254780813

254780813

Maf-like protein

GeneID in NCBI database:8209819Locus tag:CLIBASIA_03520
Protein GI in NCBI database:254780813Protein Accession:YP_003065226.1
Gene range:-(441888, 442487)Protein Length:199aa
Gene description:Maf-like protein
COG prediction:[D] Nucleotide-binding protein implicated in inhibition of septum formation
KEGG prediction:Maf-like protein; K06287 septum formation protein
SEED prediction:Maf/YceF/YhdE family protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVID
ccccEEEEcccHHHHHHHHHcccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcEEEEEccEEccccccHHHHHHHHHHHcccEEEEEEEEEEEEcccEEEEEEEEEEEEEEcccHHHHHHHHHccccccccccccEEEcccHHHHHHEEccccccEEcccHHHHHHHHHHccccc
ccccEEEccccHHHHHHHHHcccccEEEcccccccccccHccccccccHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEcccEccccccHHHHHHHHHHHcccEEEEEEEEEEEcccccEEEEEEEEEEEEEcccHHHHHHHHHHcccccccccccHHccccHHEEEEEEccccccEccccHHHHHHHHHHccccc
MIKNIILASSSLSRRKLLQnsgiqfsvvkpnideremekkmdfserkrPEKIALILAEKKALevsnrypesfvigcdqtmslgssiyhkpvDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIkgsyfsivgLPIIELIndlkiekvid
MIKNIILASSSLSRRKLlqnsgiqfsvvkpnideremekkmdfserkrpeKIALILAekkalevsnrYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIelindlkiekvid
MIKNIIlassslsrrkllQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVID
MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKM**SERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVID
MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREME*********RPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVID
***NIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVID
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVID
MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVID
MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVID

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target199 Maf-like protein [Candidatus Liberibacter asiaticus str
254780438261 pyridoxine 5'-phosphate synthase [Candidatus Liber 0.046
>gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Back     alignment
 Score = 29.3 bits (64), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 46/127 (36%), Gaps = 27/127 (21%)

Query: 24  QFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLG 83
           QF   + NI+    E  ++  ER +PE+I L+  +   L   + +               
Sbjct: 67  QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGW--------------- 111

Query: 84  SSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIK 143
                   D L+ +  L +   + H + S   L  +G    H +  A+LT      + I+
Sbjct: 112 --------DFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT----GADCIE 159

Query: 144 FYLNKIG 150
            Y    G
Sbjct: 160 LYTGPYG 166

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target199 Maf-like protein [Candidatus Liberibacter asiaticus str
315122036202 Maf-like protein [Candidatus Liberibacter solanacearum 1 3e-81
222087933199 septum formation protein [Agrobacterium radiobacter K84 1 1e-49
159184119199 Maf-like protein [Agrobacterium tumefaciens str. C58] L 1 2e-49
209551507199 Maf-like protein [Rhizobium leguminosarum bv. trifolii 1 5e-49
153008188199 Maf-like protein [Ochrobactrum anthropi ATCC 49188] Len 1 6e-49
239833109198 septum formation protein Maf [Ochrobactrum intermedium 1 1e-47
150398402199 Maf-like protein [Sinorhizobium medicae WSM419] Length 1 2e-47
110635807202 Maf-like protein [Mesorhizobium sp. BNC1] Length = 202 1 2e-47
114707821199 Maf-like protein [Fulvimarina pelagi HTCC2506] Length = 1 2e-47
306842816199 septum formation protein Maf [Brucella sp. BO2] Length 1 3e-47
>gi|315122036|ref|YP_004062525.1| Maf-like protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 202 Back     alignment and organism information
 Score =  304 bits (779), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 168/186 (90%)

Query: 14  RRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFV 73
           R+ +++NSGI FSVVKP IDER++EK ++ S +K  EKIALILAEKKALEVS+RYP+S V
Sbjct: 14  RKMIMKNSGIHFSVVKPEIDERKIEKDLEISHKKNSEKIALILAEKKALEVSSRYPQSIV 73

Query: 74  IGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLT 133
           IGCDQTMSLG+ IYHKP+DM EAEKNLL++SGKKHRI SAYVLV+NGK+L HHISVAQLT
Sbjct: 74  IGCDQTMSLGNVIYHKPIDMKEAEKNLLQLSGKKHRIGSAYVLVKNGKILHHHISVAQLT 133

Query: 134 MYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLK 193
           MYK S+EFIKFYL KIGKKALLSVGSYQIDK+GIQLFSSIKGSYF++VGLPI ELINDLK
Sbjct: 134 MYKFSQEFIKFYLKKIGKKALLSVGSYQIDKDGIQLFSSIKGSYFAVVGLPITELINDLK 193

Query: 194 IEKVID 199
            EK ID
Sbjct: 194 KEKAID 199


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087933|ref|YP_002542728.1| septum formation protein [Agrobacterium radiobacter K84] Length = 199 Back     alignment and organism information
>gi|159184119|ref|NP_353042.2| Maf-like protein [Agrobacterium tumefaciens str. C58] Length = 199 Back     alignment and organism information
>gi|209551507|ref|YP_002283424.1| Maf-like protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 199 Back     alignment and organism information
>gi|153008188|ref|YP_001369403.1| Maf-like protein [Ochrobactrum anthropi ATCC 49188] Length = 199 Back     alignment and organism information
>gi|239833109|ref|ZP_04681438.1| septum formation protein Maf [Ochrobactrum intermedium LMG 3301] Length = 198 Back     alignment and organism information
>gi|150398402|ref|YP_001328869.1| Maf-like protein [Sinorhizobium medicae WSM419] Length = 199 Back     alignment and organism information
>gi|110635807|ref|YP_676015.1| Maf-like protein [Mesorhizobium sp. BNC1] Length = 202 Back     alignment and organism information
>gi|114707821|ref|ZP_01440715.1| Maf-like protein [Fulvimarina pelagi HTCC2506] Length = 199 Back     alignment and organism information
>gi|306842816|ref|ZP_07475456.1| septum formation protein Maf [Brucella sp. BO2] Length = 199 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target199 Maf-like protein [Candidatus Liberibacter asiaticus str
PRK02478199 PRK02478, PRK02478, Maf-like protein; Reviewed 4e-66
cd00555180 cd00555, Maf, Nucleotide binding protein Maf 4e-41
PRK00648191 PRK00648, PRK00648, Maf-like protein; Reviewed 1e-24
pfam02545193 pfam02545, Maf, Maf-like protein 4e-24
PRK00148194 PRK00148, PRK00148, Maf-like protein; Reviewed 1e-22
PRK14368193 PRK14368, PRK14368, Maf-like protein; Provisional 1e-20
PRK14362207 PRK14362, PRK14362, Maf-like protein; Provisional 2e-20
TIGR00172183 TIGR00172, maf, MAF protein 8e-20
PRK14361187 PRK14361, PRK14361, Maf-like protein; Provisional 3e-19
PRK14366195 PRK14366, PRK14366, Maf-like protein; Provisional 1e-17
PRK00884194 PRK00884, PRK00884, Maf-like protein; Reviewed 1e-17
PRK04694190 PRK04694, PRK04694, Maf-like protein; Reviewed 7e-17
PRK00032190 PRK00032, PRK00032, Maf-like protein; Reviewed 8e-17
PRK00234192 PRK00234, PRK00234, Maf-like protein; Reviewed 9e-17
PRK14363204 PRK14363, PRK14363, Maf-like protein; Provisional 4e-16
PRK04425196 PRK04425, PRK04425, Maf-like protein; Reviewed 8e-16
PRK00078192 PRK00078, PRK00078, Maf-like protein; Reviewed 6e-15
KOG1509209 KOG1509, KOG1509, KOG1509, Predicted nucleic acid-bindi 9e-15
PRK01839209 PRK01839, PRK01839, Maf-like protein; Reviewed 1e-14
PRK02141207 PRK02141, PRK02141, Maf-like protein; Reviewed 2e-14
PRK14364181 PRK14364, PRK14364, Maf-like protein; Provisional 2e-14
PRK14365197 PRK14365, PRK14365, Maf-like protein; Provisional 5e-14
PRK01526205 PRK01526, PRK01526, Maf-like protein; Reviewed 6e-13
PRK01441207 PRK01441, PRK01441, Maf-like protein; Reviewed 9e-11
PRK14367202 PRK14367, PRK14367, Maf-like protein; Provisional 5e-09
COG0424193 COG0424, Maf, Nucleotide-binding protein implicated in 2e-41
cd00985131 cd00985, Maf_Ham1, Maf_Ham1 7e-19
PRK04056180 PRK04056, PRK04056, Maf-like protein; Reviewed 0.003
>gnl|CDD|167380 PRK02478, PRK02478, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|29954 cd00555, Maf, Nucleotide binding protein Maf Back     alignment and domain information
>gnl|CDD|179081 PRK00648, PRK00648, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|111445 pfam02545, Maf, Maf-like protein Back     alignment and domain information
>gnl|CDD|178901 PRK00148, PRK00148, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|172844 PRK14368, PRK14368, Maf-like protein; Provisional Back     alignment and domain information
>gnl|CDD|172838 PRK14362, PRK14362, Maf-like protein; Provisional Back     alignment and domain information
>gnl|CDD|129276 TIGR00172, maf, MAF protein Back     alignment and domain information
>gnl|CDD|172837 PRK14361, PRK14361, Maf-like protein; Provisional Back     alignment and domain information
>gnl|CDD|172842 PRK14366, PRK14366, Maf-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179153 PRK00884, PRK00884, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|179873 PRK04694, PRK04694, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|178808 PRK00032, PRK00032, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|166864 PRK00234, PRK00234, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|184647 PRK14363, PRK14363, Maf-like protein; Provisional Back     alignment and domain information
>gnl|CDD|167814 PRK04425, PRK04425, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|178846 PRK00078, PRK00078, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|36722 KOG1509, KOG1509, KOG1509, Predicted nucleic acid-binding protein ASMTL [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|179341 PRK01839, PRK01839, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|179378 PRK02141, PRK02141, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|184648 PRK14364, PRK14364, Maf-like protein; Provisional Back     alignment and domain information
