254780810

254780810

transcription termination factor Rho

GeneID in NCBI database:8209816Locus tag:CLIBASIA_03505
Protein GI in NCBI database:254780810Protein Accession:YP_003065223.1
Gene range:+(444702, 445973)Protein Length:423aa
Gene description:transcription termination factor Rho
COG prediction:[K] Transcription termination factor
KEGG prediction:rho; transcription termination factor Rho; K03628 transcription termination factor Rho
SEED prediction:Transcription termination factor Rho
Pathway involved in KEGG:RNA degradation [PATH:las03018]
Subsystem involved in SEED:Transcription factors bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN
cccccHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccEEEcccEEEEEcccccccccccccccccccccEEcHHHHHHHHHccccEEEccccccccccEEEccEEEEcccccccHHHcccccccccccccccccccHHccccccccccHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccEEEEEEEEcccccccccccHHHHHccEEEEEEEEHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHcc
ccccEHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEccccccccccccEEEcHHHHHHcccccccEEEEEEEccccccccEEEEEEcccccccHHHHHcHHHHHccccccccHccEccccccccccccHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEccccccHHHHHccHHHHHHHHHHHccccHHHHEHHHHcccccccHHEEHHccccccEEEEccHHHHHccccccEEcccccccHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHccc
msemklqelknksptKLLAFAESLEIENANVMRKQELMFSILKVlsgrdveiIGEGVIEVLQDGfgflrspdanylagpddiyvspsqiksfslktgdtvegsirapreGERYFALLKVNainfdvpervrnkihfdnltplypdkrfnmelnnpenkdisSRVIDLiapigkgqrslivapprtgktILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNvlmpssgkiltggvdanalqrpkrFFGAarnikeggslTIIGTALVDTGSRMDEVIFEEfkgtgnseIVLERKIadkrifpamdiiksgtrkeDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN
msemklqelknksptklLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIksfslktgdtvegsirapreGERYFALLKVNAInfdvpervrnkihfdnltplypdkrfNMELnnpenkdissRVIDLIAPIGkgqrslivapprTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAarnikeggsltIIGTALVDTGSRMDEVIFEefkgtgnseivlerkiadkrifpamdiiksgtrkedllvERQDLQKVFMLRRIVSSMNSSDAIEFLIDklkqtkdnKDFFYSMNKQN
MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN
**EMKLQELKNKSPTKLLAFAESLEIE***VMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN***
MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN
*SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN
MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN
MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target423 transcription termination factor Rho [Candidatus Liberi
254780684438 flagellum-specific ATP synthase [Candidatus Liberi 3e-13
254780615478 F0F1 ATP synthase subunit beta [Candidatus Liberib 3e-06
254780617509 F0F1 ATP synthase subunit alpha [Candidatus Liberi 2e-04
>gi|254780684|ref|YP_003065097.1| flagellum-specific ATP synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 121/259 (46%), Gaps = 30/259 (11%)

Query: 163 RVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECY--LIVLLIDERPEEVT 220
           RVID+  P+  GQR  + A    GK+ LL   A S      +C+  +I+ L+ ER  EV 
Sbjct: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS------DCFDKVIISLVGERGREVR 203

Query: 221 DMQRSVQGE------VISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLC 274
           +      G+      V+ +T DES           +  A+     G +V+++LDSITR  
Sbjct: 204 EFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263

Query: 275 RAYNVLMPSSGKI-LTGGVDANAL-QRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDE 332
            +   +  +SG++ +  G   +   + P+       + KE G++T + + LVD G   ++
Sbjct: 264 HSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD-GDNHND 322

Query: 333 VIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSS 392
            I +  +   +  IVL R +A++  +P +D + S +R  D      +       +++VSS
Sbjct: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE-------KKLVSS 375

