254780809

254780809

tRNA modification GTPase TrmE

GeneID in NCBI database:8209815Locus tag:CLIBASIA_03500
Protein GI in NCBI database:254780809Protein Accession:YP_003065222.1
Gene range:+(445994, 447316)Protein Length:440aa
Gene description:tRNA modification GTPase TrmE
COG prediction:[R] Predicted GTPase
KEGG prediction:trmE; tRNA modification GTPase TrmE; K03650 tRNA modification GTPase
SEED prediction:GTPase and tRNA-U34 5-formylation enzyme TrmE
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Universal GTPases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MNHEKETIFAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENADLILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK
cccccccEEEEEccccccEEEEEEEccHHHHHHHHHHHcccccccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEEcccHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHccccEEcccccccEEEEEEEEEEEccEEEEEEEcHHHcccccHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHcccEEEEEEEHHHHcccccccccEEEEccccccHHHHHHHHHHHHccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccc
ccccccEEEEEEccccccEEEEEEEccHHHHHHHHHHHcccccccccccccccccccccEHHHHEEEEcccccccccccEEEEcccccHHHHHHHHHHHHHcccccEcccccccHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccEEEEEccccccHHHHHHHHHccccEEEEccccccHHHHHHEEccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEcccccccHcccccccEEEEEEccccccccccccEEEEEccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccc
MNHEKETIFAVSTGALPSAISIIrlsgpscfQVCEFIckkkkpfprkaslRYFFGldgrildkgllivfpspesftgedsaefhVHGGIAVVNGILEELakmpnlrlanpgefsrraFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIeadldfseeedvqnfsskevLNDILFLKndisshisqgklgeIIRNGYKIVILGHSNAGKSSLFNALakkdvaivtdipgttrdVLTIDLDLEGylvkisdtagiretddivEKEGIKRTFLEVENADLILLLKEInskkeisfpknidfifigtksdlysTYTEEYDHLISSFTGEGLEELINKIKSILSNkfkklpfsipshkrhLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK
MNHEKETIFAVSTGALPSAISIIRLSGPSCFQVCEFIckkkkpfprkASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALAKKDVAivtdipgttrdvltidldlegylvkisdtagiretddivekegikrtflevenADLILLLKEinskkeisfpknidfifIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK
MNHEKETIFAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENADLILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK
***EKET*FAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFENGKIDLLEAESLADLISSETE************ELSSLYGQWIDKLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENADLILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK
MNHEKETIFAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENADLILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK
***EKETIFAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENADLILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHEKETIFAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENADLILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK
MNHEKETIFAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENADLILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK
MNHEKETIFAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENADLILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target440 tRNA modification GTPase TrmE [Candidatus Liberibacter
255764471 470 GTP-binding protein EngA [Candidatus Liberibacter 3e-13
255764471470 GTP-binding protein EngA [Candidatus Liberibacter 3e-07
254780941311 GTP-binding protein Era [Candidatus Liberibacter a 1e-05
254780787 884 translation initiation factor IF-2 [Candidatus Lib 0.005
254780226 367 translation-associated GTPase [Candidatus Liberiba 0.007
>gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Back     alignment
 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 88/181 (48%), Gaps = 23/181 (12%)

Query: 220 YKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRE 279
           Y I I+G  N GKS+LFN L KK +A+V + PG TRD L     + G +  I DTAGI +
Sbjct: 3   YTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIAD 62

Query: 280 TDDI-VEKEGIKRTFLEVENADLILLLKEINSKKEI--------SF--PKNIDFIFIGTK 328
             +  + K+   +T L +  A LIL L  I+SK  I        SF   KNI  I +  K
Sbjct: 63  GKNCSIAKQMNDQTELAINEAHLILFL--IDSKAGITPYDHAITSFLRKKNIPIIIVSNK 120

Query: 329 SD-------LYSTYTEEYDHL--ISSFTGEGLEELINKIKSILSNKFKKLPFS-IPSHKR 378
            D        Y  Y+ ++  +  IS+    G  EL + I  I   K+   P   I ++KR
Sbjct: 121 MDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKR 180

Query: 379 H 379
           +
Sbjct: 181 N 181

>gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Back     alignment
 Score = 47.8 bits (112), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 3/88 (3%)

Query: 221 KIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRET 280
           +I ++G  N GKS+L N L   +  +     G TRD ++I  + + + ++I DTAG+R+ 
Sbjct: 205 RIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKP 264