>gnl|CDD|184649 PRK14365, PRK14365, Maf-like protein; Provisional Back     alignment and domain information
>gnl|CDD|167235 PRK01526, PRK01526, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|167232 PRK01441, PRK01441, Maf-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|172843 PRK14367, PRK14367, Maf-like protein; Provisional Back     alignment and domain information
>gnl|CDD|30773 COG0424, Maf, Nucleotide-binding protein implicated in inhibition of septum formation [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|73242 cd00985, Maf_Ham1, Maf_Ham1 Back     alignment and domain information
>gnl|CDD|179732 PRK04056, PRK04056, Maf-like protein; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 199 Maf-like protein [Candidatus Liberibacter asiaticus str
PRK02478199 Maf-like protein; Reviewed 100.0
COG0424193 Maf Nucleotide-binding protein implicated in inhibition 100.0
PRK00148195 Maf-like protein; Reviewed 100.0
PRK04222191 consensus 100.0
PRK02676196 consensus 100.0
PRK03411194 consensus 100.0
PRK00884194 Maf-like protein; Reviewed 100.0
PRK00032189 Maf-like protein; Reviewed 100.0
PRK00234192 Maf-like protein; Reviewed 100.0
PRK04425196 Maf-like protein; Reviewed 100.0
PRK03442213 consensus 100.0
PRK00238198 consensus 100.0
PRK03415197 consensus 100.0
PRK01839209 Maf-like protein; Reviewed 100.0
PRK00648191 Maf-like protein; Reviewed 100.0
PRK02141206 Maf-like protein; Reviewed 100.0
PRK01441207 Maf-like protein; Reviewed 100.0
PRK03098185 consensus 100.0
PRK00078192 Maf-like protein; Reviewed 100.0
PRK04694190 Maf-like protein; Reviewed 100.0
pfam02545193 Maf Maf-like protein. Maf is a putative inhibitor of se 100.0
PRK04719188 consensus 100.0
PRK01526205 Maf-like protein; Reviewed 100.0
cd00555180 Maf Nucleotide binding protein Maf. Maf has been implic 100.0
PRK04056180 Maf-like protein; Reviewed 100.0
PRK03797186 consensus 100.0
PRK01946195 consensus 100.0
TIGR00172212 maf septum formation protein Maf; InterPro: IPR003697 M 100.0
KOG1509209 consensus 100.0
cd00985131 Maf_Ham1 Maf_Ham1. Maf, a nucleotide binding protein, h 99.96
PRK00120197 putative deoxyribonucleotide triphosphate pyrophosphata 96.47
cd00515183 HAM1 NTPase/HAM1. This family consists of the HAM1 prot 95.33
>PRK02478 Maf-like protein; Reviewed Back     alignment and domain information
>COG0424 Maf Nucleotide-binding protein implicated in inhibition of septum formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00148 Maf-like protein; Reviewed Back     alignment and domain information
>PRK04222 consensus Back     alignment and domain information
>PRK02676 consensus Back     alignment and domain information
>PRK03411 consensus Back     alignment and domain information
>PRK00884 Maf-like protein; Reviewed Back     alignment and domain information
>PRK00032 Maf-like protein; Reviewed Back     alignment and domain information
>PRK00234 Maf-like protein; Reviewed Back     alignment and domain information
>PRK04425 Maf-like protein; Reviewed Back     alignment and domain information
>PRK03442 consensus Back     alignment and domain information
>PRK00238 consensus Back     alignment and domain information
>PRK03415 consensus Back     alignment and domain information
>PRK01839 Maf-like protein; Reviewed Back     alignment and domain information
>PRK00648 Maf-like protein; Reviewed Back     alignment and domain information
>PRK02141 Maf-like protein; Reviewed Back     alignment and domain information
>PRK01441 Maf-like protein; Reviewed Back     alignment and domain information
>PRK03098 consensus Back     alignment and domain information
>PRK00078 Maf-like protein; Reviewed Back     alignment and domain information
>PRK04694 Maf-like protein; Reviewed Back     alignment and domain information
>pfam02545 Maf Maf-like protein Back     alignment and domain information
>PRK04719 consensus Back     alignment and domain information
>PRK01526 Maf-like protein; Reviewed Back     alignment and domain information
>cd00555 Maf Nucleotide binding protein Maf Back     alignment and domain information
>PRK04056 Maf-like protein; Reviewed Back     alignment and domain information
>PRK03797 consensus Back     alignment and domain information
>PRK01946 consensus Back     alignment and domain information
>TIGR00172 maf septum formation protein Maf; InterPro: IPR003697 Maf is a putative inhibitor of septum formation in eukaryotes, bacteria, and archaea Back     alignment and domain information
>KOG1509 consensus Back     alignment and domain information
>cd00985 Maf_Ham1 Maf_Ham1 Back     alignment and domain information
>PRK00120 putative deoxyribonucleotide triphosphate pyrophosphatase; Reviewed Back     alignment and domain information
>cd00515 HAM1 NTPase/HAM1 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target199 Maf-like protein [Candidatus Liberibacter asiaticus str
1ex2_A189 Crystal Structure Of Bacillus Subtilis Maf Protein 6e-35
2p5x_A230 Crystal Structure Of Maf Domain Of Human N-Acetylse 2e-25
gi|9256957|pdb|1EX2|A Chain A, Crystal Structure Of Bacillus Subtilis Maf Protein Length = 189 Back     alignment and structure
 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 56/197 (28%), Positives = 95/197 (48%), Gaps = 10/197 (5%)