Query: 393 MNSSDAIEFLIDKLKQTKD 411
           +        LI + ++T+D
Sbjct: 376 LT------HLIHRFEETRD 388

>gi|254780615|ref|YP_003065028.1| F0F1 ATP synthase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Back     alignment
 Score = 44.7 bits (104), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 94/225 (41%), Gaps = 25/225 (11%)

Query: 163 RVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDM 222
           +VIDLI+P  KG +  +      GKT+L+  + +++ K H   Y +   + ER  E  D+
Sbjct: 138 KVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAH-GGYSVFAGVGERTREGNDL 196

Query: 223 Q------------RSVQGEVISS-------TFDESAARHVQVAEMVIAKAKCLVEYGLDV 263
                        R   G  + S         +E      +VA   +  A+   + G DV
Sbjct: 197 YHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDV 256

Query: 264 VILLDSITRLCRAYNVLMPSSGKI--LTGGVDANALQRPKRFFGAARNIKEGGSLTIIGT 321
           +  +D+I R  +A + +    G+I    G     AL+  +        +K  GS+T +  
Sbjct: 257 LFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLK--GSITSVQA 314

Query: 322 ALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKS 366
             V      D      F    ++  VL R+I++K I+PA+D + S
Sbjct: 315 IYVPADDLTDPAPATSFTHL-DATTVLSRQISEKGIYPAIDPLDS 358

>gi|254780617|ref|YP_003065030.1| F0F1 ATP synthase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Back     alignment
 Score = 38.5 bits (88), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 13/131 (9%)

Query: 163 RVIDLIAPIGKGQRSLIVAPPRTGKTILL------QNIAHSIKKNHPECYLIVLLIDERP 216
           + ID + PIG+GQR LI+   +TGKT ++      Q  +H       + Y I + I ++ 
Sbjct: 151 KAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKR 210

Query: 217 EEVTDMQRSVQ--GEVISSTFDESAARHVQVAEMVIAKAKCLV-EY----GLDVVILLDS 269
             V    ++++  G +  S    ++A      +++   A C + EY    G   +I  D 
Sbjct: 211 SSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDD 270

Query: 270 ITRLCRAYNVL 280
           + +   AY  L
Sbjct: 271 LQKHAVAYRQL 281

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target423 transcription termination factor Rho [Candidatus Liberi
315122033423 transcription termination factor Rho [Candidatus Liberi 1 0.0
241206941421 transcription termination factor Rho [Rhizobium legumin 1 0.0
222087930421 transcription termination factor Rho [Agrobacterium rad 1 0.0
116254464421 transcription termination factor Rho [Rhizobium legumin 1 0.0
190893980421 transcription termination factor protein [Rhizobium etl 1 0.0
86359702421 transcription termination factor Rho [Rhizobium etli CF 1 0.0
327191198421 transcription termination factor protein [Rhizobium etl 1 0.0
15890078421 transcription termination factor Rho [Agrobacterium tum 1 0.0
163757467421 transcription termination factor Rho [Hoeflea phototrop 1 0.0
325294203421 transcription termination factor Rho [Agrobacterium sp. 1 0.0
>gi|315122033|ref|YP_004062522.1| transcription termination factor Rho [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 423 Back     alignment and organism information
 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/423 (96%), Positives = 418/423 (98%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGV+EV
Sbjct: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPDANYLAGPDDIYVSPSQI+SFSLKTGDTVEG IRAP+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIRSFSLKTGDTVEGPIRAPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           +INFDVPERVRNKIHFDNLTPLYPD+RFNMELN+ E KDISSRVIDLIAPIGKGQRSLIV
Sbjct: 121 SINFDVPERVRNKIHFDNLTPLYPDQRFNMELNDLEKKDISSRVIDLIAPIGKGQRSLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQ+IAHSIK NHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA
Sbjct: 181 APPRTGKTMLLQSIAHSIKNNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI+KAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP
Sbjct: 241 RHVQVAEMVISKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA
Sbjct: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNK+FFY MN
Sbjct: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKEFFYLMN 420

Query: 421 KQN 423
           KQN
Sbjct: 421 KQN 423


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241206941|ref|YP_002978037.1| transcription termination factor Rho [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 421 Back     alignment and organism information
>gi|222087930|ref|YP_002546468.1| transcription termination factor Rho [Agrobacterium radiobacter K84] Length = 421 Back     alignment and organism information
>gi|116254464|ref|YP_770302.1| transcription termination factor Rho [Rhizobium leguminosarum bv. viciae 3841] Length = 421 Back     alignment and organism information
>gi|190893980|ref|YP_001980522.1| transcription termination factor protein [Rhizobium etli CIAT 652] Length = 421 Back     alignment and organism information
>gi|86359702|ref|YP_471594.1| transcription termination factor Rho [Rhizobium etli CFN 42] Length = 421 Back     alignment and organism information
>gi|327191198|gb|EGE58241.1| transcription termination factor protein [Rhizobium etli CNPAF512] Length = 421 Back     alignment and organism information
>gi|15890078|ref|NP_355759.1| transcription termination factor Rho [Agrobacterium tumefaciens str. C58] Length = 421 Back     alignment and organism information
>gi|163757467|ref|ZP_02164556.1| transcription termination factor Rho [Hoeflea phototrophica DFL-43] Length = 421 Back     alignment and organism information
>gi|325294203|ref|YP_004280067.1| transcription termination factor Rho [Agrobacterium sp. H13-3] Length = 421 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target423 transcription termination factor Rho [Candidatus Liberi
PRK09376416 PRK09376, rho, transcription termination factor Rho; Pr 0.0
TIGR00767415 TIGR00767, rho, transcription termination factor Rho 0.0
COG1158422 COG1158, Rho, Transcription termination factor [Transcr 0.0
PRK12678672 PRK12678, PRK12678, transcription termination factor Rh 1e-162
PRK12608380 PRK12608, PRK12608, transcription termination factor Rh 1e-154
cd01128249 cd01128, rho_factor, Transcription termination factor r 1e-118
COG1157441 COG1157, FliI, Flagellar biosynthesis/type III secretor 2e-24
cd01136326 cd01136, ATPase_flagellum-secretory_path_III, Flagellum 8e-24
TIGR02546422 TIGR02546, III_secr_ATP, type III secretion apparatus H 7e-21
TIGR01026440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 1e-19
PRK07594433 PRK07594, PRK07594, type III secretion system ATPase Ss 2e-17
PRK07721438 PRK07721, fliI, flagellum-specific ATP synthase; Valida 6e-17
TIGR03497413 TIGR03497, FliI_clade2, flagellar protein export ATPase 8e-16
PRK06820440 PRK06820, PRK06820, type III secretion system ATPase; V 9e-16
PRK09099441 PRK09099, PRK09099, type III secretion system ATPase; P 4e-15
PRK06793432 PRK06793, fliI, flagellum-specific ATP synthase; Valida 6e-15
PRK06315442 PRK06315, PRK06315, type III secretion system ATPase; P 2e-14
TIGR03496411 TIGR03496, FliI_clade1, flagellar protein export ATPase 5e-14
PRK06936439 PRK06936, PRK06936, type III secretion system ATPase; P 1e-13
PRK08149428 PRK08149, PRK08149, ATP synthase SpaL; Validated 3e-12
PRK08972444 PRK08972, fliI, flagellum-specific ATP synthase; Valida 8e-10
PRK07960455 PRK07960, fliI, flagellum-specific ATP synthase; Valida 9e-10
PRK05688451 PRK05688, fliI, flagellum-specific ATP synthase; Valida 3e-08
PRK08472434 PRK08472, fliI, flagellum-specific ATP synthase; Valida 5e-08
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, 4e-62
TIGR03498418 TIGR03498, FliI_clade3, flagellar protein export ATPase 6e-19
PRK08927442 PRK08927, fliI, flagellum-specific ATP synthase; Valida 9e-16
PRK07196434 PRK07196, fliI, flagellum-specific ATP synthase; Valida 1e-13
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 9e-13
PRK06002450 PRK06002, fliI, flagellum-specific ATP synthase; Valida 3e-12
cd01133274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, 3e-09
TIGR01039461 TIGR01039, atpD, ATP synthase, F1 beta subunit 9e-08
COG0055468 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [En 3e-07
cd01134369 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic 0.002
PRK12597461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Pro 0.002
COG1155588 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit 0.003
pfam0749778 pfam07497, Rho_RNA_bind, Rho termination factor, RNA-bi 3e-37
cd0445968 cd04459, Rho_CSD, Rho_CSD: Rho protein cold-shock domai 2e-27
smart0035764 smart00357, CSP, Cold shock protein domain 3e-12
pfam0749843 pfam07498, Rho_N, Rho termination factor, N-terminal do 4e-09
PRK05922434 PRK05922, PRK05922, type III secretion system ATPase; V 9e-08
smart00382148 smart00382, AAA, ATPases associated with a variety of c 3e-05
COG0056504 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [E 2e-04
TIGR03324497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 su 0.001
cd01132274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, centra 0.002
KOG1350521 KOG1350, KOG1350, KOG1350, F0F1-type ATP synthase, beta 7e-07
PRK07165 507 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Va 2e-04
PRK13343502 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Pr 0.002
>gnl|CDD|181809 PRK09376, rho, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|162030 TIGR00767, rho, transcription termination factor Rho Back     alignment and domain information
>gnl|CDD|31352 COG1158, Rho, Transcription termination factor [Transcription] Back     alignment and domain information
>gnl|CDD|183675 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|183622 PRK12608, PRK12608, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|29994 cd01128, rho_factor, Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>gnl|CDD|31351 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|30002 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|162913 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|162162 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|132536 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|163292 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181253 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|143799 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|181583 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|168339 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|29999 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|130111 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|30404 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30000 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|31349 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|148864 pfam07497, Rho_RNA_bind, Rho termination factor, RNA-binding domain Back     alignment and domain information
