254780814

254780814

DNA gyrase subunit B

GeneID in NCBI database:8209820Locus tag:CLIBASIA_03525
Protein GI in NCBI database:254780814Protein Accession:YP_003065227.1
Gene range:+(439394, 441805)Protein Length:803aa
Gene description:DNA gyrase subunit B
COG prediction:[L] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit
KEGG prediction:gyrB; DNA gyrase subunit B; K02470 DNA gyrase subunit B [EC:5.99.1.3]
SEED prediction:DNA gyrase subunit B (EC 5.99.1.3)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA topoisomerases, Type II, ATP-dependent;
Resistance to fluoroquinolones
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800---
MSDNIQNSSYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLADCSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAEKSEKSWHGSINNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGDEVEPRREFIQENSLPSALDI
cccccccccccHHHEEEcccHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEccEEcccccccccccccEEEEEEEEccccccccccEEEEEEcccHHHHEEEEEccEEEEEEEEccEEEEEEEEccEEcccEEEEccccccccEEEEEEEccHHcccccccHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEcccHHHHHHHHHHccccccccccEEEEEEcccEEEEEEEEEcccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEcccccHHHHHcccccccEEEEEEccccccHHcccHHHHHcHHHHHHHHHHHccccccccccHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccEEEEEcccEEEEEEccEEEEEccHHHHHHHHHHccccccEEEEccccccccHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEEEEEccccHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEEccHHHHHHHHHHHcccccEEEEcccccccHHHHHHcccccccEEEEEEEcccHHHHHHHHHHHcccccHHHHHHHHHccccccccc
cccccccccccHHHcEEccccHHHHHccHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEEccccccccEEccccEEHHHHHHHcccEEcHHHccccccccccccccHHHHHHcEEEEEEEEEEccEEEEEEEEccEEEEEEEEEEEccccccEEEEEcccccHcccccccHHHHHHHHHHHHHHccccEcEEEEEEccccEEEEEccccHHHHHHHHHcccccEcccccEEEEEEEccEEEEEEEEEEcccccEEEEEEccEEccccEHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccEEEEEEEEcccccEcccccccEccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccccHcccccccHHHHHccccccEEEEEEcccccccccccccccccEEccccccEEEEEEccccccccHHHHHHHHHHccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHcHHHHHcccEEEEccccEEEccccEEEEEccHHHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccEEEEcHHHHccHHHHHHHHHHHHHHHHHccccEEEcccccEccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHcccHHHHHHEEEEHHHHHHHHHHHHHHcccccccHHHHHHHHHcEEcccc
msdniqnssydadsIQILKGLdavkkrpsmyigdtdgesglHHMIYEVLDNAIDESLEGYADIITVTLnmdgsctvsdngrgiptdlhkeeGISAAEVIMTRLhaggkfnqksykvsgglHGVGVSVVNALSSWLKLRIKREGNIYEMSFINgildnplvvtgsagndtgtevtflpssdifsvqdfnYDTLQHRLRELSFLNSSVQISlidkrspepreITMFYKGGIEAFVSYLDRhkkplmqspiriqgsrdniSIDLAMrwndgyhenvlcftnnipqkdggthlsGLRSALTRQITSYVEksfgskkdkrsvigddcregFTSVlsikmpdprfssqtkekLVSSEVRSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRrkgvldiaslpgkladcserdpkksELFLVegdsaggsakqgrsrenqailplrgKILNVERARFDKMLSSQEIGTLITALgtgigqdsfdinklRYHKIIImtdadvdgAHIRTLLLTFFFrqmpslihngflyiikpplygitrgkslqyvkdEESLEDYLINQSLSEEIELFCdskgviskndlrNFIDDALKIDKLIKdfypnhdktFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAeksekswhgsinnsDILVKRIARGVQEQFVLegssifsfgsKYKRIFSNRIEENYLTILSLICngdkikitgpcsllDTIFSIGRKGISMQRYkglgemnasqlwettlnpdtrsLLRVKITDASQADDLFsrlmgdeveprrefiqenslpsaldi
msdniqnssydadsiQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSflnssvqislidkrspeprEITMFYKGGIEAFVSYLDRHKKPlmqspiriqgsrdNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSyveksfgskkdkrsvigddcREGFTsvlsikmpdprfssqtkeklvsSEVRSVVESFVNDGLSAWLEEHPLEAKIIVkkvldasmvRDAARrardltrrkgvldiaslpgkladcserdpKKSELFLVEGdsaggsakqgrsrenqailplrgkilNVERARFDKMLSSQEIGTLITAlgtgigqdSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIaeksekswhgsinNSDILVKRIARGVQEQFVlegssifsfgskYKRIFSNRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKItdasqaddlfsrlmgdeveprrefiqenslpsaldi
MSDNIQNSSYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKvsgglhgvgvsvvNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLvssevrsvvesFVNDGLSAWLEEHPLEAKIIVKKVLDASMVrdaarrardltrrKGVLDIASLPGKLADCSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEigtlitalgtgigQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFiddalkidklikdFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAEKSEKSWHGSINNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGDEVEPRREFIQENSLPSALDI
***************QILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLADCSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFC*****ISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAEKSEKSWHGSINNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGDEVEPRREFIQENSLPSALDI
*********YDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVE**********SVIGDDCREGFTSVLSIKMPDPR**************RSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLADCSERDPKKSELFLVEGD************ENQAILPLRGKILNVERARFDKMLSSQEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAEKSEKSWHGSINNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGDEVEPRREFIQENSLPSALDI
********SYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLADCSERDPKKSELFLVEGDS***********ENQAILPLRGKILNVERARFDKMLSSQEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAEKSEKSWHGSINNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGDEVEPRREFIQENSLPSALDI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDNIQNSSYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLADCSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAEKSEKSWHGSINNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGDEVEPRREFIQENSLPSALDI
MSDNIQNSSYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLADCSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAEKSEKSWHGSINNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGDEVEPRREFIQENSLPSALDI
MSDNIQNSSYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLADCSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAEKSEKSWHGSINNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGDEVEPRREFIQENSLPSALDI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target803 DNA gyrase subunit B [Candidatus Liberibacter asiaticus
254780222686 DNA topoisomerase IV subunit B [Candidatus Liberib 1e-113
254780222686 DNA topoisomerase IV subunit B [Candidatus Liberib 4e-09
>gi|254780222|ref|YP_003064635.1| DNA topoisomerase IV subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 686 Back     alignment
 Score =  402 bits (1033), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 257/655 (39%), Positives = 374/655 (57%), Gaps = 33/655 (5%)

Query: 9   SYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTL 68
           +YDA SI+IL+GL+ V+ RP MYIG TD E  LHH+  EV+DNA+DE + GYA++I V+L
Sbjct: 43  NYDASSIRILEGLEPVRMRPGMYIGGTD-EKALHHLFSEVIDNAMDEVIAGYANLIEVSL 101

Query: 69  NMDGSCTVSDNGRGIPTDLH-KEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSV 127
           + +G  TV DNGRGIP + H K    S  E+I+T LHAGGKF+  +Y++SGGLHGVG+SV
Sbjct: 102 DGNGFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISV 161

Query: 128 VNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQ-D 186
           VNALS  L + + R+  I+   F  GI  +PL       N  GT +TF P   IF  +  
Sbjct: 162 VNALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAG 221

Query: 187 FNYDTLQHRLRELSFLNSSVQISL-IDKRSPE----PREITMFYKGGIEAFVSYLDRHKK 241
           F+   L    +  ++L+  V+     DK   E    P +   ++ GG++ ++       +
Sbjct: 222 FDAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQ-TKLENR 280

Query: 242 PLMQSPI-----RIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSAL 296
            L+ S I       +G+    +++ A+ W +   E +  + N I   +GGTH SGLR AL
Sbjct: 281 SLISSEIFTGKTEKKGTHRG-TVEWAIAWCEENPE-ITSYCNTILTDEGGTHESGLRVAL 338

Query: 297 TRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVV 356
           TR I  Y E      K   S+I DD       +LS+ + +P F+ QTK KLVS + +  V
Sbjct: 339 TRGIKKYAE--LTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTV 396

Query: 357 ESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLAD 416
           E+ + D    +L ++P+EA  +++ V++ S  R   R+ R++ R+  +  +  LPGKLAD
Sbjct: 397 ENALRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVNRKTAIRKL-RLPGKLAD 455

Query: 417 CSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGT 476
           CS+     +ELF+VEGDSAGGSAKQ R+R NQA+LPLRGKILNV  A  +K+ ++Q+I  
Sbjct: 456 CSQNIAHGTELFIVEGDSAGGSAKQARNRSNQAVLPLRGKILNVASAGSEKIRNNQQIMD 515

Query: 477 LITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYI 536
           L+ ALG    +  +    LRY K+IIMTDADVDGAHI +LLLTFF+++M  LI    L++
Sbjct: 516 LVQALGCRT-RSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFL 574

Query: 537 IKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALK 596
           I PPL+ IT+G    Y  DEE        Q + EE +     K  IS+     F      
Sbjct: 575 ISPPLFRITQGTKSVYAHDEEH------KQKILEEFKKHGKGKIEISR-----FKGLGEM 623

Query: 597 IDKLIKDFYPNHDKTFIEQAVISGVFNCESDQE--INVSLASKLANRLNFIAEKS 649
           +   +K+   + +K  + +  I+   N   D +  IN  + +K   R  FI E++
Sbjct: 624 LASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERA 678

>gi|254780222|ref|YP_003064635.1| DNA topoisomerase IV subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 686 Back     alignment
 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 4/71 (5%)

Query: 730 GRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKI----TDASQADDLFSRLMGDEV 785
           G+  I + R+KGLGEM ASQL ET ++ + R+LLRV+I           D  ++LMG + 
Sbjct: 608 GKGKIEISRFKGLGEMLASQLKETAMDANKRTLLRVEINKDLNSLKDTQDSINKLMGTKA 667

Query: 786 EPRREFIQENS 796
           + R +FIQE +
Sbjct: 668 DERFKFIQERA 678

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target803 DNA gyrase subunit B [Candidatus Liberibacter asiaticus
315122037802 DNA gyrase subunit B [Candidatus Liberibacter solanacea 1 0.0
86355681811 DNA gyrase subunit B [Rhizobium etli CFN 42] Length = 8 1 0.0
190889652811 DNA gyrase, B subunit [Rhizobium etli CIAT 652] Length 1 0.0
209551517811 DNA gyrase subunit B [Rhizobium leguminosarum bv. trifo 1 0.0
227823871811 DNA gyrase subunit B [Sinorhizobium fredii NGR234] Leng 1 0.0
241206955811 DNA gyrase subunit B [Rhizobium leguminosarum bv. trifo 1 0.0
15963765811 DNA gyrase subunit B [Sinorhizobium meliloti 1021] Leng 1 0.0
116249778811 DNA gyrase subunit B [Rhizobium leguminosarum bv. vicia 1 0.0
222084213811 DNA gyrase, B subunit [Agrobacterium radiobacter K84] L 1 0.0
150398412811 DNA gyrase subunit B [Sinorhizobium medicae WSM419] Len 1 0.0
>gi|315122037|ref|YP_004062526.1| DNA gyrase subunit B [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 802 Back     alignment and organism information
 Score = 1438 bits (3722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/805 (87%), Positives = 750/805 (93%), Gaps = 5/805 (0%)

Query: 1   MSDNIQNSSYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGY 60
           M++NIQNSSY ADSIQILKGLDAVKKRPSMYIGDTD  SGLHHM+YEVLDNAIDE+LEGY
Sbjct: 1   MNNNIQNSSYSADSIQILKGLDAVKKRPSMYIGDTDDGSGLHHMVYEVLDNAIDEALEGY 60

Query: 61  ADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGL 120
           ADII VTLNMDGSCTVSDNGRGIPTD+HKEEGISA EVIMTRLHAGGKF+Q SYKVSGGL
Sbjct: 61  ADIINVTLNMDGSCTVSDNGRGIPTDIHKEEGISATEVIMTRLHAGGKFDQNSYKVSGGL 120

Query: 121 HGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSD 180
           HGVGVSVVNALSSWLKLRIKREG IYEMSFINGI+D+PLVV G AG DTGTE+TFLP+SD
Sbjct: 121 HGVGVSVVNALSSWLKLRIKREGKIYEMSFINGIVDSPLVVVGDAGKDTGTEITFLPNSD 180

Query: 181 IFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHK 240
           IFS+ DF+ D L+HRLRELSFLNS V ISL+DKR  +PREI +FY+GGIEAFV YLDRHK
Sbjct: 181 IFSIHDFDCDVLKHRLRELSFLNSGVHISLVDKRCSDPREIKLFYEGGIEAFVCYLDRHK 240

Query: 241 KPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQI 300
           KPL+Q+PIRIQG RD IS+DLAMRWNDGYHENVLCFTNNIPQKDGGTHL+GLRSALTRQI
Sbjct: 241 KPLIQNPIRIQGMRDEISVDLAMRWNDGYHENVLCFTNNIPQKDGGTHLAGLRSALTRQI 300