Query: 281 DDI---VEKEGIKRTFLEVENADLILLL 305
             I   +E++ +K++   V   +  ++L
Sbjct: 265 SRITESLEQKTVKKSMQSVRTCETTIVL 292

>gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Back     alignment
 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 51/93 (54%), Gaps = 2/93 (2%)

Query: 222 IVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETD 281
           + ++G +NAGKS+L N      V+IVT    TTR ++   +  +   +   DT GI    
Sbjct: 25  VALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAK 84

Query: 282 DIVEKEGIKRTFLEVENADLILLLKEINSKKEI 314
           D   K  I+ ++  +++AD++ L+  ++S +E+
Sbjct: 85  DSYHKLMIRLSWSTIKHADIVCLV--VDSHREL 115

>gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Back     alignment
 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 222 IVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAG 276
           + I+GH + GK+SL +A+ K DVA   +I G T+ +    +  +G  +   DT G
Sbjct: 386 VTIMGHVDHGKTSLLDAIRKADVA-KGEIGGITQHIGAYQVAYQGKNITFLDTPG 439

>gi|254780226|ref|YP_003064639.1| translation-associated GTPase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Back     alignment
 Score = 33.5 bits (75), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 219 GYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTT 254
           G+K  I+G  N GKS+LFNAL +   A   + P  T
Sbjct: 2   GFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCT 37

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target440 tRNA modification GTPase TrmE [Candidatus Liberibacter
315122032440 tRNA modification GTPase TrmE [Candidatus Liberibacter 1 0.0
222087929444 tRNA modification GTPase TrmE [Agrobacterium radiobacte 1 1e-118
227823856439 tRNA modification GTPase TrmE [Sinorhizobium fredii NGR 1 1e-114
161621425439 tRNA modification GTPase TrmE [Sinorhizobium meliloti 1 1 1e-113
327191200437 GTP-binding protein in thiophene and furan oxidation [R 1 1e-113
209551502437 tRNA modification GTPase TrmE [Rhizobium leguminosarum 1 1e-113
190893979439 GTP-binding protein in thiophene and furan oxidation [R 1 1e-112
116254463439 tRNA modification GTPase TrmE [Rhizobium leguminosarum 1 1e-112
15890077442 tRNA modification GTPase TrmE [Agrobacterium tumefacien 1 1e-112
325294202443 tRNA modification GTPase TrmE [Agrobacterium sp. H13-3] 1 1e-112
>gi|315122032|ref|YP_004062521.1| tRNA modification GTPase TrmE [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 440 Back     alignment and organism information
 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/440 (84%), Positives = 403/440 (91%)

Query: 1   MNHEKETIFAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRI 60
           MN+EK+TIFA+S+G LPSAIS+IRLSG SCFQVCEFICKKK P PR ASLR+F+G DGRI
Sbjct: 1   MNYEKKTIFALSSGILPSAISVIRLSGSSCFQVCEFICKKKNPLPRVASLRFFYGFDGRI 60

Query: 61  LDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPNLRLANPGEFSRRAFEN 120
           LDKGLLI+FPSP+SFTGED AEFHVHGGI+VV+GILEELAKMPNLR ANPGEFSRRAFEN
Sbjct: 61  LDKGLLILFPSPKSFTGEDCAEFHVHGGISVVDGILEELAKMPNLRRANPGEFSRRAFEN 120

Query: 121 GKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWIDKLTHIRSFIEADLDFSE 180
           GKIDLLEAESLADLISSETEMQRRLSMEGMSG+LS+LY  WI+KLT++RSFIEADLDFS+
Sbjct: 121 GKIDLLEAESLADLISSETEMQRRLSMEGMSGKLSNLYNGWINKLTYVRSFIEADLDFSD 180

Query: 181 EEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKIVILGHSNAGKSSLFNALA 240
           EEDVQ FSSKE+ NDIL LK++ISSHISQGKLGEIIRNGYKIVILG+SNAGKSSL NALA
Sbjct: 181 EEDVQKFSSKEIWNDILLLKDEISSHISQGKLGEIIRNGYKIVILGNSNAGKSSLLNALA 240

Query: 241 KKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENAD 300
           K+DVAIVTD+PGTTRDV+TIDLDL GYLVKISDTAGIRET+ IVEKEGIKR F EVENAD
Sbjct: 241 KRDVAIVTDVPGTTRDVITIDLDLGGYLVKISDTAGIRETNSIVEKEGIKRAFREVENAD 300

Query: 301 LILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYDHLISSFTGEGLEELINKIKS 360
           LILLL+EI+SK EI FPKNI FIFIGTKSDLY    +EYDHLISS TGEGLEELINKIK+
Sbjct: 301 LILLLEEISSKTEILFPKNIAFIFIGTKSDLYDNSFKEYDHLISSVTGEGLEELINKIKN 360

Query: 361 ILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKDCGLDIIAENLRLASVSLGKIT 420
           I+SNKFK     IPSHKRHL HLSQ V+YLE AS  EKDCGLDIIAENLRLAS+SLG+IT
Sbjct: 361 IISNKFKTNSMFIPSHKRHLDHLSQAVKYLEDASSGEKDCGLDIIAENLRLASISLGRIT 420

Query: 421 GCVDVEQLLDIIFSKFCIGK 440
           G VDVEQLLDIIFSKFCIGK
Sbjct: 421 GNVDVEQLLDIIFSKFCIGK 440


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087929|ref|YP_002546467.1| tRNA modification GTPase TrmE [Agrobacterium radiobacter K84] Length = 444 Back     alignment and organism information
>gi|227823856|ref|YP_002827829.1| tRNA modification GTPase TrmE [Sinorhizobium fredii NGR234] Length = 439 Back     alignment and organism information
>gi|161621425|ref|NP_387444.2| tRNA modification GTPase TrmE [Sinorhizobium meliloti 1021] Length = 439 Back     alignment and organism information
>gi|327191200|gb|EGE58243.1| GTP-binding protein in thiophene and furan oxidation [Rhizobium etli CNPAF512] Length = 437 Back     alignment and organism information
>gi|209551502|ref|YP_002283419.1| tRNA modification GTPase TrmE [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 437 Back     alignment and organism information
>gi|190893979|ref|YP_001980521.1| GTP-binding protein in thiophene and furan oxidation [Rhizobium etli CIAT 652] Length = 439 Back     alignment and organism information
>gi|116254463|ref|YP_770301.1| tRNA modification GTPase TrmE [Rhizobium leguminosarum bv. viciae 3841] Length = 439 Back     alignment and organism information
>gi|15890077|ref|NP_355758.1| tRNA modification GTPase TrmE [Agrobacterium tumefaciens str. C58] Length = 442 Back     alignment and organism information
>gi|325294202|ref|YP_004280066.1| tRNA modification GTPase TrmE [Agrobacterium sp. H13-3] Length = 443 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target440 tRNA modification GTPase TrmE [Candidatus Liberibacter
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed 1e-146
KOG1191531 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Transl 1e-80
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase Trm 3e-70
COG0486454 COG0486, ThdF, Predicted GTPase [General function predi 1e-124
cd04164157 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain pr 2e-46
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 4e-21
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 5e-20
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 3e-17
cd00880163 cd00880, Era_like, Era (E 1e-16
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 1e-16
cd01894157 cd01894, EngA1, EngA1 subfamily 2e-16
COG1160 444 COG1160, COG1160, Predicted GTPases [General function p 5e-16
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 5e-16
cd04163168 cd04163, Era, Era subfamily 2e-08
COG1159298 COG1159, Era, GTPase [General function prediction only] 3e-08
COG2262411 COG2262, HflX, GTPases [General function prediction onl 3e-08
PRK00089292 PRK00089, era, GTPase Era; Reviewed 5e-08
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 6e-08
cd00882157 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily 8e-08
PRK15494339 PRK15494, era, GTPase Era; Provisional 3e-07
cd01878204 cd01878, HflX, HflX subfamily 8e-07
cd01876170 cd01876, YihA_EngB, The YihA (EngB) subfamily 1e-06
KOG0410410 KOG0410, KOG0410, KOG0410, Predicted GTP binding protei 9e-06
cd00154159 cd00154, Rab, Rab family 1e-05
cd01881176 cd01881, Obg_like, The Obg-like subfamily consists of f 2e-05
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G prote 4e-05
COG1084346 COG1084, COG1084, Predicted GTPase [General function pr 4e-05
COG0218200 COG0218, COG0218, Predicted GTPase [General function pr 4e-05
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 0.001
cd01897168 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein p 0.002
pfam10396114 pfam10396, TrmE_N, GTP-binding protein TrmE N-terminus 3e-42
pfam01926106 pfam01926, MMR_HSR1, GTPase of unknown function 8e-20
cd01895174 cd01895, EngA2, EngA2 subfamily 1e-18
TIGR00231161 TIGR00231, small_GTP, small GTP-binding protein domain 1e-10
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 2e-08
PRK03003472 PRK03003, PRK03003, GTP-binding protein Der; Reviewed 6e-08
cd01855190 cd01855, YqeH, YqeH 9e-08
pfam03193161 pfam03193, DUF258, Protein of unknown function, DUF258 1e-07
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPa 2e-07
COG1161322 COG1161, COG1161, Predicted GTPases [General function p 5e-07
PRK00098298 PRK00098, PRK00098, GTPase RsgA; Reviewed 5e-07
TIGR03597360 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH 7e-07
pfam02421188 pfam02421, FeoB_N, Ferrous iron transport protein B 6e-06
cd01879158 cd01879, FeoB, Ferrous iron transport protein B (FeoB) 2e-05
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding 5e-05
PRK03003 472 PRK03003, PRK03003, GTP-binding protein Der; Reviewed 2e-04
PRK01889356 PRK01889, PRK01889, GTPase RsgA; Reviewed 2e-04
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provisional 2e-04
PRK13796365 PRK13796, PRK13796, GTPase YqeH; Provisional 2e-04
KOG1423379 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cy 3e-04
KOG2485335 KOG2485, KOG2485, KOG2485, Conserved ATP/GTP binding pr 3e-04
TIGR00436270 TIGR00436, era, GTP-binding protein Era 3e-04
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 4e-04
cd04178172 cd04178, Nucleostemin_like, Nucleostemin-like 0.002
pfam08477118 pfam08477, Miro, Miro-like protein 0.002
KOG2423572 KOG2423, KOG2423, KOG2423, Nucleolar GTPase [General fu 0.003
cd01857141 cd01857, HSR1_MMR1, HSR1/MMR1 0.004
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [Inorgan 1e-08
cd01854287 cd01854, YjeQ_engC, YjeQ/EngC 1e-08
COG1162301 COG1162, COG1162, Predicted GTPases [General function p 1e-07
cd01856171 cd01856, YlqF, YlqF 3e-07
COG3596296 COG3596, COG3596, Predicted GTPase [General function pr 3e-06
cd01849155 cd01849, YlqF_related_GTPase, YlqF-related GTPases 7e-05
TIGR00157245 TIGR00157, TIGR00157, ribosome small subunit-dependent 6e-04
PRK09518 712 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPa 2e-06
>gnl|CDD|179996 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|36405 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161885 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|30833 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133364 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133256 cd00880, Era_like, Era (E Back     alignment and domain information
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|133363 cd04163, Era, Era subfamily Back     alignment and domain information
>gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|133258 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|133279 cd01878, HflX, HflX subfamily Back     alignment and domain information
>gnl|CDD|133278 cd01876, YihA_EngB, The YihA (EngB) subfamily Back     alignment and domain information
>gnl|CDD|35631 KOG0410, KOG0410, KOG0410, Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|133250 cd00154, Rab, Rab family Back     alignment and domain information
>gnl|CDD|133281 cd01881, Obg_like, The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|31281 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|30567 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|179035 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|133297 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>gnl|CDD|150979 pfam10396, TrmE_N, GTP-binding protein TrmE N-terminus Back     alignment and domain information
>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function Back     alignment and domain information
>gnl|CDD|133295 cd01895, EngA2, EngA2 subfamily Back     alignment and domain information
>gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|161878 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|57926 cd01855, YqeH, YqeH Back     alignment and domain information
>gnl|CDD|146027 pfam03193, DUF258, Protein of unknown function, DUF258 Back     alignment and domain information
>gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|31355 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|178861 PRK00098, PRK00098, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|132636 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH Back     alignment and domain information
>gnl|CDD|145523 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|133280 cd01879, FeoB, Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>gnl|CDD|163345 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|179346 PRK01889, PRK01889, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184332 PRK13796, PRK13796, GTPase YqeH; Provisional Back     alignment and domain information
>gnl|CDD|36637 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|37696 KOG2485, KOG2485, KOG2485, Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|181957 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|57931 cd04178, Nucleostemin_like, Nucleostemin-like Back     alignment and domain information
>gnl|CDD|149505 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|37634 KOG2423, KOG2423, KOG2423, Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|57928 cd01857, HSR1_MMR1, HSR1/MMR1 Back     alignment and domain information
>gnl|CDD|30719 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|57925 cd01854, YjeQ_engC, YjeQ/EngC Back     alignment and domain information
>gnl|CDD|31356 COG1162, COG1162, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|57927 cd01856, YlqF, YlqF Back     alignment and domain information
>gnl|CDD|33396 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|57924 cd01849, YlqF_related_GTPase, YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|161735 TIGR00157, TIGR00157, ribosome small subunit-dependent GTPase A Back     alignment and domain information
>gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 440 tRNA modification GTPase TrmE [Candidatus Liberibacter
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 100.0
COG0486454 ThdF Predicted GTPase [General function prediction only 100.0
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 100.0
KOG1191531 consensus 100.0
pfam10396114 TrmE_N GTP-binding protein TrmE N-terminus. This family 100.0
PRK00389362 gcvT glycine cleavage system aminomethyltransferase T; 96.54
COG0404379 GcvT Glycine cleavage system T protein (aminomethyltran 95.85
pfam01571212 GCV_T Aminomethyltransferase folate-binding domain. Thi 95.39
PRK12486367 dmdA putative dimethyl sulfoniopropionate demethylase; 95.09
PRK00389362 gcvT glycine cleavage system aminomethyltransferase T; 95.01
COG0404379 GcvT Glycine cleavage system T protein (aminomethyltran 94.03
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 100.0
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 100.0
PRK00093438 engA GTP-binding protein EngA; Reviewed 100.0
PRK03003474 engA GTP-binding protein EngA; Reviewed 100.0
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 100.0
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 100.0
PRK00093 438 engA GTP-binding protein EngA; Reviewed 100.0
PRK00089296 era GTP-binding protein Era; Reviewed 100.0
PRK03003 474 engA GTP-binding protein EngA; Reviewed 100.0
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 100.0
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 99.98
COG1160444 Predicted GTPases [General function prediction only] 99.97
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 99.97
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.97
COG1160 444 Predicted GTPases [General function prediction only] 99.97
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 99.96
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 99.96
COG1159298 Era GTPase [General function prediction only] 99.95
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 99.95
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 99.95
PRK00454196 engB GTPase EngB; Reviewed 99.95
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 99.94
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 99.94
cd01896233 DRG The developmentally regulated GTP-binding protein ( 99.93
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 99.93
PRK04213195 GTP-binding protein; Provisional 99.92
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 99.87
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.87
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 99.87
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 99.84
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic ion tra 99.84
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 99.83
PRK12299334 obgE GTPase ObgE; Reviewed 99.82
KOG1423379 consensus 99.8
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 99.8
cd00881189 GTP_translation_factor GTP translation factor family. T 99.77
PRK12298380 obgE GTPase ObgE; Reviewed 99.75
PRK12297429 obgE GTPase ObgE; Reviewed 99.73
COG1163365 DRG Predicted GTPase [General function prediction only] 99.72
PRK12296495 obgE GTPase ObgE; Reviewed 99.71
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 99.7
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.66
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.66
KOG1489366 consensus 99.65
COG0218200 Predicted GTPase [General function prediction only] 99.65
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 99.6
COG0536369 Obg Predicted GTPase [General function prediction only] 99.59
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 99.59
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 99.55
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 99.54
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 99.54
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 99.54
PTZ00133182 ADP-ribosylation factor; Provisional 99.53
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 99.52
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 99.52
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 99.52
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 99.51
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 99.51
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 99.5
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 99.5
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 99.49
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 99.48
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 99.48
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 99.48
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 99.47
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 99.47
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 99.46
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 99.46
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 99.46
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 99.45
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 99.44
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 99.44
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 99.44
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 99.44
KOG1490 620 consensus 99.44
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 99.44
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 99.43
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 99.43
cd04123162 Rab21 Rab21 subfamily. The localization and function of 99.43
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 99.43
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 99.43
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 99.43
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 99.42
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 99.42
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 99.42
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras- 99.42
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 99.42
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 99.42
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 99.42
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 99.42
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 99.41
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 99.41
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein on ch 99.41
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 99.41
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 99.41
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 99.41
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 99.41
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 99.41
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 99.41
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 99.41
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 99.41
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 99.4
COG3596296 Predicted GTPase [General function prediction only] 99.4
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 99.4
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 99.4
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 99.4
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 99.4
PTZ00132209 GTP-binding nuclear protein; Provisional 99.4
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 99.39
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 99.39
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 99.39
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 99.39
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 99.39
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.38
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 99.38
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 99.38
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 99.37
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 99.37
cd04143247 Rhes_like Rhes_like subfamily. This subfamily includes 99.36
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 99.36
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 99.36
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 99.35
cd04109215 Rab28 Rab28 subfamily. First identified in maize, Rab28 99.35
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 99.35
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 99.34
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 99.34
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 99.33
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 99.33
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 99.33
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 99.33
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 99.33
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 99.32
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 99.32
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab prot 99.31
PRK12312 610 infB translation initiation factor IF-2; Provisional 99.31
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 99.3
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 99.29
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase tha 99.28
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 99.28
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 99.26
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 99.26
TIGR00436278 era GTP-binding protein Era; InterPro: IPR005662 Era is 99.24
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 99.23
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 99.22
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (alpha, 99.21
PRK05306 839 infB translation initiation factor IF-2; Validated 99.21
CHL00189 770 infB translation initiation factor 2; Provisional 99.19
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I 99.18
KOG1486364 consensus 99.15
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 99.14
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 99.14
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 99.14
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.13
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 99.12
PRK05433 601 GTP-binding protein LepA; Provisional 99.11
PRK04004 592 translation initiation factor IF-2; Validated 99.03
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB subfamil 99.02
KOG0462 650 consensus 99.0
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-envelope 98.97
KOG0078207 consensus 98.93
KOG0092200 consensus 98.9
TIGR00475 627 selB selenocysteine-specific translation elongation fac 98.9
PRK10218 607 GTP-binding protein; Provisional 98.87
KOG1145 683 consensus 98.86
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 98.85
KOG0073185 consensus 98.82
KOG0084205 consensus 98.81
cd04105203 SR_beta Signal recognition particle receptor, beta subu 98.81
KOG0094221 consensus 98.79
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesis, ou 98.78
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 98.77
PRK04000 410 translation initiation factor IF-2 subunit gamma; Valid 98.76
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase) [Tr 98.73
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 98.69
KOG0395196 consensus 98.65
TIGR01394 609 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298 98.64
PRK05124 475 cysN sulfate adenylyltransferase subunit 1; Provisional 98.61
PRK05506 613 bifunctional sulfate adenylyltransferase subunit 1/aden 98.61
KOG0394210 consensus 98.59
KOG2486320 consensus 98.58
COG1217 603 TypA Predicted membrane GTPase involved in stress respo 98.51
KOG0098216 consensus 98.51
COG3276 447 SelB Selenocysteine-specific translation elongation fac 98.47
KOG0070181 consensus 98.47
KOG0075186 consensus 98.42
KOG1707625 consensus 98.4
KOG1487358 consensus 98.34
PTZ00327 460 eukaryotic translation initiation factor 2 gamma subuni 98.34
KOG0458 603 consensus 98.32
KOG0087222 consensus 98.25
KOG0080209 consensus 98.23
COG2229187 Predicted GTPase [General function prediction only] 98.21
KOG0079198 consensus 98.19
KOG0076197 consensus 98.18
KOG3883198 consensus 98.07
TIGR02034 411 CysN sulfate adenylyltransferase, large subunit; InterP 98.05
KOG0091213 consensus 98.02
KOG0077193 consensus 98.0
KOG0093193 consensus 97.98
KOG0088218 consensus 97.92
COG4917148 EutP Ethanolamine utilization protein [Amino acid trans 97.91
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 97.91
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 97.85
KOG1144 1064 consensus 97.8
KOG0461 522 consensus 97.76
KOG0095213 consensus 97.74
KOG0086214 consensus 97.74
COG5257 415 GCD11 Translation initiation factor 2, gamma subunit (e 97.68
KOG1707 625 consensus 97.68
COG2895 431 CysN GTPases - Sulfate adenylate transferase subunit 1 97.63
TIGR00483 445 EF-1_alpha translation elongation factor EF-1, subunit 97.58
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 97.58
TIGR00487 594 IF-2 translation initiation factor IF-2; InterPro: IPR0 97.54
KOG0074185 consensus 97.4
KOG1532366 consensus 97.38
KOG3886295 consensus 97.14
KOG0097215 consensus 97.05
KOG0090238 consensus 97.0
KOG0071180 consensus 96.88
COG5258 527 GTPBP1 GTPase [General function prediction only] 96.77
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 96.29
KOG0083192 consensus 95.64
KOG0081219 consensus 95.28
KOG0096216 consensus 95.1
KOG1673205 consensus 95.01
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 100.0
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 99.94
COG2262411 HflX GTPases [General function prediction only] 99.91
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 99.98
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 99.2
PRK09435325 arginine/ornithine transport system ATPase; Provisional 99.13
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 98.66
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.55
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 97.49
PRK10790593 putative multidrug transporter membrane\ATP-binding com 97.48
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 97.47
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 97.27
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 96.76
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 96.59
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 96.5
COG4987573 CydC ABC-type transport system involved in cytochrome b 95.91
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 95.0
PRK11058426 putative GTPase HflX; Provisional 99.93
COG1084346 Predicted GTPase [General function prediction only] 99.85
KOG0410410 consensus 99.74
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 97.2
pfam01926106 MMR_HSR1 GTPase of unknown function. 99.74
TIGR02729296 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014 99.65
COG0012 372 Predicted GTPase, probable translation factor [Translat 99.47
PRK09601 364 translation-associated GTPase; Reviewed 99.46
PRK09602 396 translation-associated GTPase; Reviewed 99.42
cd01900274 YchF YchF subfamily. YchF is a member of the Obg family 99.35
PTZ00258 392 GTP-binding protein; Provisional 99.33
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg-like 99.23
KOG1491 391 consensus 99.04
pfam00350168 Dynamin_N Dynamin family. 99.01
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 99.01
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 98.99
COG1100219 GTPase SAR1 and related small G proteins [General funct 98.94
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 98.94
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 98.91
PRK12317 426 elongation factor 1-alpha; Reviewed 98.88
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 98.84
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 98.84
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 98.79
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 98.78
pfam04548200 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to b 98.78
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 98.78
PTZ00141 443 elongation factor 1 alpha; Provisional 98.78
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 98.76
PRK12736 394 elongation factor Tu; Reviewed 98.75
PRK12735 396 elongation factor Tu; Reviewed 98.75
PRK00741 526 prfC peptide chain release factor 3; Provisional 98.73
PTZ00336 449 elongation factor 1-alpha; Provisional 98.72
PRK00049 397 elongation factor Tu; Reviewed 98.7
PRK13351 687 elongation factor G; Reviewed 98.68
PRK12739 693 elongation factor G; Reviewed 98.63
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 98.6
CHL00071 409 tufA elongation factor Tu 98.59
PRK07560 730 elongation factor EF-2; Reviewed 98.57
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 98.48
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 98.47
KOG0448 749 consensus 98.47
PRK13768253 GTPase; Provisional 98.43
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 98.4
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 98.29
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represents Ara 98.25
pfam05049 375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 98.23
cd03114148 ArgK-like The function of this protein family is unkown 98.22
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 98.12
COG5019373 CDC3 Septin family protein [Cell division and chromosom 98.09
TIGR00993 772 3a0901s04IAP86 chloroplast protein import component Toc 98.06
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 98.05
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 97.97
pfam04670230 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 wa 97.92
KOG2655366 consensus 97.84
KOG1954 532 consensus 97.75
COG4108 528 PrfC Peptide chain release factor RF-3 [Translation, ri 97.65
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate vesicl 97.64
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.62
COG0480 697 FusA Translation elongation factors (GTPases) [Translat 97.62
KOG0447 980 consensus 97.57
KOG4252246 consensus 97.54
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.44
KOG1547336 consensus 97.34
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.25
TIGR00503 530 prfC peptide chain release factor 3; InterPro: IPR00454 97.24
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.11
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 97.04
KOG0468 971 consensus 97.02
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 96.97
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.82
KOG0467 887 consensus 96.79
PRK10416499 cell division protein FtsY; Provisional 96.79
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.7
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.64
KOG0393198 consensus 96.63
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.62
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.59
KOG3859 406 consensus 96.53
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 96.4
PRK11537317 putative GTP-binding protein YjiA; Provisional 95.95
TIGR00101199 ureG urease accessory protein UreG; InterPro: IPR004400 95.84
COG0050 394 TufB GTPases - translation elongation factors [Translat 95.71
KOG0446 657 consensus 94.41
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 94.4
KOG1533290 consensus 94.36
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 94.13
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 99.72
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protein gen 99.68
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 99.67
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 99.64
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to the hu 99.59
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 99.56
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin (NS) 99.55
PRK09563282 rbgA ribosomal biogenesis GTPase; Reviewed 99.53
COG1161322 Predicted GTPases [General function prediction only] 99.45
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protein. De 99.39
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 99.25
PRK13796367 GTP-binding protein YqeH; Provisional 99.2
KOG1424562 consensus 99.07
TIGR00650123 MG442 GTP-binding conserved hypothetical protein; Inter 98.95
KOG2484435 consensus 98.91
KOG2485335 consensus 98.84
KOG2423572 consensus 98.79
COG1162301 Predicted GTPases [General function prediction only] 98.5
PRK01889353 ribosome-associated GTPase; Reviewed 98.47
pfam03193161 DUF258 Protein of unknown function, DUF258. 98.35
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 98.35
PRK00098298 ribosome-associated GTPase; Reviewed 98.34
PRK12288344 ribosome-associated GTPase; Reviewed 98.25
PRK12289351 ribosome-associated GTPase; Reviewed 98.23
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.35
KOG1191 531 consensus 97.27
PRK10789569 putative multidrug transporter membrane\ATP-binding com 97.24
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 97.2
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 96.99
PRK00300208 gmk guanylate kinase; Provisional 96.96
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 96.91
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 96.86
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 96.86
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal domain. 96.83
pfam00493327 MCM MCM2/3/5 family. 96.76
PRK10522547 multidrug transporter membrane component/ATP-binding co 96.68
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.57
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 96.5
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 96.48
pfam00625182 Guanylate_kin Guanylate kinase. 96.4
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 96.4
KOG1249 572 consensus 96.34
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 96.14
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 96.11
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 96.1
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 96.07
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 95.98
KOG0065 1391 consensus 95.94
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.9
COG1241 682 MCM2 Predicted ATPase involved in replication control, 95.87
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 95.86
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.82
KOG00541381 consensus 95.6
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.55
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 95.51
cd03112158 CobW_like The function of this protein family is unkown 95.45
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.33
pfam02263264 GBP Guanylate-binding protein, N-terminal domain. Trans 95.05
KOG1249572 consensus 95.01
cd03234226 ABCG_White The White subfamily represents ABC transport 94.9
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 94.86
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 94.68
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 94.66
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 94.57
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 94.5
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 94.49
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 94.44
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 94.4
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 94.38
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 94.24
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 94.2
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 94.18
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 94.17
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 94.17
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 94.09
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 94.08
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 94.04
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 94.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 93.99
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 93.92
TIGR00092 390 TIGR00092 GTP-binding protein YchF; InterPro: IPR004396 99.14
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.94
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 96.41
PRK00007 693 elongation factor G; Reviewed 98.48
PRK12740 670 elongation factor G; Reviewed 98.19
PTZ00243 1560 ABC transporter; Provisional 97.01
KOG0054 1381 consensus 96.78
COG4988559 CydD ABC-type transport system involved in cytochrome b 96.57
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 96.01
pfam05783 490 DLIC Dynein light intermediate chain (DLIC). This famil 95.99
PRK13695174 putative NTPase; Provisional 95.88
KOG3905 473 consensus 95.69
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 95.63
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 95.44
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.4
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.07
KOG2743 391 consensus 95.01
PTZ002651467 multidrug resistance protein (mdr1); Provisional 94.95
PRK13900332 type IV secretion system ATPase VirB11; Provisional 94.86
KOG0057591 consensus 94.74
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 94.72
COG4178604 ABC-type uncharacterized transport system, permease and 94.43
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 94.37
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 94.27
PRK13851343 type IV secretion system protein VirB11; Provisional 94.27
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 94.16
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 94.1
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 94.1
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 94.08
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 94.08
KOG0055 1228 consensus 94.03
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 93.94
PRK09984262 phosphonate/organophosphate ester transporter subunit; 93.93
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 93.88
PTZ00099176 rab6; Provisional 98.44
KOG0072182 consensus 97.03
pfam00503350 G-alpha G-protein alpha subunit. G proteins couple rece 95.53
cd00066317 G-alpha G protein alpha subunit. The alpha subunit of G 95.24
smart00275342 G_alpha G protein alpha subunit. Subunit of G proteins 94.94
KOG2423 572 consensus 94.5
KOG0082354 consensus 94.03
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 98.25
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 98.04
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 97.87
PRK09563282 rbgA ribosomal biogenesis GTPase; Reviewed 97.78
PRK13796 367 GTP-binding protein YqeH; Provisional 97.65
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 97.59
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protein. De 97.41
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protein gen 97.16
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 97.07
PRK12289351 ribosome-associated GTPase; Reviewed 95.47
PRK12288344 ribosome-associated GTPase; Reviewed 95.16
PRK00098298 ribosome-associated GTPase; Reviewed 94.93
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 94.76
PRK01889353 ribosome-associated GTPase; Reviewed 94.44
TIGR00491 1145 aIF-2 translation initiation factor aIF-2; InterPro: IP 98.17
PRK09866 742 hypothetical protein; Provisional 97.6
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to the hu 96.51
cd03110179 Fer4_NifH_child This protein family's function is unkow 94.97
pfam0685858 NOG1 Nucleolar GTP-binding protein 1 (NOG1). This famil 94.16
COG3523 1188 IcmF Type VI protein secretion system component VasK [I 97.31
PRK00771433 signal recognition particle protein Srp54; Provisional 96.95
PRK10867453 signal recognition particle protein; Provisional 96.93
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t