>gnl|CDD|88425 cd04459, Rho_CSD, Rho_CSD: Rho protein cold-shock domain (CSD) Back     alignment and domain information
>gnl|CDD|128651 smart00357, CSP, Cold shock protein domain Back     alignment and domain information
>gnl|CDD|148865 pfam07498, Rho_N, Rho termination factor, N-terminal domain Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|30405 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|29998 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|36564 KOG1350, KOG1350, KOG1350, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180863 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 423 transcription termination factor Rho [Candidatus Liberi
PRK09376416 rho transcription termination factor Rho; Provisional 100.0
COG1158422 Rho Transcription termination factor [Transcription] 100.0
TIGR00767420 rho transcription termination factor Rho; InterPro: IPR 100.0
TIGR00962520 atpA ATP synthase F1, alpha subunit; InterPro: IPR00529 100.0
PRK09099441 type III secretion system ATPase; Provisional 100.0
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha. 100.0
CHL00059501 atpA ATP synthase CF1 alpha subunit 100.0
PRK07960455 fliI flagellum-specific ATP synthase; Validated 100.0
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 100.0
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 100.0
COG0056504 AtpA F0F1-type ATP synthase, alpha subunit [Energy prod 100.0
PRK12678667 transcription termination factor Rho; Provisional 100.0
PRK12608379 transcription termination factor Rho; Provisional 100.0
TIGR02545439 ATP_syn_fliI flagellar protein export ATPase FliI; Inte 100.0
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 100.0
TIGR01026455 fliI_yscN ATPase FliI/YscN family; InterPro: IPR005714 100.0
COG1157441 FliI Flagellar biosynthesis/type III secretory pathway 100.0
PRK05688451 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06936439 type III secretion system ATPase; Provisional 100.0
PRK07594433 type III secretion system ATPase; Validated 100.0
PRK06793432 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08927441 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08972440 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08472435 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06315442 type III secretion system ATPase; Provisional 100.0
PRK07721435 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. Membe 100.0
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. Membe 100.0
PRK06820445 type III secretion system ATPase; Validated 100.0
PRK06002450 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08149427 ATP synthase SpaL; Validated 100.0
PRK07196434 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. Membe 100.0
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 100.0
PRK05922434 type III secretion system ATPase; Validated 100.0
PRK04196460 V-type ATP synthase subunit B; Provisional 100.0
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 100.0
PRK02118432 V-type ATP synthase subunit B; Provisional 100.0
PTZ00185 574 ATPase alpha subunit; Provisional 100.0
PRK04192585 V-type ATP synthase subunit A; Provisional 100.0
COG1156463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy 100.0
KOG1353340 consensus 99.97
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit; InterP 99.97
KOG1351489 consensus 99.97
TIGR01040464 V-ATPase_V1_B V-type ATPase, B subunit; InterPro: IPR00 99.94
cd01128249 rho_factor Transcription termination factor rho is a ba 100.0
COG1155588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy 100.0
PRK13341 726 recombination factor protein RarA/unknown domain fusion 97.68
PRK13342 417 recombination factor protein RarA; Reviewed 97.5
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 96.71
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.44
KOG2028 554 consensus 96.37
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.39
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 95.31
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.29
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.28
PRK09280466 F0F1 ATP synthase subunit beta; Validated 100.0
PRK12597459 F0F1 ATP synthase subunit beta; Provisional 100.0
CHL00060480 atpB ATP synthase CF1 beta subunit 100.0
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy produ 100.0
KOG1350521 consensus 100.0
TIGR01039460 atpD ATP synthase F1, beta subunit; InterPro: IPR005722 100.0
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-specific 100.0
KOG1352618 consensus 100.0
TIGR01042596 V-ATPase_V1_A V-type ATPase, A subunit; InterPro: IPR00 99.97
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 100.0
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subu 100.0
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central domain. 100.0
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A. 100.0
PRK09302501 circadian clock protein KaiC; Reviewed 98.6
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 95.12
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 100.0
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 99.89
PRK06067241 flagellar accessory protein FlaH; Validated 98.35
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 98.24
pfam06745231 KaiC KaiC. This family represents a conserved region wi 98.14
cd01124187 KaiC KaiC is a circadian clock protein primarily found 98.06
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.03
PRK04328250 hypothetical protein; Provisional 97.78
cd01394218 radB RadB. The archaeal protein radB shares similarity 97.66
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.95
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 95.66
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 94.96
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 94.1
TIGR01043584 ATP_syn_A_arch ATP synthase archaeal, A subunit; InterP 100.0
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 96.33
pfam0749778 Rho_RNA_bind Rho termination factor, RNA-binding domain 99.84
cd0445968 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD). R 99.75
smart0035764 CSP Cold shock protein domain. RNA-binding domain that 96.53
pfam0820658 OB_RNB Ribonuclease B OB domain. This family includes t 91.9
pfam0749843 Rho_N Rho termination factor, N-terminal domain. The Rh 98.35
smart00382148 AAA ATPases associated with a variety of cellular activ 98.15
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 97.93
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 97.58
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 97.47
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 97.4
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 97.34
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 97.25
PRK09354350 recA recombinase A; Provisional 97.16
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 97.14
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 97.1
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 97.08
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 97.03
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 96.84
pfam00931285 NB-ARC NB-ARC domain. 96.83
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 96.77
PRK05541176 adenylylsulfate kinase; Provisional 96.74
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.52
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 96.27
PRK03846198 adenylylsulfate kinase; Provisional 96.12
PRK04301318 radA DNA repair and recombination protein RadA; Validat 96.1
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 96.07
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 96.03
KOG4658 889 consensus 95.97
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 95.87
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 95.87
cd03115173 SRP The signal recognition particle (SRP) mediates the 95.81
PRK04841 903 transcriptional regulator MalT; Provisional 95.78
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 95.76
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 95.58
PRK00889175 adenylylsulfate kinase; Provisional 95.48
KOG0727408 consensus 95.41
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 95.34
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 95.13
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 95.11
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 95.09
PRK10867 453 signal recognition particle protein; Provisional 94.79
PTZ00035350 Rad51; Provisional 94.55
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.47
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 94.27
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 94.2
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 94.15
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 94.1
pfam04665241 Pox_A32 Poxvirus A32 protein. The A32 protein is though 94.05
PRK13768253 GTPase; Provisional 93.62
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 93.57
KOG1433326 consensus 93.48
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 93.48
KOG0744423 consensus 93.41
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 93.39
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 93.23
PRK04040189 adenylate kinase; Provisional 93.22
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components [Intr 93.15
pfam00625182 Guanylate_kin Guanylate kinase. 92.79
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 92.35
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 92.31
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 92.27
KOG0733 802 consensus 92.19
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 92.1
COG0645170 Predicted kinase [General function prediction only] 92.01
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 98.03
PRK03992390 proteasome-activating nucleotidase; Provisional 97.17
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 96.83
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 95.62
PRK13900332 type IV secretion system ATPase VirB11; Provisional 94.77
KOG0651388 consensus 92.34
PRK09302 501 circadian clock protein KaiC; Reviewed 97.79
COG1066 456 Sms Predicted ATP-dependent serine protease [Posttransl 96.9
PRK00149447 dnaA chromosomal replication initiation protein; Review 96.83
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 96.73
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.56
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 96.32
pfam00308219 Bac_DnaA Bacterial dnaA protein. 96.24
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 96.23
pfam00004131 AAA ATPase family associated with various cellular acti 96.22
COG5635 824 Predicted NTPase (NACHT family) [Signal transduction me 96.14
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 96.1
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 96.06
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.04
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 95.98
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 95.98
PRK09270230 frcK putative fructose transport system kinase; Reviewe 95.84
PRK06526254 transposase; Provisional 95.79
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 95.72
PRK08118167 topology modulation protein; Reviewed 95.71
PRK08084235 DNA replication initiation factor; Provisional 95.59
PRK07261171 topology modulation protein; Provisional 95.57
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.55
PRK07952242 DNA replication protein DnaC; Validated 95.53
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 95.52
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.48
PRK09435325 arginine/ornithine transport system ATPase; Provisional 95.48
PRK11147632 ABC transporter ATPase component; Reviewed 95.45
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 95.38
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.34
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 95.33
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 95.31
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.31
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.31
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 95.28
KOG0735 952 consensus 95.25
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 95.24
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 95.24
cd03114148 ArgK-like The function of this protein family is unkown 95.23
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 95.11
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.08
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.06
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 94.99
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 94.98
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 94.96
PRK12422455 chromosomal replication initiation protein; Provisional 94.95
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 94.81
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 94.77
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 94.74
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.71
PRK06696227 uridine kinase; Validated 94.68
COG4987573 CydC ABC-type transport system involved in cytochrome b 94.65
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 94.64
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.55
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 94.54
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 94.53
PRK08903227 hypothetical protein; Validated 94.48
PRK05748448 replicative DNA helicase; Provisional 94.45
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 94.43
PRK05595444 replicative DNA helicase; Provisional 94.4
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 94.32
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 94.32
PRK07667190 uridine kinase; Provisional 94.32
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 94.27
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 94.27
PRK13409590 putative ATPase RIL; Provisional 94.24
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 94.23
PRK10908222 cell division protein FtsE; Provisional 94.22
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 94.2
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 94.17
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 94.16
TIGR00416 481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 94.16
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.16
PRK09183258 transposase/IS protein; Provisional 94.16
PRK06217185 hypothetical protein; Validated 94.16
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 94.14
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 94.11
PRK07263453 consensus 94.07
PRK08181269 transposase; Validated 94.06
PRK08082453 consensus 94.05
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 94.04
PRK12402337 replication factor C small subunit 2; Reviewed 93.98
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 93.94
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 93.91
PRK08760476 replicative DNA helicase; Provisional 93.89
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 93.88
PRK08694468 consensus 93.87
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 93.87
PRK12377248 putative replication protein; Provisional 93.84
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 93.82
PRK00440318 rfc replication factor C small subunit; Reviewed 93.78
COG4555245 NatA ABC-type Na+ transport system, ATPase component [E 93.74
pfam07726131 AAA_3 ATPase family associated with various cellular ac 93.73
pfam04851103 ResIII Type III restriction enzyme, res subunit. 93.68
PRK05564313 DNA polymerase III subunit delta'; Validated 93.66
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 93.65
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 93.63
PRK13894320 conjugal transfer ATPase TrbB; Provisional 93.61
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 93.53
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.51
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 93.5
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 93.49
PRK08006471 replicative DNA helicase; Provisional 93.48
PRK08939306 primosomal protein DnaI; Reviewed 93.48
PRK13536306 nodulation factor exporter subunit NodI; Provisional 93.44
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 93.44
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 93.43
PRK07004460 replicative DNA helicase; Provisional 93.41
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 93.4
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 93.39
KOG0743457 consensus 93.38
PRK08506473 replicative DNA helicase; Provisional 93.37
PRK04195 403 replication factor C large subunit; Provisional 93.37
PRK13764 605 ATPase; Provisional 93.36
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 93.35
COG0714329 MoxR-like ATPases [General function prediction only] 93.33
PRK06904472 replicative DNA helicase; Validated 93.3
PRK05636507 replicative DNA helicase; Provisional 93.3
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 93.26
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 93.18
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 93.17
COG1484254 DnaC DNA replication protein [DNA replication, recombin 93.16
CHL00195491 ycf46 Ycf46; Provisional 93.15
PRK13833323 conjugal transfer protein TrbB; Provisional 93.11
PRK06749428 replicative DNA helicase; Provisional 93.08
PRK08840464 replicative DNA helicase; Provisional 93.05
PRK09112352 DNA polymerase III subunit delta'; Validated 93.01
PRK06321472 replicative DNA helicase; Provisional 92.91
PRK13409 590 putative ATPase RIL; Provisional 92.82
KOG0062 582 consensus 92.81
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 92.78
PTZ00301210 uridine kinase; Provisional 92.66
KOG0736953 consensus 92.64
COG1123539 ATPase components of various ABC-type transport systems 92.62
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 92.62
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 92.59
PRK13695174 putative NTPase; Provisional 92.56
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 92.55
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 92.52
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 92.51
PRK06851368 hypothetical protein; Provisional 92.49
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 92.48
COG4181228 Predicted ABC-type transport system involved in lysopho 92.46
KOG0066 807 consensus 92.46
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 92.44
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 92.44
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 92.33
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 92.29
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 92.27
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 92.19
COG0488 530 Uup ATPase components of ABC transporters with duplicat 92.17
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 92.15
PRK13873 815 conjugal transfer ATPase TrbE; Provisional 92.15
PRK08058329 DNA polymerase III subunit delta'; Validated 92.11
PRK07773 868 replicative DNA helicase; Validated 91.98
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 91.95
pfam03266168 DUF265 Protein of unknown function, DUF265. 91.92
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 91.87
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 91.85
PRK11054 684 helD DNA helicase IV; Provisional 91.84
COG1135339 AbcC ABC-type metal ion transport system, ATPase compon 91.84
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.36
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.29
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 96.89
KOG0057591 consensus 96.67
KOG0056790 consensus 95.75
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 95.56
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 95.3
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 95.05
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 94.98
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 96.85
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 96.59
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.39
KOG0745 564 consensus 95.94
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 95.38
PRK10416499 cell division protein FtsY; Provisional 95.02
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 93.43
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 96.78
PRK10790593 putative multidrug transporter membrane\ATP-binding com 94.95
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.41
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.3
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.2
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 96.04
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.01
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 95.97
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 95.89
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 95.67
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.65
PRK10636638 putative ABC transporter ATP-binding protein; Provision 95.64
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 95.57
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 95.55
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 95.54
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 95.53
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 95.52
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 95.5
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 95.46
COG3839338 MalK ABC-type sugar transport systems, ATPase component 95.42
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.41
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 95.41
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.41
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.4
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 95.39
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.32
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.31
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.31
PRK10744257 phosphate transporter subunit; Provisional 95.29
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 95.27
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.27
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.24
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 95.2
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.2
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.19
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 95.18
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 95.16
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.16
cd03234226 ABCG_White The White subfamily represents ABC transport 95.13
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 95.12
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.11
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.11
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.1
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.09
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 95.08
PRK09984262 phosphonate/organophosphate ester transporter subunit; 95.07
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 95.03
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 95.02
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.02
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 95.0
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 94.96
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 94.95
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.95
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.92
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 94.91
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.89
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.85
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 94.82
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 94.78
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 94.78
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 94.78
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 94.76
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 94.76
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 94.74
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 94.66
PRK03695245 vitamin B12-transporter ATPase; Provisional 94.65
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 94.63
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.6
PRK13542224 consensus 94.54
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 94.52
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 94.5
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 94.48
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 94.45
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 94.43
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 94.41
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 94.41
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.34
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 94.34
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 94.33
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 94.31
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 94.29
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 94.23
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.23
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 94.22
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 94.2
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 94.2
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 94.2
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 94.18
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 94.16
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 94.15
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 94.1
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 94.1
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 94.1
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 94.08
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.07
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 94.04
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.04
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 93.98
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 93.98
COG0488530 Uup ATPase components of ABC transporters with duplicat 93.94
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 93.8
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 93.75
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 93.72
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 93.69
PRK13544208 consensus 93.59
COG4988559 CydD ABC-type transport system involved in cytochrome b 93.58
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.54
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.52
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 93.46
COG1127263 Ttg2A ABC-type transport system involved in resistance 93.44
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 93.43
COG4586325 ABC-type uncharacterized transport system, ATPase compo 93.36
PRK13549513 xylose transporter ATP-binding subunit; Provisional 93.23
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 93.12
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 93.11
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.11
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 93.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 92.92
CHL00181287 cbbX CbbX; Provisional 92.85
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 92.73
PRK10762501 D-ribose transporter ATP binding protein; Provisional 92.69
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 92.63
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 92.61
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 92.57
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 92.47
pfam03193161 DUF258 Protein of unknown function, DUF258. 92.3
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 92.3
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 92.06
PRK11823454 DNA repair protein RadA; Provisional 96.16
PRK09519 790 recA recombinase A; Reviewed 95.87
PRK11642 813 exoribonuclease R; Provisional 95.81
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.74
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.6
COG4178604 ABC-type uncharacterized transport system, permease and 95.19
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 95.13
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.06
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 94.91
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.83
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 94.79
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 94.54
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 94.47
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 94.12
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 93.89
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 93.84
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 93.05
KOG0060659 consensus 93.04
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 92.5
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 92.29
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 95.69
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 95.12
PRK08116262 hypothetical protein; Validated 94.38
PRK10636638 putative ABC transporter ATP-binding protein; Provision 95.62
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 94.68
PRK11147632 ABC transporter ATPase component; Reviewed 95.26
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 93.0
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 95.14
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 94.07
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 93.62
PRK04220306 2-phosphoglycerate kinase; Provisional 94.84
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 94.62
COG4619223 ABC-type uncharacterized transport system, ATPase compo 94.51
COG4136213 ABC-type uncharacterized transport system, ATPase compo 92.37
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 94.48
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 93.7
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 92.89
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 92.83
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 92.47
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 92.46
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho; InterPro: IPR004665 Members of this family have a related but highly variable long, highly charged insert near the amino end Back     alignment and domain information
>TIGR00962 atpA ATP synthase F1, alpha subunit; InterPro: IPR005294 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information