Query: 301 TSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFV 360
           TSYVEKSFGSKKDKRSV+GDDCREGFTSVLSIK+ DPRFSSQTKEKLVSSEVRSVVE  V
Sbjct: 301 TSYVEKSFGSKKDKRSVVGDDCREGFTSVLSIKISDPRFSSQTKEKLVSSEVRSVVEGLV 360

Query: 361 NDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLTRRKGVLDIASLPGKLADCSER 420
            DGLS+WLEEHP EAKIIVKKVL+ASMVRDAARRARDLTRRKGVLDIASLPGKLADCSER
Sbjct: 361 TDGLSSWLEEHPSEAKIIVKKVLEASMVRDAARRARDLTRRKGVLDIASLPGKLADCSER 420

Query: 421 DPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGTLITA 480
           DPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGTLITA
Sbjct: 421 DPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGTLITA 480

Query: 481 LGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPP 540
           LGTGIGQDSFDI KLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLI NGFLYIIKPP
Sbjct: 481 LGTGIGQDSFDIKKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIQNGFLYIIKPP 540

Query: 541 LYGITRGKSLQYVKDEESLEDYLINQSLSEEIEL-FCDSKGVISKNDLRNFIDDALKIDK 599
           LYGITRGKSLQYVKDEESLEDYLINQ+LSEEIEL F  +K  I+ NDLR+FIDDALKIDK
Sbjct: 541 LYGITRGKSLQYVKDEESLEDYLINQALSEEIELSFGSTK--ITGNDLRSFIDDALKIDK 598

Query: 600 LIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLASKLANRLNFIAEKSEKSWHGSINN 659
           LIK FYP++DK FIEQ VISG+FNCE+ Q+IN  LASKLANRLN IAEKSE  W GSI +
Sbjct: 599 LIKSFYPSYDKIFIEQVVISGIFNCENTQQINEDLASKLANRLNLIAEKSE-VWSGSIVD 657

Query: 660 S-DILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLTILSLICNGDKIKITG 718
           S +ILVKR+ RGVQEQF+L GSSIF+FGS+YKRIFS RIEENYLTI  LICNG+KIKI G
Sbjct: 658 SGNILVKRVVRGVQEQFILNGSSIFAFGSRYKRIFSKRIEENYLTISHLICNGNKIKIVG 717

Query: 719 PCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFS 778
           PCSLLDTIFSIGRKG+SMQRYKGLGEMNASQLW+TTLNP+ RSLLRVKITDASQADD+FS
Sbjct: 718 PCSLLDTIFSIGRKGVSMQRYKGLGEMNASQLWDTTLNPEARSLLRVKITDASQADDVFS 777

Query: 779 RLMGDEVEPRREFIQENSLPSALDI 803
           RLMGDEVEPRREFIQENSL + +DI
Sbjct: 778 RLMGDEVEPRREFIQENSLSATIDI 802


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86355681|ref|YP_467573.1| DNA gyrase subunit B [Rhizobium etli CFN 42] Length = 811 Back     alignment and organism information
>gi|190889652|ref|YP_001976194.1| DNA gyrase, B subunit [Rhizobium etli CIAT 652] Length = 811 Back     alignment and organism information
>gi|209551517|ref|YP_002283434.1| DNA gyrase subunit B [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 811 Back     alignment and organism information
>gi|227823871|ref|YP_002827844.1| DNA gyrase subunit B [Sinorhizobium fredii NGR234] Length = 811 Back     alignment and organism information
>gi|241206955|ref|YP_002978051.1| DNA gyrase subunit B [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 811 Back     alignment and organism information
>gi|15963765|ref|NP_384118.1| DNA gyrase subunit B [Sinorhizobium meliloti 1021] Length = 811 Back     alignment and organism information
>gi|116249778|ref|YP_765616.1| DNA gyrase subunit B [Rhizobium leguminosarum bv. viciae 3841] Length = 811 Back     alignment and organism information
>gi|222084213|ref|YP_002542739.1| DNA gyrase, B subunit [Agrobacterium radiobacter K84] Length = 811 Back     alignment and organism information
>gi|150398412|ref|YP_001328879.1| DNA gyrase subunit B [Sinorhizobium medicae WSM419] Length = 811 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target803 DNA gyrase subunit B [Candidatus Liberibacter asiaticus
PRK14939756 PRK14939, gyrB, DNA gyrase subunit B; Provisional 0.0
PRK05644638 PRK05644, gyrB, DNA gyrase subunit B; Validated 0.0
TIGR01059654 TIGR01059, gyrB, DNA gyrase, B subunit 0.0
PRK05559631 PRK05559, PRK05559, DNA topoisomerase IV subunit B; Rev 0.0
TIGR01058637 TIGR01058, parE_Gpos, DNA topoisomerase IV, B subunit, 1e-170
TIGR01055625 TIGR01055, parE_Gneg, DNA topoisomerase IV, B subunit, 1e-131
PTZ00109903 PTZ00109, PTZ00109, DNA gyrase subunit b; Provisional 1e-129
PHA02569602 PHA02569, 39, DNA topoisomerase II large subunit; Provi 1e-50
PTZ00108 1388 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; P 2e-43
PLN03128 1135 PLN03128, PLN03128, DNA topoisomerase 2; Provisional 6e-40
COG0187635 COG0187, GyrB, Type IIA topoisomerase (DNA gyrase/topo 0.0
smart00433594 smart00433, TOP2c, TopoisomeraseII 0.0
PLN03237 1465 PLN03237, PLN03237, DNA topoisomerase 2; Provisional 7e-34
KOG0355842 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [C 3e-70
cd03366114 cd03366, TOPRIM_TopoIIA_GyrB, TOPRIM_TopoIIA_GyrB: topo 4e-60
cd01030115 cd01030, TOPRIM_TopoIIA_like, TOPRIM_TopoIIA_like: topo 9e-57
cd03365120 cd03365, TOPRIM_TopoIIA, TOPRIM_TopoIIA: topoisomerase- 2e-22
cd0018883 cd00188, TOPRIM, Topoisomerase-primase domain 5e-05
pfam0175189 pfam01751, Toprim, Toprim domain 0.004
cd00822172 cd00822, TopoII_Trans_DNA_gyrase, TopoIIA_Trans_DNA_gyr 2e-57
pfam00204173 pfam00204, DNA_gyraseB, DNA gyrase B 3e-50
PRK05644638 PRK05644, gyrB, DNA gyrase subunit B; Validated 2e-33
TIGR01059654 TIGR01059, gyrB, DNA gyrase, B subunit 6e-30
PRK05559631 PRK05559, PRK05559, DNA topoisomerase IV subunit B; Rev 5e-29
pfam0098665 pfam00986, DNA_gyraseB_C, DNA gyrase B subunit, carboxy 7e-29
COG0187635 COG0187, GyrB, Type IIA topoisomerase (DNA gyrase/topo 2e-27
smart00433594 smart00433, TOP2c, TopoisomeraseII 5e-25
TIGR01058637 TIGR01058, parE_Gpos, DNA topoisomerase IV, B subunit, 3e-20
PTZ00109903 PTZ00109, PTZ00109, DNA gyrase subunit b; Provisional 8e-17
TIGR01055625 TIGR01055, parE_Gneg, DNA topoisomerase IV, B subunit, 3e-10
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, 1e-11
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPases 2e-11
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; This 1e-07
cd00329107 cd00329, TopoII_MutL_Trans, MutL_Trans: transducer doma 2e-08
cd03481153 cd03481, TopoIIA_Trans_ScTopoIIA, TopoIIA_Trans_ScTopoI 0.003
>gnl|CDD|184903 PRK14939, gyrB, DNA gyrase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|180181 PRK05644, gyrB, DNA gyrase subunit B; Validated Back     alignment and domain information
>gnl|CDD|162180 TIGR01059, gyrB, DNA gyrase, B subunit Back     alignment and domain information
>gnl|CDD|180127 PRK05559, PRK05559, DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>gnl|CDD|130130 TIGR01058, parE_Gpos, DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>gnl|CDD|130127 TIGR01055, parE_Gneg, DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>gnl|CDD|185452 PTZ00109, PTZ00109, DNA gyrase subunit b; Provisional Back     alignment and domain information
>gnl|CDD|177398 PHA02569, 39, DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>gnl|CDD|185451 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|178674 PLN03128, PLN03128, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|30536 COG0187, GyrB, Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|128710 smart00433, TOP2c, TopoisomeraseII Back     alignment and domain information
>gnl|CDD|178775 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|35576 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|173786 cd03366, TOPRIM_TopoIIA_GyrB, TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to the Escherichia coli GyrB subunit Back     alignment and domain information
>gnl|CDD|173780 cd01030, TOPRIM_TopoIIA_like, TOPRIM_TopoIIA_like: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topoisomerase II Back     alignment and domain information
>gnl|CDD|173785 cd03365, TOPRIM_TopoIIA, TOPRIM_TopoIIA: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topoisomerase II Back     alignment and domain information
>gnl|CDD|173773 cd00188, TOPRIM, Topoisomerase-primase domain Back     alignment and domain information
>gnl|CDD|145089 pfam01751, Toprim, Toprim domain Back     alignment and domain information
>gnl|CDD|48467 cd00822, TopoII_Trans_DNA_gyrase, TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E Back     alignment and domain information
>gnl|CDD|143961 pfam00204, DNA_gyraseB, DNA gyrase B Back     alignment and domain information
>gnl|CDD|180181 PRK05644, gyrB, DNA gyrase subunit B; Validated Back     alignment and domain information
>gnl|CDD|162180 TIGR01059, gyrB, DNA gyrase, B subunit Back     alignment and domain information
>gnl|CDD|180127 PRK05559, PRK05559, DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>gnl|CDD|144542 pfam00986, DNA_gyraseB_C, DNA gyrase B subunit, carboxyl terminus Back     alignment and domain information
>gnl|CDD|30536 COG0187, GyrB, Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|128710 smart00433, TOP2c, TopoisomeraseII Back     alignment and domain information
>gnl|CDD|130130 TIGR01058, parE_Gpos, DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>gnl|CDD|185452 PTZ00109, PTZ00109, DNA gyrase subunit b; Provisional Back     alignment and domain information
>gnl|CDD|130127 TIGR01055, parE_Gneg, DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>gnl|CDD|145582 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|128669 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|28956 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|73195 cd00329, TopoII_MutL_Trans, MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins Back     alignment and domain information
>gnl|CDD|48469 cd03481, TopoIIA_Trans_ScTopoIIA, TopoIIA_Trans_ScTopoIIA: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topo IIA Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 803 DNA gyrase subunit B [Candidatus Liberibacter asiaticus
TIGR01059818 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA top 100.0
PRK05644725 gyrB DNA gyrase subunit B; Validated 100.0
COG0187635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topois 100.0
PTZ00109941 DNA gyrase subunit b; Provisional 100.0
TIGR01058655 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IP 100.0
PRK05559633 DNA topoisomerase IV subunit B; Reviewed 100.0
TIGR01055647 parE_Gneg DNA topoisomerase IV, B subunit; InterPro: IP 100.0
KOG0355 842 consensus 100.0
smart00433594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomerase II, 100.0
PTZ00108 1506 DNA topoisomerase II; Provisional 100.0
cd00822172 TopoII_Trans_DNA_gyrase TopoIIA_Trans_DNA_gyrase: Trans 100.0
pfam00204173 DNA_gyraseB DNA gyrase B. This family represents the se 100.0
cd03481153 TopoIIA_Trans_ScTopoIIA TopoIIA_Trans_ScTopoIIA: Transd 99.88
cd03366114 TOPRIM_TopoIIA_GyrB TOPRIM_TopoIIA_GyrB: topoisomerase- 100.0
cd01030115 TOPRIM_TopoIIA_like TOPRIM_TopoIIA_like: topoisomerase- 100.0
cd03365120 TOPRIM_TopoIIA TOPRIM_TopoIIA: topoisomerase-primase (T 100.0
pfam0175189 Toprim Toprim domain. This is a conserved region from D 95.76
cd0018883 TOPRIM Topoisomerase-primase domain. This is a nucleoti 94.88
pfam0098665 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus. 99.94
PRK04184533 DNA topoisomerase VI subunit B; Validated 99.4
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, recom 99.34
TIGR01052662 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005 99.04
PRK00095612 mutL DNA mismatch repair protein; Reviewed 98.86
cd00329107 TopoII_MutL_Trans MutL_Trans: transducer domain, having 98.55
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA 98.44
TIGR00585367 mutl DNA mismatch repair protein MutL; InterPro: IPR014 98.36
KOG1978672 consensus 97.47
PRK05218612 heat shock protein 90; Provisional 97.21
KOG1979694 consensus 96.72
PTZ00130824 heat shock protein 90; Provisional 95.91
KOG1977 1142 consensus 94.34
cd00075103 HATPase_c Histidine kinase-like ATPases; This family in 97.67
pfam02518111 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-l 97.63
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine kina 97.59
COG3920221 Signal transduction histidine kinase [Signal transducti 96.12
PRK03660146 anti-sigma F factor; Provisional 95.23
PRK04069158 serine-protein kinase RsbW; Provisional 92.82
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein kina 90.99
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttranslation 97.04
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 96.98
PRK13560807 hypothetical protein; Provisional 96.91
PRK10364455 sensor protein ZraS; Provisional 93.84
PRK10935568 nitrate/nitrite sensor protein NarQ; Provisional 96.07
COG3850574 NarQ Signal transduction histidine kinase, nitrate/nitr 96.04
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 95.31
PRK11644497 sensory histidine kinase UhpB; Provisional 94.6
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Signal 95.77
PRK10490895 sensor protein KdpD; Provisional 95.18
PRK10604433 sensor protein RstB; Provisional 95.64
PRK10337446 sensor protein QseC; Provisional 95.41
PRK10549467 signal transduction histidine-protein kinase BaeS; Prov 95.4
PRK09835482 sensor kinase CusS; Provisional 95.34
PRK10815484 sensor protein PhoQ; Provisional 95.19
PRK09467437 envZ osmolarity sensor protein; Provisional 94.5
PRK10755355 sensor protein BasS/PmrB; Provisional 94.46
PRK11100475 sensory histidine kinase CreC; Provisional 94.1
PRK09303378 adaptive-response sensory kinase; Validated 94.06
PRK11006431 phoR phosphate regulon sensor protein; Provisional 93.36
COG5000712 NtrY Signal transduction histidine kinase involved in n 90.8
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 95.29
PTZ00108 1506 DNA topoisomerase II; Provisional 94.75
COG4191603 Signal transduction histidine kinase regulating C4-dica 92.32
COG4585365 Signal transduction histidine kinase [Signal transducti 94.59
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 94.3
KOG0787414 consensus 94.04
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 92.29
PRK11466912 hybrid sensory histidine kinase TorS; Provisional 90.09
>TIGR01059 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IPR005740 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit; InterPro: IPR005737 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>KOG0355 consensus Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>PTZ00108 DNA topoisomerase II; Provisional Back     alignment and domain information
>cd00822 TopoII_Trans_DNA_gyrase TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E Back     alignment and domain information
>pfam00204 DNA_gyraseB DNA gyrase B Back     alignment and domain information
>cd03481 TopoIIA_Trans_ScTopoIIA TopoIIA_Trans_ScTopoIIA: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topo IIA Back     alignment and domain information
>cd03366 TOPRIM_TopoIIA_GyrB TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to the Escherichia coli GyrB subunit Back     alignment and domain information
>cd01030 TOPRIM_TopoIIA_like TOPRIM_TopoIIA_like: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topoisomerase II Back     alignment and domain information
>cd03365 TOPRIM_TopoIIA TOPRIM_TopoIIA: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topoisomerase II Back     alignment and domain information
>pfam01751 Toprim Toprim domain Back     alignment and domain information
>cd00188 TOPRIM Topoisomerase-primase domain Back     alignment and domain information
>pfam00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005734 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>cd00329 TopoII_MutL_Trans MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL; InterPro: IPR014763 This entry represents DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>KOG1978 consensus Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>KOG1979 consensus Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>KOG1977 consensus Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>pfam02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PTZ00108 DNA topoisomerase II; Provisional Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>KOG0787 consensus Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target803 DNA gyrase subunit B [Candidatus Liberibacter asiaticus
1ei1_A391 Dimerization Of E. Coli Dna Gyrase B Provides A Str 1e-130
1kij_A390 Crystal Structure Of The 43k Atpase Domain Of Therm 1e-111
1s16_A390 Crystal Structure Of E. Coli Topoisomerase Iv Pare 4e-96
3lnu_A408 Crystal Structure Of Pare Subunit Length = 408 6e-95
1qzr_A418 Crystal Structure Of The Atpase Region Of Saccharom 7e-55
1pvg_A418 Crystal Structure Of The Atpase Region Of Saccharom 1e-53
1zxm_A400 Human Topo Iia AtpaseAMP-Pnp Length = 400 1e-52
3nuh_B420 A Domain Insertion In E. Coli Gyrb Adopts A Novel F 1e-124
1aj6_A219 Novobiocin-Resistant Mutant (R136h) Of The N-Termin 9e-99
1kzn_A205 Crystal Structure Of E. Coli 24kda Domain In Comple 6e-93
3g7e_A203 Crystal Structure Of E. Coli Gyrase B Co-Complexed 1e-92
3fv5_A201 Crystal Structure Of E. Coli Topoisomerase Iv Co-Co 2e-72
3g75_A184 Crystal Structure Of Staphylococcus Aureus Gyrase B 5e-60
1s14_A194 Crystal Structure Of Escherichia Coli Topoisomerase 6e-59
>gi|7546302|pdb|1EI1|A Chain A, Dimerization Of E. Coli Dna Gyrase B Provides A Structural Mechanism For Activating The Atpase Catalytic Center Length = 391 Back     alignment and structure
 Score =  471 bits (1211), Expect = e-130,   Method: Composition-based stats.
 Identities = 209/371 (56%), Positives = 276/371 (74%), Gaps = 4/371 (1%)

Query: 15  IQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITVTLNMDGSC 74
           I++LKGLDAV+KRP MYIGDTD  +GLHHM++EV+DNAIDE+L G+   I VT++ D S 
Sbjct: 9   IKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSV 68

Query: 75  TVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVSVVNALSSW 134
           +V D+GRGIPT +H EEG+SAAEVIMT LHAGGKF+  SYKVSGGLHGVGVSVVNALS  
Sbjct: 69  SVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQK 128

Query: 135 LKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFSV-QDFNYDTLQ 193
           L+L I+REG I+   + +G+   PL VTG     TGT V F PS + F+   +F Y+ L 
Sbjct: 129 LELVIQREGKIHRQIYEHGVPQAPLAVTGETE-KTGTMVRFWPSLETFTNVTEFEYEILA 187

Query: 194 HRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQSPIRIQGS 253
            RLRELSFL+S V I L DKR  +       Y+GGI+AFV YL+++K P+  +       
Sbjct: 188 KRLRELSFLDSGVSIRLRDKRDGKE--DHFHYEGGIKAFVEYLNKNKTPIHPNIFYFSTE 245

Query: 254 RDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVEKSFGSKKD 313
           +D I +++A++WNDG+ EN+ CFTNNIPQ+DGGTHL+G R+A+TR + +Y++K   SKK 
Sbjct: 246 KDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKA 305

Query: 314 KRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDGLSAWLEEHPL 373
           K S  GDD REG  +V+S+K+PDP+FSSQTK+KLVSSEV+S VE  +N+ L+ +L E+P 
Sbjct: 306 KVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPT 365

Query: 374 EAKIIVKKVLD 384
           +AKI+V K++D
Sbjct: 366 DAKIVVGKIID 376


>gi|21465844|pdb|1KIJ|A Chain A, Crystal Structure Of The 43k Atpase Domain Of Thermus Thermophilus Gyrase B In Complex With Novobiocin Length = 390 Back     alignment and structure
>gi|48425515|pdb|1S16|A Chain A, Crystal Structure Of E. Coli Topoisomerase Iv Pare 43kda Subunit Complexed With Adpnp Length = 390 Back     alignment and structure
>gi|323462873|pdb|3LNU|A Chain A, Crystal Structure Of Pare Subunit Length = 408 Back     alignment and structure
>gi|37928124|pdb|1QZR|A Chain A, Crystal Structure Of The Atpase Region Of Saccharomyces Cerevisiae Topoisomerase Ii Bound To Icrf-187 (Dexrazoxane) Length = 418 Back     alignment and structure
>gi|34810356|pdb|1PVG|A Chain A, Crystal Structure Of The Atpase Region Of Saccharomyces Cerevisiae Topoisomerase Ii Length = 418 Back     alignment and structure
>gi|75765928|pdb|1ZXM|A Chain A, Human Topo Iia AtpaseAMP-Pnp Length = 400 Back     alignment and structure
>gi|302566245|pdb|3NUH|B Chain B, A Domain Insertion In E. Coli Gyrb Adopts A Novel Fold That Plays A Critical Role In Gyrase Function Length = 420 Back     alignment and structure
>gi|157829905|pdb|1AJ6|A Chain A, Novobiocin-Resistant Mutant (R136h) Of The N-Terminal 24 Kda Fragment Of Dna Gyrase B Complexed With Novobiocin At 2.3 Angstroms Resolution Length = 219 Back     alignment and structure
>gi|21730596|pdb|1KZN|A Chain A, Crystal Structure Of E. Coli 24kda Domain In Complex With Clorobiocin Length = 205 Back     alignment and structure
>gi|288562964|pdb|3G7E|A Chain A, Crystal Structure Of E. Coli Gyrase B Co-Complexed With Inhibitor Length = 203 Back     alignment and structure
>gi|284793877|pdb|3FV5|A Chain A, Crystal Structure Of E. Coli Topoisomerase Iv Co-Complexed With Inhibitor Length = 201 Back     alignment and structure
>gi|288562960|pdb|3G75|A Chain A, Crystal Structure Of Staphylococcus Aureus Gyrase B Co- Complexed With Inhibitor Length = 184 Back     alignment and structure
>gi|48425513|pdb|1S14|A Chain A, Crystal Structure Of Escherichia Coli Topoisomerase Iv Pare 24kda Subunit Length = 194 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target803 DNA gyrase subunit B [Candidatus Liberibacter asiaticus
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HE 1e-152
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coumarin 1e-124
1s16_A390 Topoisomerase IV subunit B; two-domain protein complexe 1e-102
1pvg_A418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 3e-88
3cwv_A369 DNA gyrase, B subunit, truncated; structural genomics, 3e-80
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; G 2e-55
3nuh_B420 DNA gyrase subunit B; topoisomerase, supercoiling, spec 1e-131
2xkj_E 767 Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinet 1e-75
3l4j_A 757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 4e-66
2xcs_B 692 DNA gyrase subunit B, DNA gyrase subunit A; isomerase, 2e-64
1bjt_A 793 Topoisomerase II; quaternary change, DNA-binding, DNA t 1e-62
2xkj_E 767 Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinet 2e-09
3l4j_A 757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 9e-04
2xcs_B 692 DNA gyrase subunit B, DNA gyrase subunit A; isomerase, 1e-08
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 3e-15
3m4i_A242 DNA gyrase subunit B; GYRB, toprim, type II topoisomera 3e-21
3k9f_C268 DNA topoisomerase 4 subunit B; quinolone, topoisomerase 3e-22
2zjt_A247 DNA gyrase subunit B; GYRB-CTD, toprim, tail, DNA topoi 1e-20
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B subun 3e-68
3g7e_A203 DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {E 9e-67
3g75_A184 DNA gyrase subunit B; antibiotic resistance, isomerase; 6e-54
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 1e-11
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA repa 3e-06
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 2e-60
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 2e-32
3m4i_A242 DNA gyrase subunit B; GYRB, toprim, type II topoisomera 1e-57
2zjt_A247 DNA gyrase subunit B; GYRB-CTD, toprim, tail, DNA topoi 9e-51
3k9f_C268 DNA topoisomerase 4 subunit B; quinolone, topoisomerase 1e-51
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatc 4e-05
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Length = 391 Back     alignment and structure
 Score =  535 bits (1379), Expect = e-152
 Identities = 223/394 (56%), Positives = 298/394 (75%), Gaps = 4/394 (1%)

Query: 7   NSSYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMIYEVLDNAIDESLEGYADIITV 66
           ++S D+ SI++LKGLDAV+KRP MYIGDTD  +GLHHM++EV+DNAIDE+L G+   I V
Sbjct: 1   SNSSDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIV 60

Query: 67  TLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLHAGGKFNQKSYKVSGGLHGVGVS 126
           T++ D S +V D+GRGIPT +H EEG+SAAEVIMT LHAGGKF+  SYKVSGGLHGVGVS
Sbjct: 61  TIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVS 120

Query: 127 VVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTGSAGNDTGTEVTFLPSSDIFS-VQ 185
           VVNALS  L+L I+REG I+   + +G+   PL VTG     TGT V F PS + F+ V 
Sbjct: 121 VVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETE-KTGTMVRFWPSLETFTNVT 179

Query: 186 DFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREITMFYKGGIEAFVSYLDRHKKPLMQ 245
           +F Y+ L  RLRELSFL+S V I L DKR  + +E    Y+GGI+AFV YL+++K P+  
Sbjct: 180 EFEYEILAKRLRELSFLDSGVSIRLRDKR--DGKEDHFHYEGGIKAFVEYLNKNKTPIHP 237

Query: 246 SPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVE 305
           +       +D I +++A++WNDG+ EN+ CFTNNIPQ+DGGTHL+G R+A+TR + +Y++
Sbjct: 238 NIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMD 297

Query: 306 KSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDGLS 365
           K   SKK K S  GDD REG  +V+S+K+PDP+FSSQTK+KLVSSEV+S VE  +N+ L+
Sbjct: 298 KEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLA 357

Query: 366 AWLEEHPLEAKIIVKKVLDASMVRDAARRARDLT 399
            +L E+P +AKI+V K++DA+  R+AARRAR++T
Sbjct: 358 EYLLENPTDAKIVVGKIIDAARAREAARRAREMT 391


>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Length = 390 Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Length = 390 Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Length = 418 Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, ATP-binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus dk 1622} Length = 369 Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Length = 400 Back     alignment and structure
>3nuh_B DNA gyrase subunit B; topoisomerase, supercoiling, specialization, isomera; HET: DNA; 3.10A {Escherichia coli} Length = 420 Back     alignment and structure
>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Length = 767 Back     alignment and structure
>3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Length = 757 Back     alignment and structure
>2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xcr_B* 2xcq_A* 2xco_A* Length = 692 Back     alignment and structure
>1bjt_A Topoisomerase II; quaternary change, DNA-binding, DNA topology; 2.50A {Saccharomyces cerevisiae} SCOP: e.11.1.1 PDB: 1bgw_A 2rgr_A* Length = 793 Back     alignment and structure
>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Length = 767 Back     alignment and structure
>3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Length = 757 Back     alignment and structure
>2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xcr_B* 2xcq_A* 2xco_A* Length = 692 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>3m4i_A DNA gyrase subunit B; GYRB, toprim, type II topoisomerase, tuberculosi quinolone binding site, DNA binding site, ATP-binding; HET: DNA; 1.95A {Mycobacterium tuberculosis} PDB: 3ig0_A* 2zjt_A* Length = 242 Back     alignment and structure
>3k9f_C DNA topoisomerase 4 subunit B; quinolone, topoisomerase, protein-DNA cleavage complex; HET: DNA LFX; 2.90A {Streptococcus pneumoniae} PDB: 3fof_C* 3foe_C* Length = 268 Back     alignment and structure
>2zjt_A DNA gyrase subunit B; GYRB-CTD, toprim, tail, DNA topoisomerase II, G- segment, T-segment, ATP-binding, nucleotide-binding; HET: DNA; 2.80A {Mycobacterium tuberculosis} Length = 247 Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Length = 201 Back     alignment and structure
>3g7e_A DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {Escherichia coli} PDB: 1kzn_A* 1aj6_A* Length = 203 Back     alignment and structure
>3g75_A DNA gyrase subunit B; antibiotic resistance, isomerase; HET: DNA B48; 2.30A {Staphylococcus aureus} PDB: 3g7b_A* Length = 184 Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Length = 367 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 Back     alignment and structure
>3m4i_A DNA gyrase subunit B; GYRB, toprim, type II topoisomerase, tuberculosi quinolone binding site, DNA binding site, ATP-binding; HET: DNA; 1.95A {Mycobacterium tuberculosis} PDB: 3ig0_A* 2zjt_A* Length = 242 Back     alignment and structure
>2zjt_A DNA gyrase subunit B; GYRB-CTD, toprim, tail, DNA topoisomerase II, G- segment, T-segment, ATP-binding, nucleotide-binding; HET: DNA; 2.80A {Mycobacterium tuberculosis} Length = 247 Back     alignment and structure
>3k9f_C DNA topoisomerase 4 subunit B; quinolone, topoisomerase, protein-DNA cleavage complex; HET: DNA LFX; 2.90A {Streptococcus pneumoniae} PDB: 3fof_C* 3foe_C* Length = 268 Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Length = 365 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target803 DNA gyrase subunit B [Candidatus Liberibacter asiaticus
3nuh_B420 DNA gyrase subunit B; topoisomerase, supercoiling, spec 100.0
3k9f_C268 DNA topoisomerase 4 subunit B; quinolone, topoisomerase 100.0
2xkj_E 767 Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinet 100.0
3m4i_A242 DNA gyrase subunit B; GYRB, toprim, type II topoisomera 100.0
3l4j_A 757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 100.0
2xcs_B 692 DNA gyrase subunit B, DNA gyrase subunit A; isomerase, 100.0
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HE 100.0
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coumarin 100.0
1s16_A390 Topoisomerase IV subunit B; two-domain protein complexe 100.0
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; G 100.0
3cwv_A369 DNA gyrase, B subunit, truncated; structural genomics, 100.0
1pvg_A418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 100.0
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 100.0
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B subun 100.0
3g7e_A203 DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {E 100.0
3g75_A184 DNA gyrase subunit B; antibiotic resistance, isomerase; 100.0
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 99.54
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA repa 99.52
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatc 99.36
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, liga 97.39
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone, ATP 97.2
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, cytopl 97.09
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1 97.06
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein homolog 99.35
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Esc 98.94
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 98.81
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein (ENVZ 96.25
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, 96.01
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, transf 95.34
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding domain, 95.25
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bundle, c 94.94
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase domain, A 94.62
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduction, 94.62
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, selenom 94.36
1uyl_A236 HSP 86, heat shock protein HSP 90-alpha; ATPase, chaper 97.31
2cg9_A677 ATP-dependent molecular chaperone HSP82; chaperone comp 97.29
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycle, ca 97.17
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP- 97.05
3peh_A281 Endoplasmin homolog; structural genomics, structural ge 97.01
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; HET: 96.7
3ied_A272 Heat shock protein; HSP90, chaperone, structural genomi 96.63
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 3.50 96.14
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; 96.75
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kin 96.72
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif r 96.7
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; 96.57
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-bind 96.38
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, transf 95.72
1ixm_A192 SPO0B, protein (sporulation response regulatory protein 93.71
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, GHL AT 91.39
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinase, ph 94.41
>3nuh_B DNA gyrase subunit B; topoisomerase, supercoiling, specialization, isomera; HET: DNA; 3.10A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=1088.68  Aligned_cols=411  Identities=46%  Similarity=0.739  Sum_probs=389.7

Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEECCCCCCCHHHCCHHHHHCC
Q ss_conf             45532110011001246766766665555555217999825575432233465443023300562033443058766323
Q gi|254780814|r  392 ARRARDLTRRKGVLDIASLPGKLADCSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSS  471 (803)
Q Consensus       392 a~kar~~~rrK~~~~~~~lpgKL~Dc~~k~~~~~eL~ivEGDSAggsak~gRdr~~qai~PLrGKilNv~~a~~~~i~~n  471 (803)
                      |+||||+||||++|++++|||||+||+++||++|||||||||||||||||||||+|||||||||||||||+|+.++|++|
T Consensus         1 ~~~ar~l~rrk~~l~~~~lpgkl~d~~~~~~~~~~l~~~egdsa~~~~~~~r~~~~~~~~pl~gk~ln~~~~~~~~~~~n   80 (420)
T 3nuh_B            1 SNAAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSS   80 (420)
T ss_dssp             -----------------CCBTTBBCCSCCSTTSCEEEEEEHHHHHHHHHHHSCTTTEEEEEECC-------------CCC
T ss_pred             CCHHHHHHHHHCCCCCCCCCCCCHHHCCCCCCCCEEEEECCCCCHHHHHHHCCCCCEEEEECCCCCCCHHCCCHHHHHCC
T ss_conf             93578878410234568998620201148976557999757566777764348666688653886432402788788568


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCEEEEEECCCEE
Q ss_conf             66788887625787753321235673738998508888532899999999963077874895999438337887267179
Q gi|254780814|r  472 QEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQ  551 (803)
Q Consensus       472 ~Ei~~l~~~lG~~~g~~~~~~~~lrY~kiiimtDaD~DG~HI~~Llltff~~~~~~li~~g~~yia~ppl~~~~~~K~E~  551 (803)
                      +||.+|++|||||+|.++||+++||||||||||||||||+||||||||||||+||+||++|||||||||||+|++||+++
T Consensus        81 ~ei~~l~~~lg~~~~~~~~~~~~lry~~i~i~tdad~dg~hi~~ll~~~~~~~~~~l~~~g~~~~~~~p~~~~~~~k~~~  160 (420)
T 3nuh_B           81 QEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQ  160 (420)
T ss_dssp             HHHHHHHHHHC-------------CCSEEEECCCSSTTTTHHHHHHHHHHHHHCHHHHHTTCEEEECCCSEEEEETTEEE
T ss_pred             HHHHHHHHHHCCCCCCCCCCCHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCHHHHHCCCEEEEECCHHHEECCCCEE
T ss_conf             99999999976688977677000554527997357877520588999999986767650780699847246323487107


Q ss_pred             EEECHHHHHHHHHHHCCCCHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH--HHHH
Q ss_conf             98145789899985001100001457765435468999999999999999864344579999988742113511--2357
Q gi|254780814|r  552 YVKDEESLEDYLINQSLSEEIELFCDSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCE--SDQE  629 (803)
Q Consensus       552 YikDD~EL~~~Ll~~gl~~~~l~~~~~~~~l~ge~L~~li~~~~~~~~~l~~l~~~~~~~lle~l~~~~~l~~~--~d~~  629 (803)
                      |++||.||++||++.|+++..+....++..++|++|.+++..+.++++++.+++++++..++++++..+.+...  .++.
T Consensus       161 y~~~~~~~~~~li~~g~e~~~L~~~~~g~~isg~eL~~ll~~~~~~~~ll~~l~rr~~~~~l~~l~~~~~l~~~~l~~~~  240 (420)
T 3nuh_B          161 YIKDDEAMDQYQISIALDGATLHTNASAPALAGEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADLSDEQ  240 (420)
T ss_dssp             EECCHHHHHHHHHHHHHTTEEEEESSSCSEEEHHHHHHHHHHHHHHHHHHHHTTTTSCHHHHHHHHHSCCCCHHHHHCHH
T ss_pred             EEEEHHHHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCHHHHCCHH
T ss_conf             88503678899997413574663155553246477888899999999999987542667789999853333244321179


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEECC------CCCCCEEEEEEECCCCEEEEECHHHHCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             789999999988765310000110024------45670599999518530266466774164278999988887751145
Q gi|254780814|r  630 INVSLASKLANRLNFIAEKSEKSWHGS------INNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFSNRIEENYLT  703 (803)
Q Consensus       630 ~~~~~~~~l~~~l~~~~~~~~~~~~~~------~~~~~i~~~~~~~Gv~~~~~l~~~~~~s~~~~~~~~~~~~l~~~~~~  703 (803)
                      ....|.+.+...++...... ..|...      .....+.+.+..+|+.....++..|+.+.+++.+..+...+...+..
T Consensus       241 ~~~~~~~~l~~~l~~~~~~~-~~~~~~~~~d~e~~~~~~~i~~~~~Gv~~~~~I~~~f~~s~e~~~l~~~~~~~~~~~~~  319 (420)
T 3nuh_B          241 TVTRWVNALVSELNDKEQHG-SQWKFDVHTNAEQNLFEPIVRVRTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLLEE  319 (420)
T ss_dssp             HHHHHHHHHHHHHHHHCCSS-CEEEEEEEECC---CEEEEEEEECSSSEEEEECCHHHHHSHHHHHHHHHHHHHHHTTTT
T ss_pred             HHHHHHHHHHHHHHHHHCCC-CEEEEEEEECCCCCCCEEEEEEEECCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999986553037-60589985346555221589998447322563398884476789999999987554124


Q ss_pred             CEEEEECCCEEEECCHHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHCCCCHHHCEEEEEEHHHHHHHHHHHHHHCCC
Q ss_conf             50276558258739989999999986306762860377778895572230389613402123679889888786564189
Q gi|254780814|r  704 ILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWETTLNPDTRSLLRVKITDASQADDLFSRLMGD  783 (803)
Q Consensus       704 ~~~l~~~~~~~~i~s~~el~~~i~~~gkKG~sIQRYKGLGEMNPeQLWETTMDP~tRtLLqV~IeDa~~Ad~iF~~LMGD  783 (803)
                      ++.+..+++.+++.+|.+++++|++.||||++||||||||||||||||||||||++|+||||+|+||++||+||++||||
T Consensus       320 ~~~~~~~~~~~~i~s~~ell~~v~~~gkKGlsIQRYKGLGEMNPeQLWETTMDP~~RtLLqV~IeDa~~AD~iFs~LMGD  399 (420)
T 3nuh_B          320 DAFIERGERRQPVASFEQALDWLVKESRRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGD  399 (420)
T ss_dssp             SEEEEESSCEEEESSHHHHHHHHHHHHTTTCEEEECSCGGGSCHHHHHHHHTCTTTCCEEECCHHHHHHHHHHHHHHCSC
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHCCCCCCCCEEEEEECHHHHHHHHHHHHHCCC
T ss_conf             53012576452137689999999996078981234564777798898641528102617998513488999899872699


Q ss_pred             CCCCHHHHHHHHHHHC-CCCC
Q ss_conf             9876289988524412-3669
Q gi|254780814|r  784 EVEPRREFIQENSLPS-ALDI  803 (803)
Q Consensus       784 ~VEPRReFIe~NAL~v-NLDI  803 (803)
                      +|||||+|||+|||+| ||||
T Consensus       400 ~VEPRR~FIe~NAl~V~NLDI  420 (420)
T 3nuh_B          400 AVEPRRAFIEENALKAANIDI  420 (420)
T ss_dssp             C--------------------
T ss_pred             CCHHHHHHHHHHHHHHHHCCC
T ss_conf             957889999998403232599



>3k9f_C DNA topoisomerase 4 subunit B; quinolone, topoisomerase, protein-DNA cleavage complex; HET: DNA LFX; 2.90A {Streptococcus pneumoniae} PDB: 3fof_C* 3foe_C* 3ksa_C* 3ksb_C* 3ltn_C* Back     alignment and structure
>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Back     alignment and structure
>3m4i_A DNA gyrase subunit B; GYRB, toprim, type II topoisomerase, tuberculosi quinolone binding site, DNA binding site, ATP-binding; HET: DNA; 1.95A {Mycobacterium tuberculosis} PDB: 3ig0_A* 2zjt_A* Back     alignment and structure
>3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Back     alignment and structure
>2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xcr_B* 2xcq_A* 2xco_A* Back     alignment and structure