Query: 1   MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKK 60
           M K +ILAS S  R++LL    + +S++   ++E+        +    PE+    LA++K
Sbjct: 1   MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEK-------LNRNFSPEENVQWLAKQK 53

Query: 61  ALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNG 120
           A  V++ +P + VIG D  + L      KP D  EA   L R+SG+ H + +A  +    
Sbjct: 54  AKAVADLHPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAEN 113

Query: 121 KVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSI 180
                +    ++  + LSEE I  Y+    K+ +   G+Y I   G      I G Y+S+
Sbjct: 114 HSETFY-DKTEVAFWSLSEEEIWTYIET--KEPMDKAGAYGIQGRGALFVKKIDGDYYSV 170

Query: 181 VGLPIIELINDLKIEKV 197
           +GLPI + +  L+   +
Sbjct: 171 MGLPISKTMRALRHFDI 187


>gi|145580497|pdb|2P5X|A Chain A, Crystal Structure Of Maf Domain Of Human N-Acetylserotonin O-Methyltransferase-Like Protein Length = 230 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target199 Maf-like protein [Candidatus Liberibacter asiaticus str
1ex2_A189 Protein MAF; structural genomics, PSI, protein structur 6e-43
2p5x_A230 ASMTL, N-acetylserotonin O-methyltransferase-like prote 5e-31
2amh_A207 Septum formation protein MAF homologue, putative; domai 1e-26
>1ex2_A Protein MAF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SUC PO4; 1.85A {Bacillus subtilis} SCOP: c.51.4.2 PDB: 1exc_A* Length = 189 Back     alignment and structure
 Score =  168 bits (428), Expect = 6e-43
 Identities = 56/193 (29%), Positives = 93/193 (48%), Gaps = 10/193 (5%)

Query: 1   MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKK 60
           M K +ILAS S  R++LL    + +S++   ++E         +    PE+    LA++K
Sbjct: 1   MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEE-------KLNRNFSPEENVQWLAKQK 53

Query: 61  ALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNG 120
           A  V++ +P + VIG D  + L      KP D  EA   L R+SG+ H + +A  +    
Sbjct: 54  AKAVADLHPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAEN 113

Query: 121 KVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSI 180
                +    ++  + LSEE I  Y+    K+ +   G+Y I   G      I G Y+S+
Sbjct: 114 HSETFY-DKTEVAFWSLSEEEIWTYIET--KEPMDKAGAYGIQGRGALFVKKIDGDYYSV 170

Query: 181 VGLPIIELINDLK 193
           +GLPI + +  L+
Sbjct: 171 MGLPISKTMRALR 183


>2p5x_A ASMTL, N-acetylserotonin O-methyltransferase-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 2.00A {Homo sapiens} Length = 230 Back     alignment and structure
>2amh_A Septum formation protein MAF homologue, putative; domain alpha-beta motif, structural genomics, PSI, protein structure initiative; 2.00A {Trypanosoma brucei} SCOP: c.51.4.2 Length = 207 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target199 Maf-like protein [Candidatus Liberibacter asiaticus str
2p5x_A230 ASMTL, N-acetylserotonin O-methyltransferase-like prote 100.0
1ex2_A189 Protein MAF; structural genomics, PSI, protein structur 100.0
2amh_A207 Septum formation protein MAF homologue, putative; domai 100.0
1v7r_A186 Hypothetical protein PH1917; ntpase, structural genomic 92.2
1b78_A193 Pyrophosphatase; structural genomics, hyperthermal prot 90.57
>2p5x_A ASMTL, N-acetylserotonin O-methyltransferase-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 2.00A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=0  Score=392.79  Aligned_cols=191  Identities=29%  Similarity=0.468  Sum_probs=176.3

Q ss_pred             CCCCEEECCCCHHHHHHHHHCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC------CCCCCEE
Q ss_conf             9875474269989999999789885997589884324220134457998999888765433321013------7754034
Q gi|254780813|r    1 MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNR------YPESFVI   74 (199)
Q Consensus         1 m~~~iILAS~S~~R~~lL~~~gi~f~~~~~~iDE~~~~~~~~~~~~~~p~~~~~~lA~~Ka~~v~~~------~~~~~VI   74 (199)
                      |+++|||||+||||++||+++|++|++++|+|||++++.+     ..+|.+++.++|+.||.+++..      .++.+||
T Consensus         2 ~~krlILASsSprR~~lL~~~gi~f~v~~~~iDE~~~~~~-----~~~p~~~~~~lA~~KA~~v~~~~~~~~~~~~~iVI   76 (230)
T 2p5x_A            2 LHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKAS-----FATPYGYAMETAKQKALEVANRLYQKDLRAPDVVI   76 (230)
T ss_dssp             TTSCEEECCCCHHHHHHHHHTTCCCEECCCCCCCCCCGGG-----SSSHHHHHHHHHHHHHHHHHHHHHHHHSCCCSEEE
T ss_pred             CCCCEEEECCCHHHHHHHHHCCCCEEEECCCCCCCCCCCC-----CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             9898999548999999998389981995699899987545-----59868999999999878878776540378998899


Q ss_pred             CHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEEECCCCC-------CCEEEEEEEEEECCCCCHHHHHHHHH
Q ss_conf             13443101234467610013469999985198037888665303786-------10046874110012220578999996
Q gi|254780813|r   75 GCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGK-------VLRHHISVAQLTMYKLSEEFIKFYLN  147 (199)
Q Consensus        75 ~aDtvv~~~g~i~~KP~~~~eA~~~L~~lsg~~h~v~T~~~i~~~~~-------~~~~~~~~t~v~f~~l~~~~I~~Yi~  147 (199)
                      ||||||+++|+|+|||.|+++|++||+.|||++|.||||+|++..+.       .++.++++|+|+|+++++++|++||+
T Consensus        77 ~aDTvv~~~g~ilgKP~~~~eA~~~L~~lsGk~H~v~T~v~l~~~~~~~~~~~~~~~~~~~~t~V~f~~ls~~~I~~Yv~  156 (230)
T 2p5x_A           77 GADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAIVHCSSKDHQLDTRVSEFYEETKVKFSELSEELLWEYVH  156 (230)
T ss_dssp             EEEEEEEETTEEECCCSSHHHHHHHHHHHTTSEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEECCCCHHHHHHHHH
T ss_pred             ECCEEEEECCEEECCCCCHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEEEEEECCCCCHHHHHHHHH
T ss_conf             61849998999845889999999999985799569998899750798763100378889840089865676999999996


Q ss_pred             HCCCCCCCCCCEECCCCCHHHHHHEECCCCCCCCCCCHHHHHHHHHHCCCC
Q ss_conf             206886733210000122332100011897532227699999999978989
Q gi|254780813|r  148 KIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVI  198 (199)
Q Consensus       148 ~~~~~~~~~aG~y~ie~~g~~~i~~I~Gd~~~V~GLPi~~l~~~L~~~gii  198 (199)
                      +  ++|++|||||+|||.|..||++|+|||+||||||+.+|+++|++.|+.
T Consensus       157 ~--~e~~~kAG~Y~Ieg~g~~li~~IeG~~~nViGLPl~~l~~~L~~~g~~  205 (230)
T 2p5x_A          157 S--GEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVKLYYP  205 (230)
T ss_dssp             H--TGGGGSGGGCCSSSGGGGTEEEEEECHHHHHTCCHHHHHHHHHHHHC-
T ss_pred             C--CCCCCEEEEEEECCCHHHCEEEEECCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             5--983553789985306463555318997640176699999999976999



>1ex2_A Protein MAF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SUC PO4; 1.85A {Bacillus subtilis} SCOP: c.51.4.2 PDB: 1exc_A* Back     alignment and structure
>2amh_A Septum formation protein MAF homologue, putative; domain alpha-beta motif, structural genomics, PSI, protein structure initiative; 2.00A {Trypanosoma brucei} SCOP: c.51.4.2 Back     alignment and structure
>1v7r_A Hypothetical protein PH1917; ntpase, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; HET: CIT; 1.40A {Pyrococcus horikoshii OT3} SCOP: c.51.4.1 PDB: 2dvn_A* 2dvo_A* 2dvp_A 2ehk_A 2zti_A 2e5x_A* Back     alignment and structure
>1b78_A Pyrophosphatase; structural genomics, hyperthermal protein; 2.20A {Methanocaldococcus jannaschii} SCOP: c.51.4.1 PDB: 2mjp_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 199 Maf-like protein [Candidatus Liberibacter asiaticus str
d2amha1201 c.51.4.2 (A:7-207) Maf homologue Tb11.01.5890 {Trypanos 1e-23
d1ex2a_185 c.51.4.2 (A:) Maf protein {Bacillus subtilis [TaxId: 14 2e-23
>d2amha1 c.51.4.2 (A:7-207) Maf homologue Tb11.01.5890 {Trypanosoma brucei [TaxId: 5691]} Length = 201 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Anticodon-binding domain-like
superfamily: ITPase-like
family: Maf-like
domain: Maf homologue Tb11.01.5890
species: Trypanosoma brucei [TaxId: 5691]
 Score =  103 bits (257), Expect = 1e-23
 Identities = 32/199 (16%), Positives = 73/199 (36%), Gaps = 9/199 (4%)

Query: 2   IKNIILASSSLSRRKLLQNSG----IQFSVVKPNIDEREMEKKMDFSERKR-PEKIALIL 56
           I+ +I+ +SS  R  +L+         F ++ P+IDE+       F   +         +
Sbjct: 3   IRTMIIGTSSAFRANVLREHFGDRFRNFVLLPPDIDEKAYRAADPFELTESIARAKMKAV 62

Query: 57  AEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHR-ISSAYV 115
            EK           +  +  DQ +  G  +  KP+   +    +   SG   R +++  +
Sbjct: 63  LEKARQHSPPISGPAIALTFDQVVVKGDEVREKPLSTEQCRSFIASYSGGGVRTVATYAL 122

Query: 116 LVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLF-SSIK 174
            V   + +    +  +    K  ++ ++  L +     + S G   ++ E +      I 
Sbjct: 123 CVVGTENVLVAHNETETFFSKFGDDIVERTLERG--ACMNSAGGLVVEDEDMSRHVVRIV 180

Query: 175 GSYFSIVGLPIIELINDLK 193
           G+ + + G+    +   L 
Sbjct: 181 GTSYGVRGMEPAVVEKLLS 199


>d1ex2a_ c.51.4.2 (A:) Maf protein {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target199 Maf-like protein [Candidatus Liberibacter asiaticus str
d1ex2a_185 Maf protein {Bacillus subtilis [TaxId: 1423]} 100.0
d2amha1201 Maf homologue Tb11.01.5890 {Trypanosoma brucei [TaxId: 100.0
d2cara1194 Inosine triphosphate pyrophosphatase, ITPase {Human (Ho 91.63
d1v7ra_186 XTP pyrophosphatase {Archaeon Pyrococcus horikoshii [Ta 91.21
>d1ex2a_ c.51.4.2 (A:) Maf protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Anticodon-binding domain-like
superfamily: ITPase-like
family: Maf-like
domain: Maf protein
species: Bacillus subtilis [TaxId: 1423]
Probab=100.00  E-value=0  Score=391.55  Aligned_cols=185  Identities=30%  Similarity=0.476  Sum_probs=176.1

Q ss_pred             CCCCEEECCCCHHHHHHHHHCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEECHHHHH
Q ss_conf             98754742699899999997898859975898843242201344579989998887654333210137754034134431
Q gi|254780813|r    1 MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTM   80 (199)
Q Consensus         1 m~~~iILAS~S~~R~~lL~~~gi~f~~~~~~iDE~~~~~~~~~~~~~~p~~~~~~lA~~Ka~~v~~~~~~~~VI~aDtvv   80 (199)
                      |+++|||||+||||++||+++|++|+++||++||+..+.       .+|.+++.++|+.||++++..+|+.+||||||||
T Consensus         1 M~~~iILAS~SprR~~lL~~~gi~f~v~~~~idE~~~~~-------~~p~~~v~~lA~~KA~~v~~~~~~~~vi~aDtvv   73 (185)
T d1ex2a_           1 MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRN-------FSPEENVQWLAKQKAKAVADLHPHAIVIGADTMV   73 (185)
T ss_dssp             CCCCEEECCCCHHHHHHHHTTCCCCEECCCCCCCCCCTT-------SCHHHHHHHHHHHHHHHHHHHCTTSEEEEEEEEE
T ss_pred             CCCCEEEECCCHHHHHHHHHCCCCCEEECCCCCCCCCCC-------CCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEC
T ss_conf             999889977899999999868999899799988776779-------9979999999998898654030010121242110


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEEECCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHCCCCCCCCCCEE
Q ss_conf             01234467610013469999985198037888665303786100468741100122205789999962068867332100
Q gi|254780813|r   81 SLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSY  160 (199)
Q Consensus        81 ~~~g~i~~KP~~~~eA~~~L~~lsg~~h~v~T~~~i~~~~~~~~~~~~~t~v~f~~l~~~~I~~Yi~~~~~~~~~~aG~y  160 (199)
                      +++|+|+|||.|+++|++||+.|||++|.|+||+|+..+++ .+.++++|.|+|+++++++|++||++  ++|++|||||
T Consensus        74 ~~~~~i~~KP~~~~~A~~~L~~lsg~~h~v~T~v~v~~~~~-~~~~~~~t~v~f~~ls~~~I~~Yi~~--~e~~~kAG~y  150 (185)
T d1ex2a_          74 CLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENH-SETFYDKTEVAFWSLSEEEIWTYIET--KEPMDKAGAY  150 (185)
T ss_dssp             EETTEEECCCSSHHHHHHHHHHHTTSEEEEEEEEEEEETTE-EEEEEEEEEEEECCCCHHHHHHHHTT--TSGGGSTTSC
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCCC-CCEECCEEEEEECCCCHHHHHHHHCC--CCHHHHHHHE
T ss_conf             24654467521267789999985156662302322102333-30204147997057879999987502--1056541001


Q ss_pred             CCCCCHHHHHHEECCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             00122332100011897532227699999999978
Q gi|254780813|r  161 QIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIE  195 (199)
Q Consensus       161 ~ie~~g~~~i~~I~Gd~~~V~GLPi~~l~~~L~~~  195 (199)
                      +|||.|..||++|+|||+||||||+.+|+++|++|
T Consensus       151 ~ie~~g~~~i~~I~Gd~~~VvGLPl~~l~~~L~~f  185 (185)
T d1ex2a_         151 GIQGRGALFVKKIDGDYYSVMGLPISKTMRALRHF  185 (185)
T ss_dssp             CSSGGGGGTEEEEESCHHHHHTCCHHHHHHHHTTC
T ss_pred             EECCCHHHCEEEEECCCCCCCCCCHHHHHHHHHCC
T ss_conf             21455531864458895311188899999999649



>d2amha1 c.51.4.2 (A:7-207) Maf homologue Tb11.01.5890 {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2cara1 c.51.4.1 (A:1-194) Inosine triphosphate pyrophosphatase, ITPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7ra_ c.51.4.1 (A:) XTP pyrophosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 199 Maf-like protein [Candidatus Liberibacter asiaticu
1ex2_A_189 (A:) Protein MAF; structural genomics, PSI, protei 5e-39
2p5x_A_230 (A:) ASMTL, N-acetylserotonin O-methyltransferase- 2e-37
2amh_A_207 (A:) Septum formation protein MAF homologue, putat 9e-35
>1ex2_A (A:) Protein MAF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SUC PO4; 1.85A {Bacillus subtilis}Length = 189 Back     alignment and structure
 Score =  155 bits (392), Expect = 5e-39
 Identities = 56/193 (29%), Positives = 92/193 (47%), Gaps = 10/193 (5%)

Query: 1   MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKK 60
           M K +ILAS S  R++LL    + +S++   ++E+             PE+    LA++K
Sbjct: 1   MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFS-------PEENVQWLAKQK 53

Query: 61  ALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNG 120
           A  V++ +P + VIG D  + L      KP D  EA   L R+SG+ H + +A  +    
Sbjct: 54  AKAVADLHPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAEN 113

Query: 121 KVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSI 180
                     ++  + LSEE I  Y+    K+ +   G+Y I   G      I G Y+S+
Sbjct: 114 HS-ETFYDKTEVAFWSLSEEEIWTYIET--KEPMDKAGAYGIQGRGALFVKKIDGDYYSV 170

Query: 181 VGLPIIELINDLK 193
           +GLPI + +  L+
Sbjct: 171 MGLPISKTMRALR 183


>2p5x_A (A:) ASMTL, N-acetylserotonin O-methyltransferase-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 2.00A {Homo sapiens}Length = 230 Back     alignment and structure
>2amh_A (A:) Septum formation protein MAF homologue, putative; domain alpha-beta motif, structural genomics, PSI, protein structure initiative; 2.00A {Trypanosoma brucei}Length = 207 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target199 Maf-like protein [Candidatus Liberibacter asiaticus str
1ex2_A_189 Protein MAF; structural genomics, PSI, protein str 100.0
2p5x_A_230 ASMTL, N-acetylserotonin O-methyltransferase-like 100.0
2amh_A_207 Septum formation protein MAF homologue, putative; 100.0
1vp2_A_208 Putative xanthosine triphosphate pyrophosphatase/H 96.15
2car_A_196 Inosine triphosphate pyrophosphatase; hydrolase, i 96.14
1v7r_A_186 Hypothetical protein PH1917; ntpase, structural ge 95.74
1b78_A_193 Pyrophosphatase; structural genomics, hyperthermal 95.41
1k7k_A_221 Hypothetical protein YGGV; MAD, His-TAG, large gro 93.96
>1ex2_A (A:) Protein MAF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SUC PO4; 1.85A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=0  Score=403.80  Aligned_cols=188  Identities=30%  Similarity=0.470  Sum_probs=181.1

Q ss_pred             CCCCEEECCCCHHHHHHHHHCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEECHHHHH
Q ss_conf             98754742699899999997898859975898843242201344579989998887654333210137754034134431
Q gi|254780813|r    1 MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPESFVIGCDQTM   80 (199)
Q Consensus         1 m~~~iILAS~S~~R~~lL~~~gi~f~~~~~~iDE~~~~~~~~~~~~~~p~~~~~~lA~~Ka~~v~~~~~~~~VI~aDtvv   80 (199)
                      |.++|||||+||||++||+++|++|++++|++||++++.       .+|.+++.++|..||+++..++|+.+||||||||
T Consensus         1 M~~~iILaS~Sp~R~~lL~~~g~~f~v~~~~idE~~~~~-------~~p~~~~~~lA~~KA~~v~~~~~~~~iI~aDtvv   73 (189)
T 1ex2_A            1 MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRN-------FSPEENVQWLAKQKAKAVADLHPHAIVIGADTMV   73 (189)
T ss_dssp             CCCCEEECCCCHHHHHHHHTTCCCCEECCCCCCCCCCTT-------SCHHHHHHHHHHHHHHHHHHHCTTSEEEEEEEEE
T ss_pred             CCCCEEEECCCHHHHHHHHHCCCCEEEECCCCCCCCCCC-------CCHHHHHHHHHHHHHHHHHHHCCCCEEEEECEEE
T ss_conf             999999957999999999977998199679989899987-------9989999999999999999678998699727499


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEEECCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHCCCCCCCCCCEE
Q ss_conf             01234467610013469999985198037888665303786100468741100122205789999962068867332100
Q gi|254780813|r   81 SLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSY  160 (199)
Q Consensus        81 ~~~g~i~~KP~~~~eA~~~L~~lsg~~h~v~T~~~i~~~~~~~~~~~~~t~v~f~~l~~~~I~~Yi~~~~~~~~~~aG~y  160 (199)
                      +++|+|+|||.|.++|++||+.|||++|.||||+|++.+++ .+.++++|+|+|+++++++|++|+++  ++|++|||||
T Consensus        74 ~~~~~i~~KP~~~~eA~~~L~~lsg~~h~v~T~v~i~~~~~-~~~~~~~t~v~f~~l~~~~I~~Yl~~--~e~~~kAGay  150 (189)
T 1ex2_A           74 CLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENH-SETFYDKTEVAFWSLSEEEIWTYIET--KEPMDKAGAY  150 (189)
T ss_dssp             EETTEEECCCSSHHHHHHHHHHHTTSEEEEEEEEEEEETTE-EEEEEEEEEEEECCCCHHHHHHHHTT--TSGGGSTTSC
T ss_pred             EECCEEECCCCCHHHHHHHHHHHCCCCEEEEEEEEEEECCE-EEEEEEEEEEEECCCCHHHHHHHHHH--CCCCCEEEEE
T ss_conf             98999947999999999999982899669999999998998-99999999999898999999999970--9984638998


Q ss_pred             CCCCCHHHHHHEECCCCCCCCCCCHHHHHHHHHHCCCC
Q ss_conf             00122332100011897532227699999999978989
Q gi|254780813|r  161 QIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVI  198 (199)
Q Consensus       161 ~ie~~g~~~i~~I~Gd~~~V~GLPi~~l~~~L~~~gii  198 (199)
                      +|||.|..||++|+|||+||||||+.++.++|+++|+.
T Consensus       151 ~iqg~g~~~ie~I~G~~~nViGLPl~~l~~~L~~~g~~  188 (189)
T 1ex2_A          151 GIQGRGALFVKKIDGDYYSVMGLPISKTMRALRHFDIR  188 (189)
T ss_dssp             CSSGGGGGTEEEEESCHHHHHTCCHHHHHHHHTTC---
T ss_pred             ECCCCHHHCEEEEECCCCCEECCCHHHHHHHHHHCCCC
T ss_conf             41578113277788877722288499999999975999



>2p5x_A (A:) ASMTL, N-acetylserotonin O-methyltransferase-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 2.00A {Homo sapiens} Back     alignment and structure
>2amh_A (A:) Septum formation protein MAF homologue, putative; domain alpha-beta motif, structural genomics, PSI, protein structure initiative; 2.00A {Trypanosoma brucei} Back     alignment and structure
>1vp2_A (A:) Putative xanthosine triphosphate pyrophosphatase/HAM1 protein homolog; TM0159; 1.78A {Thermotoga maritima} Back     alignment and structure
>2car_A (A:) Inosine triphosphate pyrophosphatase; hydrolase, inosine triphosphate pyrophosphohydrolase, inosine triphosphatase deficiency, ITP, IMP; 1.09A {Homo sapiens} Back     alignment and structure
>1v7r_A (A:) Hypothetical protein PH1917; ntpase, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; HET: CIT; 1.40A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1b78_A (A:) Pyrophosphatase; structural genomics, hyperthermal protein; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1k7k_A (A:) Hypothetical protein YGGV; MAD, His-TAG, large groove, disordered Se-Met, structural genomics, putative ribosomal protein, PSI; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure