDLLIE------EKNINQI----LIQTAIPNL--SIIPSTMDLLGIEMILG 103
           +     +Y + I       ++N+  I    ++Q+AI ++  +++   +D L I+M  G
Sbjct: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPG 213

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target265 chromosome partitioning protein A [Candidatus Liberibac
315122029265 chromosome partitioning protein A [Candidatus Liberibac 1 1e-135
190893976264 chromosome partitioning protein A [Rhizobium etli CIAT 1 1e-114
327191203264 chromosome partitioning protein A [Rhizobium etli CNPAF 1 1e-114
209551499264 cobyrinic acid ac-diamide synthase [Rhizobium leguminos 1 1e-113
218682744264 chromosome partitioning protein A [Rhizobium etli CIAT 1 1e-113
227823853264 cobyrinic acid a,c-diamide synthase [Sinorhizobium fred 1 1e-113
241206937264 Cobyrinic acid ac-diamide synthase [Rhizobium leguminos 1 1e-113
116254460264 chromosome partitioning protein [Rhizobium leguminosaru 1 1e-113
222087926271 chromosome partitioning protein A [Agrobacterium radiob 1 1e-113
86359698264 chromosome partitioning protein A [Rhizobium etli CFN 4 1 1e-112
>gi|315122029|ref|YP_004062518.1| chromosome partitioning protein A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 265 Back     alignment and organism information
 Score =  483 bits (1244), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/263 (90%), Positives = 249/263 (94%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           MEEK +RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIEL DR
Sbjct: 1   MEEKNTRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELQDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           +YSSY++LI EK ++Q+LI T+IPNLSIIPSTMDLLGIEM LGGEKDRLFRLDKAL+V+L
Sbjct: 61  EYSSYEVLIGEKGVDQVLINTSIPNLSIIPSTMDLLGIEMRLGGEKDRLFRLDKALNVKL 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYIFLDCPPSFNLLTMNAM AADSILVPLQCEFFALEGLSQLLETVEEVRRTVN  
Sbjct: 121 NKKFSYIFLDCPPSFNLLTMNAMVAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNLE 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGIILTMFDSRNSLSQQVVSDVRKNLG KVYNTVIPRNVRISEAPSYGKPAIIYDLK
Sbjct: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGEKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKE 263
           CAGSQAYLKLASE+IQQER RKE
Sbjct: 241 CAGSQAYLKLASEIIQQERQRKE 263


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190893976|ref|YP_001980518.1| chromosome partitioning protein A [Rhizobium etli CIAT 652] Length = 264 Back     alignment and organism information
>gi|327191203|gb|EGE58246.1| chromosome partitioning protein A [Rhizobium etli CNPAF512] Length = 264 Back     alignment and organism information
>gi|209551499|ref|YP_002283416.1| cobyrinic acid ac-diamide synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 264 Back     alignment and organism information
>gi|218682744|ref|ZP_03530345.1| chromosome partitioning protein A [Rhizobium etli CIAT 894] Length = 264 Back     alignment and organism information
>gi|227823853|ref|YP_002827826.1| cobyrinic acid a,c-diamide synthase [Sinorhizobium fredii NGR234] Length = 264 Back     alignment and organism information
>gi|241206937|ref|YP_002978033.1| Cobyrinic acid ac-diamide synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 264 Back     alignment and organism information
>gi|116254460|ref|YP_770298.1| chromosome partitioning protein [Rhizobium leguminosarum bv. viciae 3841] Length = 264 Back     alignment and organism information
>gi|222087926|ref|YP_002546464.1| chromosome partitioning protein A [Agrobacterium radiobacter K84] Length = 271 Back     alignment and organism information
>gi|86359698|ref|YP_471590.1| chromosome partitioning protein A [Rhizobium etli CFN 42] Length = 264 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target265 chromosome partitioning protein A [Candidatus Liberibac
pfam01656212 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding 1e-34
TIGR03453387 TIGR03453, partition_RepA, plasmid partitioning protein 8e-26
COG0455262 COG0455, COG0455, ATPases involved in chromosome partit 5e-22
PRK13869405 PRK13869, PRK13869, plasmid-partitioning protein RepA; 3e-17
cd02036179 cd02036, MinD, Bacterial cell division requires the for 2e-15
PRK13705388 PRK13705, PRK13705, plasmid-partitioning protein SopA; 1e-14
pfam09140261 pfam09140, MipZ, ATPase MipZ 1e-12
PHA02519387 PHA02519, PHA02519, plasmid partition protein SopA; Rev 9e-12
cd03110179 cd03110, Fer4_NifH_child, This protein family's functio 2e-05
cd00550254 cd00550, ArsA_ATPase, Oxyanion-translocating ATPase (Ar 2e-04
TIGR01969251 TIGR01969, minD_arch, cell division ATPase MinD, archae 3e-24
TIGR01968261 TIGR01968, minD_bact, septum site-determining protein M 4e-15
COG2894272 COG2894, MinD, Septum formation inhibitor-activating AT 2e-14
PRK10818270 PRK10818, PRK10818, cell division inhibitor MinD; Provi 2e-09
KOG3022300 KOG3022, KOG3022, KOG3022, Predicted ATPase, nucleotide 5e-07
COG1192259 COG1192, Soj, ATPases involved in chromosome partitioni 4e-58
PHA02518211 PHA02518, PHA02518, ParA-like protein; Provisional 5e-15
CHL00175281 CHL00175, minD, septum-site determining protein; Valida 2e-10
COG0489265 COG0489, Mrp, ATPases involved in chromosome partitioni 1e-09
COG4963366 COG4963, CpaE, Flp pilus assembly protein, ATPase CpaE 1e-06
TIGR01005754 TIGR01005, eps_transp_fam, exopolysaccharide transport 6e-05
PRK10037250 PRK10037, PRK10037, cell division protein; Provisional 0.004
cd02042104 cd02042, ParA, ParA and ParB of Caulobacter crescentus 2e-13
TIGR03371246 TIGR03371, cellulose_yhjQ, cellulose synthase operon pr 2e-07
cd02037169 cd02037, MRP-like, MRP (Multiple Resistance and pH adap 5e-07
cd02038139 cd02038, FleN-like, FleN is a member of the Fer4_NifH s 7e-07
PRK11670369 PRK11670, PRK11670, antiporter inner membrane protein; 4e-06
cd0198399 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains 6e-06
cd03111106 cd03111, CpaE_like, This protein family consists of pro 1e-05
cd02117212 cd02117, NifH_like, This family contains the NifH (iron 2e-05
COG1348278 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorg 2e-05
PRK13185270 PRK13185, chlL, protochlorophyllide reductase iron-sulf 2e-05
pfam00142269 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster bindin 3e-05
cd02033329 cd02033, BchX, Chlorophyllide reductase converts chloro 6e-05
TIGR01281268 TIGR01281, DPOR_bchL, light-independent protochlorophyl 8e-05
cd02032267 cd02032, Bchl_like, This family of proteins contains bc 9e-05
cd02040270 cd02040, NifH, NifH gene encodes component II (iron pro 1e-04
PRK13232273 PRK13232, nifH, nitrogenase reductase; Reviewed 1e-04
CHL00072290 CHL00072, chlL, photochlorophyllide reductase subunit L 2e-04
cd02034116 cd02034, CooC, The accessory protein CooC, which contai 2e-04
PRK13230279 PRK13230, PRK13230, nitrogenase reductase-like protein; 3e-04
TIGR01287275 TIGR01287, nifH, nitrogenase iron protein 8e-04
KOG2825323 KOG2825, KOG2825, KOG2825, Putative arsenite-translocat 9e-04
pfam02374304 pfam02374, ArsA_ATPase, Anion-transporting ATPase 0.001
COG3640255 COG3640, CooC, CO dehydrogenase maturation factor [Cell 0.001
COG1149284 COG1149, COG1149, MinD superfamily P-loop ATPase contai 0.001
pfam06564244 pfam06564, YhjQ, YhjQ protein 0.003
PRK13236296 PRK13236, PRK13236, nitrogenase reductase; Reviewed 0.003
PRK13234295 PRK13234, nifH, nitrogenase reductase; Reviewed 0.004
cd02042104 cd02042, ParA, ParA and ParB of Caulobacter crescentus 2e-12
cd02035217 cd02035, ArsA, ArsA ATPase functionas as an efflux pump 2e-07
COG0003322 COG0003, ArsA, Predicted ATPase involved in chromosome 2e-07
TIGR01007204 TIGR01007, eps_fam, capsular exopolysaccharide family 2e-05
TIGR02016296 TIGR02016, BchX, chlorophyllide reductase iron protein 4e-05
TIGR03018207 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEPCTERM 2e-04
PRK11519719 PRK11519, PRK11519, tyrosine kinase; Provisional 0.002
>gnl|CDD|145019 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>gnl|CDD|163271 TIGR03453, partition_RepA, plasmid partitioning protein RepA Back     alignment and domain information
>gnl|CDD|30803 COG0455, COG0455, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|139929 PRK13869, PRK13869, plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>gnl|CDD|73299 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>gnl|CDD|184261 PRK13705, PRK13705, plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>gnl|CDD|117696 pfam09140, MipZ, ATPase MipZ Back     alignment and domain information
>gnl|CDD|107201 PHA02519, PHA02519, plasmid partition protein SopA; Reviewed Back     alignment and domain information
>gnl|CDD|73339 cd03110, Fer4_NifH_child, This protein family's function is unkown Back     alignment and domain information
>gnl|CDD|73214 cd00550, ArsA_ATPase, Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>gnl|CDD|131024 TIGR01969, minD_arch, cell division ATPase MinD, archaeal Back     alignment and domain information
>gnl|CDD|131023 TIGR01968, minD_bact, septum site-determining protein MinD Back     alignment and domain information
>gnl|CDD|32719 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|182756 PRK10818, PRK10818, cell division inhibitor MinD; Provisional Back     alignment and domain information
>gnl|CDD|38232 KOG3022, KOG3022, KOG3022, Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|31385 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|134018 PHA02518, PHA02518, ParA-like protein; Provisional Back     alignment and domain information
>gnl|CDD|164554 CHL00175, minD, septum-site determining protein; Validated Back     alignment and domain information
>gnl|CDD|30835 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|34570 COG4963, CpaE, Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|130078 TIGR01005, eps_transp_fam, exopolysaccharide transport protein family Back     alignment and domain information
>gnl|CDD|182204 PRK10037, PRK10037, cell division protein; Provisional Back     alignment and domain information
>gnl|CDD|73302 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>gnl|CDD|163238 TIGR03371, cellulose_yhjQ, cellulose synthase operon protein YhjQ Back     alignment and domain information
>gnl|CDD|73300 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>gnl|CDD|73301 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>gnl|CDD|183270 PRK11670, PRK11670, antiporter inner membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|73290 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>gnl|CDD|73340 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>gnl|CDD|48371 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>gnl|CDD|31539 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183881 PRK13185, chlL, protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|143913 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family Back     alignment and domain information
>gnl|CDD|48363 cd02033, BchX, Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>gnl|CDD|130348 TIGR01281, DPOR_bchL, light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>gnl|CDD|48362 cd02032, Bchl_like, This family of proteins contains bchL and chlL Back     alignment and domain information
>gnl|CDD|48369 cd02040, NifH, NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>gnl|CDD|106194 PRK13232, nifH, nitrogenase reductase; Reviewed Back     alignment and domain information
>gnl|CDD|177011 CHL00072, chlL, photochlorophyllide reductase subunit L Back     alignment and domain information
>gnl|CDD|73297 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>gnl|CDD|183903 PRK13230, PRK13230, nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|162286 TIGR01287, nifH, nitrogenase iron protein Back     alignment and domain information
>gnl|CDD|38036 KOG2825, KOG2825, KOG2825, Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|111283 pfam02374, ArsA_ATPase, Anion-transporting ATPase Back     alignment and domain information
>gnl|CDD|33438 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|31343 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|148269 pfam06564, YhjQ, YhjQ protein Back     alignment and domain information
>gnl|CDD|183908 PRK13236, PRK13236, nitrogenase reductase; Reviewed Back     alignment and domain information
>gnl|CDD|183906 PRK13234, nifH, nitrogenase reductase; Reviewed Back     alignment and domain information
>gnl|CDD|73302 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>gnl|CDD|73298 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>gnl|CDD|30352 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|130080 TIGR01007, eps_fam, capsular exopolysaccharide family Back     alignment and domain information
>gnl|CDD|162661 TIGR02016, BchX, chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>gnl|CDD|132063 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>gnl|CDD|183173 PRK11519, PRK11519, tyrosine kinase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 265 chromosome partitioning protein A [Candidatus Liberibac
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 100.0
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 100.0
PRK13869405 plasmid-partitioning protein RepA; Provisional 100.0
TIGR01969258 minD_arch cell division ATPase MinD; InterPro: IPR01022 100.0
PRK10818270 cell division inhibitor MinD; Provisional 100.0
CHL00175279 minD septum-site determining protein; Validated 100.0
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 100.0
PRK13705388 plasmid-partitioning protein SopA; Provisional 100.0
PHA02519387 plasmid partition protein SopA; Reviewed 100.0
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 100.0
COG1192259 Soj ATPases involved in chromosome partitioning [Cell d 100.0
PHA02518211 ParA-like protein; Provisional 100.0
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 100.0
cd02040270 NifH NifH gene encodes component II (iron protein) of n 100.0
PRK13230292 nitrogenase reductase-like protein; Reviewed 100.0
PRK11670369 putative ATPase; Provisional 100.0
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 100.0
cd02036179 MinD Bacterial cell division requires the formation of 100.0
PRK13232273 nifH nitrogenase reductase; Reviewed 100.0
PRK13235274 nifH nitrogenase reductase; Reviewed 100.0
PRK10037250 cell division protein; Provisional 100.0
PRK13233275 nifH nitrogenase reductase; Reviewed 100.0
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, an A 100.0
cd02032267 Bchl_like This family of proteins contains bchL and chl 100.0
PRK13231264 nitrogenase reductase-like protein; Reviewed 100.0
PRK13185269 chlL protochlorophyllide reductase iron-sulfur ATP-bind 100.0
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 100.0
KOG3022300 consensus 100.0
CHL00072271 chlL photochlorophyllide reductase subunit L 100.0
PRK13236295 nitrogenase reductase; Reviewed 100.0
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 100.0
PRK13234293 nifH nitrogenase reductase; Reviewed 100.0
TIGR01287278 nifH nitrogenase iron protein; InterPro: IPR005977 The 100.0
TIGR01281275 DPOR_bchL light-independent protochlorophyllide reducta 100.0
PRK13849231 putative crown gall tumor protein VirC1; Provisional 100.0
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intracell 99.97
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 99.96
COG1348278 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion t 99.96
COG1149284 MinD superfamily P-loop ATPase containing an inserted f 99.95
cd02033329 BchX Chlorophyllide reductase converts chlorophylls int 99.94
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 98.54
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 100.0
cd02117212 NifH_like This family contains the NifH (iron protein) 100.0
cd03110179 Fer4_NifH_child This protein family's function is unkow 99.97
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 99.96
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 99.96
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 99.95
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 99.94
TIGR02016355 BchX chlorophyllide reductase iron protein subunit X; I 99.76
TIGR01005778 eps_transp_fam exopolysaccharide transport protein fami 99.53
PRK00090223 bioD dithiobiotin synthetase; Reviewed 98.95
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 98.84
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 98.84
PRK12374231 putative dithiobiotin synthetase; Provisional 98.78
cd03115173 SRP The signal recognition particle (SRP) mediates the 98.76
PRK13896 432 cobyrinic acid a,c-diamide synthase; Provisional 98.75
PRK10416499 cell division protein FtsY; Provisional 98.73
PRK00784 492 cobyric acid synthase; Provisional 98.72
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 98.71
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 98.71
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 98.7
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 98.7
TIGR00313 502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 98.69
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 98.65
PRK09435325 arginine/ornithine transport system ATPase; Provisional 98.61
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 98.61
PRK00771 433 signal recognition particle protein Srp54; Provisional 98.57
PRK10867 453 signal recognition particle protein; Provisional 98.56
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 98.53
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme meta 98.47
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 98.41
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 98.32
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 98.28
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 98.24
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 98.15
TIGR00379 464 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR 97.93
pfam07755302 DUF1611 Protein of unknown function (DUF1611). This reg 97.36
COG1492 486 CobQ Cobyric acid synthase [Coenzyme metabolism] 97.08
COG3367339 Uncharacterized conserved protein [Function unknown] 96.23
PRK06278482 cobyrinic acid a,c-diamide synthase; Validated 92.52
TIGR01007207 eps_fam capsular exopolysaccharide family; InterPro: IP 99.96
PRK11519720 tyrosine kinase; Provisional 99.96
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 99.96
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 99.95
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 99.94
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 99.94
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 99.92
cd03111106 CpaE_like This protein family consists of proteins simi 99.9
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 99.83
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.76
PRK13768253 GTPase; Provisional 98.48
KOG0781587 consensus 98.32
PRK05632 702 phosphate acetyltransferase; Reviewed 98.11
TIGR01425 453 SRP54_euk signal recognition particle protein SRP54; In 97.98
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 95.94
cd02034116 CooC The accessory protein CooC, which contains a nucle 99.72
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 99.68
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 99.66
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 98.61
cd03114148 ArgK-like The function of this protein family is unkown 98.14
KOG1532 366 consensus 98.14
KOG1533290 consensus 97.81
KOG1534273 consensus 97.13
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.78
TIGR01618229 phage_P_loop phage nucleotide-binding protein; InterPro 96.2
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 95.95
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 99.72
KOG2825323 consensus 99.32
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.75
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 98.66
PRK13886241 conjugal transfer protein TraL; Provisional 98.46
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 98.46
KOG0780 483 consensus 98.3
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 98.16
COG1341398 Predicted GTPase or GTP-binding protein [General functi 97.88
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 97.74
PRK07667190 uridine kinase; Provisional 97.37
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 97.25
cd03116159 MobB Molybdenum is an essential trace element in the fo 97.14
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 97.08
PRK05541176 adenylylsulfate kinase; Provisional 97.07
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 97.04
TIGR00347187 bioD dethiobiotin synthase; InterPro: IPR004472 The enz 97.02
PRK03846198 adenylylsulfate kinase; Provisional 96.84
PRK00652334 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 96.83
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.82
PRK06696227 uridine kinase; Validated 96.8
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 96.78
PRK00313332 lpxK tetraacyldisaccharide 4'-kinase; Provisional 96.74
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 96.73
PRK00889175 adenylylsulfate kinase; Provisional 96.69
pfam02606318 LpxK Tetraacyldisaccharide-1-P 4'-kinase. This family c 96.65
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 96.63
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 96.54
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 96.5
PRK01906339 tetraacyldisaccharide 4'-kinase; Provisional 96.48
PRK05480209 uridine kinase; Provisional 96.47
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 96.35
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 96.35
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 96.33
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 96.31
cd01394218 radB RadB. The archaeal protein radB shares similarity 96.28
PRK00089296 era GTP-binding protein Era; Reviewed 96.21
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 96.18
KOG2749415 consensus 96.09
PRK12377248 putative replication protein; Provisional 96.08
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 96.05
pfam02572172 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 96.02
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 95.9
PRK06526254 transposase; Provisional 95.89
COG1663336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope 95.89
PRK06749428 replicative DNA helicase; Provisional 95.85
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 95.82
COG1484254 DnaC DNA replication protein [DNA replication, recombin 95.82
PRK09302 501 circadian clock protein KaiC; Reviewed 95.81
cd01124187 KaiC KaiC is a circadian clock protein primarily found 95.77
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 95.67
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 95.67
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 95.59
PRK08181269 transposase; Validated 95.58
PRK06547184 hypothetical protein; Provisional 95.57
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 95.57
PRK09183258 transposase/IS protein; Provisional 95.54
PRK05595444 replicative DNA helicase; Provisional 95.53
PRK07952242 DNA replication protein DnaC; Validated 95.52
COG1159298 Era GTPase [General function prediction only] 95.51
PRK05748448 replicative DNA helicase; Provisional 95.48
PRK08506473 replicative DNA helicase; Provisional 95.46
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 95.46
PRK07004460 replicative DNA helicase; Provisional 95.43
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 95.36
PRK13506 577 formate--tetrahydrofolate ligase; Provisional 95.24
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 95.24
PRK04328250 hypothetical protein; Provisional 95.21
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 95.19
PRK07263453 consensus 95.18
TIGR03172232 probable selenium-dependent hydroxylase accessory prote 95.05
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 95.03
PRK08082453 consensus 95.02
PRK05636507 replicative DNA helicase; Provisional 94.98
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 94.97
COG0523323 Putative GTPases (G3E family) [General function predict 94.95
COG2403449 Predicted GTPase [General function prediction only] 94.92
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 94.92
TIGR01085 494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 94.91
PRK13505 556 formate--tetrahydrofolate ligase; Provisional 94.89
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.87
cd00477 524 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyz 94.83
PRK08939306 primosomal protein DnaI; Reviewed 94.78
pfam01268 555 FTHFS Formate--tetrahydrofolate ligase. 94.74
PRK08694468 consensus 94.7
PRK08840464 replicative DNA helicase; Provisional 94.69
PRK09270230 frcK putative fructose transport system kinase; Reviewe 94.67
KOG0635207 consensus 94.62
PRK13507 587 formate--tetrahydrofolate ligase; Provisional 94.62
PRK09401 1176 reverse gyrase; Reviewed 94.61
PRK06067241 flagellar accessory protein FlaH; Validated 94.48
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 94.47
PRK09165484 replicative DNA helicase; Provisional 94.44
smart00382148 AAA ATPases associated with a variety of cellular activ 94.42
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 94.41
PRK08116262 hypothetical protein; Validated 94.34
PRK08760476 replicative DNA helicase; Provisional 94.14
COG4988559 CydD ABC-type transport system involved in cytochrome b 94.14
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 94.11
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 94.07
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.04
PRK08006471 replicative DNA helicase; Provisional 93.97
PRK04220306 2-phosphoglycerate kinase; Provisional 93.9
PRK08233182 hypothetical protein; Provisional 93.89
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 93.85
PTZ00301210 uridine kinase; Provisional 93.77
PRK09354350 recA recombinase A; Provisional 93.77
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 93.75
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 93.6
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.56
PRK05973237 replicative DNA helicase; Provisional 93.46
PRK11545177 gntK gluconate kinase 1; Provisional 93.43
PRK06321472 replicative DNA helicase; Provisional 93.42
pfam06745231 KaiC KaiC. This family represents a conserved region wi 93.35
PRK00139 481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 93.22
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 93.21
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 93.2
PRK07261171 topology modulation protein; Provisional 93.18
PRK06904472 replicative DNA helicase; Validated 93.13
pfam04851103 ResIII Type III restriction enzyme, res subunit. 93.05
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.98
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 92.96
PRK03333 394 coaE dephospho-CoA kinase/unknown domain fusion protein 92.94
PRK06835330 DNA replication protein DnaC; Validated 92.93
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.9
PRK08118167 topology modulation protein; Reviewed 92.85
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.84
KOG1805 1100 consensus 92.8
pfam02223186 Thymidylate_kin Thymidylate kinase. 92.76
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 92.72
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.72
COG0857354 Pta BioD-like N-terminal domain of phosphotransacetylas 92.69
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 92.68
COG4240300 Predicted kinase [General function prediction only] 92.68
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 92.65
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.64
KOG4658 889 consensus 92.57
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 92.5
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 92.49
PRK00698204 tmk thymidylate kinase; Validated 92.41
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.27
PRK13764605 ATPase; Provisional 92.27
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.18
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 92.11
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 92.04
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a famil 91.79
PRK12339197 2-phosphoglycerate kinase; Provisional 91.66
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 91.59
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.58
PRK01368450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.54
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 91.5
PRK06217185 hypothetical protein; Validated 91.48
PRK13721 864 conjugal transfer ATP-binding protein TraC; Provisional 91.47
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.43
TIGR00041211 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thy 91.4
TIGR01082 491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 91.29
COG2759 554 MIS1 Formyltetrahydrofolate synthetase [Nucleotide tran 91.15
PRK07933213 thymidylate kinase; Validated 91.04
PRK05986190 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 91.04
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 91.01
PRK13973216 thymidylate kinase; Provisional 91.0
PRK05876275 short chain dehydrogenase; Provisional 90.94
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 90.93
PRK06194301 hypothetical protein; Provisional 90.92
TIGR02475349 CobW cobalamin biosynthesis protein CobW; InterPro: IPR 90.88
PRK09825176 idnK D-gluconate kinase; Provisional 90.84
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.82
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 90.8
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.74
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 90.73
COG3973 747 Superfamily I DNA and RNA helicases [General function p 90.72
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 90.45
TIGR02770239 nickel_nikD nickel import ATP-binding protein NikD; Int 90.38
pfam05970 418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 90.27
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 90.04
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 98.43
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 98.34
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 98.27
PRK00741 526 prfC peptide chain release factor 3; Provisional 98.23
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 98.2
PRK00007 693 elongation factor G; Reviewed 97.63
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 97.14
PRK12740 670 elongation factor G; Reviewed 96.86
PRK13351 687 elongation factor G; Reviewed 96.8
COG0480 697 FusA Translation elongation factors (GTPases) [Translat 96.78
PRK05506 613 bifunctional sulfate adenylyltransferase subunit 1/aden 96.62
PRK12739 693 elongation factor G; Reviewed 96.3
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 96.14
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 95.9
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 95.37
PRK05433 601 GTP-binding protein LepA; Provisional 95.25
PRK10218 607 GTP-binding protein; Provisional 94.49
KOG0462 650 consensus 94.02
cd00881189 GTP_translation_factor GTP translation factor family. T 93.9
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 93.56
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 92.46
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 92.05
PRK12297429 obgE GTPase ObgE; Reviewed 90.34
PRK12299334 obgE GTPase ObgE; Reviewed 90.32
PRK12298380 obgE GTPase ObgE; Reviewed 90.26
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 90.11
pfam1060981 ParA ParA/MinD ATPase like. This family contains ATPase 98.36
PRK07560 730 elongation factor EF-2; Reviewed 96.53
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 91.87
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 91.46
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 91.39
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 91.27
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penultimate 98.25
TIGR01394 609 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298 95.73
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 93.2
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 93.1
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 92.17
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 91.95
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 90.95
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 90.7
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 90.37
pfam00931285 NB-ARC NB-ARC domain. 95.33
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 91.34
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 91.03
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 90.16
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD; InterPro: IPR010224 Proper placement of the bacterial cell division site requires the site-specific inactivation of other potential division sites Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223 This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>pfam06564 YhjQ YhjQ protein Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK11670 putative ATPase; Provisional Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>pfam09140 MipZ ATPase MipZ Back     alignment and domain information
>KOG3022 consensus Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>pfam07015 VirC1 VirC1 protein Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein; InterPro: IPR005977 The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein; InterPro: IPR005971 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>pfam01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X; InterPro: IPR010246 This entry represents the X subunit of the three-subunit enzyme, (bacterio)chlorophyllide reductase , Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family; InterPro: IPR005700 The bacterial exopolysaccharide transport protein is part of a large genetic locus which is associated with exopolysaccharide (EPS) biosynthesis Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PRK10416 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>pfam03308 ArgK ArgK protein Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09435 arginine/ornithine transport system ATPase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR004484 This family describes cobyrinic acid a,c-diamide synthase, the cobB (cbiA in Salmonella) protein of cobalamin biosynthesis Back     alignment and domain information
>pfam07755 DUF1611 Protein of unknown function (DUF1611) Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>COG3367 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family; InterPro: IPR005702 This family describes the capsular exopolysaccharide proteins in bacteria Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional