254780815

254780815

hypothetical protein CLIBASIA_03530

GeneID in NCBI database:8209821Locus tag:CLIBASIA_03530
Protein GI in NCBI database:254780815Protein Accession:YP_003065228.1
Gene range:+(438634, 439332)Protein Length:232aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MVFIKMDSGDFLILLFAFITFFVFLQLRGVLGKKTGNEKPFSGFFSGKYVFSKRDERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPNWVLISTKLGE
cEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEcccccEEcccccccEEEEEEEEEEEEcccccccEEEEEEcccc
cccHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEcccccccccHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHcccEEEEEEEEEccEEEEEEEEcccccEEEEEEEEEEEEEEEcccccEEcccccccEEEEEEEEEEccccccccccEEEEEcccc
mvfikmdsGDFLILLFAFITFFVFLQLRGvlgkktgnekpfsgffsgkyvfskrdergiitlgkgkkkdnldsinelfpigtrlNKVMRDIVSVytdfdpkdflNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFndslstrksneknvksslvgiDDMKIINASIEENTVYITIRIVGQFIsasydkdnllissdpeifgkVIDIWTFVrnippsnpnwvLISTKLGE
MVFIKMDSGDFLILLFAFITFFVFLQLRGVLGkktgnekpfsgffsgkyvfskrdergiitlgkgkkkdnldsinelfpigtrlnkvMRDIVSVYTDFDPKDFLNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFndslstrksneknvksslvgiddMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVrnippsnpnwvlistklge
MVFIKMDSGDflillfafitffvflqlRGVLGKKTGNEKPFSGFFSGKYVFSKRDERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPNWVLISTKLGE
*V****DSGDFLILLFAFITFFVFLQLRG***************************************************************SVYTDFDPKDFLNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPNWVLISTKL**
MVFIKMDSGDFLILLFAFITFFVFLQLRGVLGKKTGNEKPFSGFFSGKYVFSKRDERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPNWVLISTKLGE
MVFIKMDSGDFLILLFAFITFFVFLQLRGVLGK***********************RGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPNWVLISTK***
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFIKMDSGDFLILLFAFITFFVFLQLRGVLGKKTGNEKPFSGFFSGKYVFSKRDERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPNWVLISTKLGE
MVFIKMDSGDFLILLFAFITFFVFLQLRGVLGKKTGNEKPFSGFFSGKYVFSKRDERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPNWVLISTKLGE
MVFIKMDSGDFLILLFAFITFFVFLQLRGVLGKKTGNEKPFSGFFSGKYVFSKRDERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPNWVLISTKLGE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
254781050300 succinyl-CoA synthetase subunit alpha [Candidatus 0.045
>gi|254781050|ref|YP_003065463.1| succinyl-CoA synthetase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 300 Back     alignment
 Score = 29.6 bits (65), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 7/67 (10%)

Query: 34  KTGNEKPFSGFFSGKYVFSKR---DERGIITLGKGKKKDNLDSINE----LFPIGTRLNK 86
           K G +KP  GF +GK     R       +I+ GKG  +D ++++ E    + P   R+ +
Sbjct: 232 KRGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGR 291

Query: 87  VMRDIVS 93
            + +++ 
Sbjct: 292 SLVELLG 298

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
315122039231 hypothetical protein CKC_01445 [Candidatus Liberibacter 1 4e-81
222147023232 Membrane associated transporter protein [Agrobacterium 1 9e-40
325291461232 hypothetical protein AGROH133_02812 [Agrobacterium sp. 1 1e-37
222084209233 translocase transmembrane protein [Agrobacterium radiob 1 3e-37
218661852234 import inner membrane translocase subunit Tim44 [Rhizob 1 4e-37
159184122217 hypothetical protein Atu0008 [Agrobacterium tumefaciens 1 6e-37
218673282234 import inner membrane translocase subunit Tim44 [Rhizob 1 4e-36
86355677234 putative translocase transmembrane protein [Rhizobium e 1 1e-35
116249774234 hypothetical protein RL0008 [Rhizobium leguminosarum bv 1 2e-35
209551513234 import inner membrane translocase subunit Tim44 [Rhizob 1 2e-35
>gi|315122039|ref|YP_004062528.1| hypothetical protein CKC_01445 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 231 Back     alignment and organism information
 Score =  305 bits (781), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 157/231 (67%), Positives = 185/231 (80%), Gaps = 4/231 (1%)

Query: 6   MDSGDFLILLFAFITFFVFLQLRGVLGKKTGNEKPFSGFFS---GKYVFS-KRDERGIIT 61
           M  GDFLILL  FI  FV L+LR  LGK+TG+EKP SGF      K +FS K D   +++
Sbjct: 1   MYLGDFLILLCFFIAVFVILKLRSALGKRTGHEKPLSGFSPEQRKKSIFSPKGDGWNVVS 60

Query: 62  LGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSYEAIVDSFFEG 121
           L KGKK+D LDSIN LFP+GTRLNKV RDIVS+Y+ FDPKDFLN  R+SY  IVDSFFEG
Sbjct: 61  LNKGKKEDVLDSINGLFPVGTRLNKVFRDIVSIYSGFDPKDFLNGVRDSYGVIVDSFFEG 120

Query: 122 KVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIV 181
            +  IEKL+DS+VYQDF DSL  +KS+EK +KSSLVG+DD+KI+NAS+E N +YIT RIV
Sbjct: 121 NILKIEKLIDSKVYQDFADSLLIQKSSEKVIKSSLVGLDDLKIVNASVEGNNIYITTRIV 180

Query: 182 GQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPNWVLISTKLGE 232
           GQFISASYDK+N LI+ DPEIFGKV+D+WTFVRNI  SNPNW+LISTK GE
Sbjct: 181 GQFISASYDKNNALIAGDPEIFGKVVDVWTFVRNISSSNPNWILISTKPGE 231


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147023|ref|YP_002547980.1| Membrane associated transporter protein [Agrobacterium vitis S4] Length = 232 Back     alignment and organism information
>gi|325291461|ref|YP_004277325.1| hypothetical protein AGROH133_02812 [Agrobacterium sp. H13-3] Length = 232 Back     alignment and organism information
>gi|222084209|ref|YP_002542735.1| translocase transmembrane protein [Agrobacterium radiobacter K84] Length = 233 Back     alignment and organism information
>gi|218661852|ref|ZP_03517782.1| import inner membrane translocase subunit Tim44 [Rhizobium etli IE4771] Length = 234 Back     alignment and organism information
>gi|159184122|ref|NP_353048.2| hypothetical protein Atu0008 [Agrobacterium tumefaciens str. C58] Length = 217 Back     alignment and organism information
>gi|218673282|ref|ZP_03522951.1| import inner membrane translocase subunit Tim44 [Rhizobium etli GR56] Length = 234 Back     alignment and organism information
>gi|86355677|ref|YP_467569.1| putative translocase transmembrane protein [Rhizobium etli CFN 42] Length = 234 Back     alignment and organism information
>gi|116249774|ref|YP_765612.1| hypothetical protein RL0008 [Rhizobium leguminosarum bv. viciae 3841] Length = 234 Back     alignment and organism information
>gi|209551513|ref|YP_002283430.1| import inner membrane translocase subunit Tim44 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 234 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
pfam04280146 pfam04280, Tim44, Tim44-like domain 1e-25
KOG2580459 KOG2580, KOG2580, KOG2580, Mitochondrial import inner m 0.002
COG4395281 COG4395, COG4395, Uncharacterized protein conserved in 1e-28
>gnl|CDD|146752 pfam04280, Tim44, Tim44-like domain Back     alignment and domain information
>gnl|CDD|37791 KOG2580, KOG2580, KOG2580, Mitochondrial import inner membrane translocase, subunit TIM44 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|34102 COG4395, COG4395, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
COG4395281 Uncharacterized protein conserved in bacteria [Function 100.0
pfam04280146 Tim44 Tim44-like domain. Tim44 is an essential componen 100.0
KOG2580459 consensus 99.91
TIGR00984385 3a0801s03tim44 mitochondrial import inner membrane, tra 99.88
pfam07961235 MBA1 MBA1-like protein. Mba1 is an inner membrane prote 97.58
KOG4599379 consensus 97.22
>COG4395 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam04280 Tim44 Tim44-like domain Back     alignment and domain information
>KOG2580 consensus Back     alignment and domain information
>TIGR00984 3a0801s03tim44 mitochondrial import inner membrane, translocase subunit; InterPro: IPR005682 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>pfam07961 MBA1 MBA1-like protein Back     alignment and domain information
>KOG4599 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
2cw9_A194 Crystal Structure Of Human Tim44 C-Terminal Domain 7e-17
2fxt_A192 Crystal Structure Of Yeast Tim44 Length = 192 4e-05
3qk9_A222 Yeast Tim44 C-Terminal Domain Complexed With Cymal- 4e-05
>gi|85544427|pdb|2CW9|A Chain A, Crystal Structure Of Human Tim44 C-Terminal Domain Length = 194 Back     alignment and structure
 Score = 91.9 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 62/179 (34%), Gaps = 3/179 (1%)

Query: 55  DERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSY-EA 113
           +             D +  +       T  ++V+ +I+ V   FD   FL +  N     
Sbjct: 9   ESDNAFIRASRALTDKVTDLLGGLFSKTEXSEVLTEILRVDPAFDKDRFLKQCENDIIPN 68

Query: 114 IVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENT 173
           ++++   G++  ++       Y      +   K+      S ++ ID++ +      E  
Sbjct: 69  VLEAXISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAXGKXVEQG 128

Query: 174 VYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNP--NWVLISTKL 230
             + I    Q +    +    ++  DP+   + + +W   R+    NP   W L+    
Sbjct: 129 PVLIITFQAQLVXVVRNPKGEVVEGDPDKVLRXLYVWALCRDQDELNPYAAWRLLDISA 187


>gi|126030489|pdb|2FXT|A Chain A, Crystal Structure Of Yeast Tim44 Length = 192 Back     alignment and structure
>gi|325534055|pdb|3QK9|A Chain A, Yeast Tim44 C-Terminal Domain Complexed With Cymal-3 Length = 222 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
2cw9_A194 Translocase of inner mitochondrial membrane; structure 4e-23
2fxt_A192 Import inner membrane translocase subunit TIM44; mitoch 1e-20
>2cw9_A Translocase of inner mitochondrial membrane; structure genomics, TIM, structural genomics, NPPFSA, riken structural genomics/proteomics initiative; HET: 1PE; 1.90A {Homo sapiens} SCOP: d.17.4.13 Length = 194 Back     alignment and structure
 Score =  103 bits (258), Expect = 4e-23
 Identities = 27/163 (16%), Positives = 64/163 (39%), Gaps = 3/163 (1%)

Query: 69  DNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNS-YEAIVDSFFEGKVHAIE 127
           D +  +       T +++V+ +I+ V   FD   FL +  N     ++++   G++  ++
Sbjct: 23  DKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILK 82

Query: 128 KLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISA 187
                  Y      +   K+      S ++ ID++ +    + E    + I    Q +  
Sbjct: 83  DWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMVEQGPVLIITFQAQLVMV 142

Query: 188 SYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPN--WVLIST 228
             +    ++  DP+   +++ +W   R+    NP   W L+  
Sbjct: 143 VRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDI 185


>2fxt_A Import inner membrane translocase subunit TIM44; mitochondrial translocase, protein transport; 3.20A {Saccharomyces cerevisiae} SCOP: d.17.4.13 Length = 192 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
2cw9_A194 Translocase of inner mitochondrial membrane; structure 100.0
2fxt_A192 Import inner membrane translocase subunit TIM44; mitoch 100.0
3cu3_A172 Domain of unknown function with A cystatin-like fold; Z 92.25
>2cw9_A Translocase of inner mitochondrial membrane; structure genomics, TIM, structural genomics, NPPFSA, riken structural genomics/proteomics initiative; HET: 1PE; 1.90A {Homo sapiens} SCOP: d.17.4.13 Back     alignment and structure
Probab=100.00  E-value=1.2e-38  Score=264.08  Aligned_cols=152  Identities=17%  Similarity=0.394  Sum_probs=147.3

Q ss_pred             CCCHHHHHHHHHHHCCCCCCHHHHHHHHHH-HHHHHHHHHHCCCHHHHHHHHCHHHHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             542024577776612676798999999999-9999999984276789997318999999998777644349820236620
Q gi|254780815|r   80 IGTRLNKVMRDIVSVYTDFDPKDFLNEARN-SYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVG  158 (232)
Q Consensus        80 ~~~~~~~~~~~i~~~~~~Fd~~~Fl~gAk~-af~~I~~A~~~gD~~~L~~lls~~~~~~f~~~i~~r~~~~~~~~~~~v~  158 (232)
                      ..++.+.+++.|+.+||+||.++|++|||. +|++|++||.+||++.|++|||+++|+.|+.+|++|+.+|.+++.++++
T Consensus        34 ~~~e~~~~l~~ik~~Dp~Fd~~~Fl~~ak~~a~~~I~~A~~~gD~~~Lk~l~se~~~~~f~~~i~~r~~~g~~~~~~il~  113 (194)
T 2cw9_A           34 SKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILD  113 (194)
T ss_dssp             HHHHHHHHHHHHHHHCTTCCHHHHHHHHHHTHHHHHHHHHHHTCHHHHHHHBCHHHHHHHHHHHHHHHHTTCEECCEEEE
T ss_pred             CCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             88889999999997689999899999999999999999998488999988629999999999999999769800478840


Q ss_pred             HHHHHHHHHCCCCCEEEEEEEEEEEEEEEEECCCCCEECCCCCCCEEEEEEEEEEECCCCCCCC--EEEEEEECC
Q ss_conf             0012454211346456999999888777667689968057657848999999999618989986--689576327
Q gi|254780815|r  159 IDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPN--WVLISTKLG  231 (232)
Q Consensus       159 i~~~~i~~~~~~~~~~~itV~F~~~~i~~~~d~~g~vveG~~~~~~~~~e~WtF~R~~~~~~p~--W~L~~iq~~  231 (232)
                      |.+++|.+++..++.++++|+|.++|++|++|++|+||+|+++++.+++|+|||+|++++.+||  |+|++||++
T Consensus       114 i~~~eI~~a~~~~~~~~i~V~F~~~qi~~~~D~~G~VveGd~~~i~~~~e~W~F~R~~~~~~pn~~W~L~ei~~~  188 (194)
T 2cw9_A          114 IDNVDLAMGKMVEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISAS  188 (194)
T ss_dssp             EEEEEEEEEEEETTEEEEEEEEEEEEECEEECTTSCEEEECTTCCEEEEEEEEEEECTTCSCGGGCEEEEEEEEE
T ss_pred             CCCCEEEEEEEECCCEEEEEEEEEEEHHEEECCCCCEECCCCCCCEEEEEEEEEEECCCCCCCCCCEEEEEEHHC
T ss_conf             143223688850883299999999920117779998842898873587899999973777898998899975201



>2fxt_A Import inner membrane translocase subunit TIM44; mitochondrial translocase, protein transport; 3.20A {Saccharomyces cerevisiae} SCOP: d.17.4.13 Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like fold; ZP_00107529.1, structural genomics, joint center for structural genomics; 2.00A {Nostoc punctiforme pcc 73102} SCOP: d.17.4.28 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
d2cw9a1182 d.17.4.13 (A:270-451) Translocase of inner mitochondria 8e-24
d2fxta1192 d.17.4.13 (A:234-425) Translocase of inner mitochondria 1e-21
>d2cw9a1 d.17.4.13 (A:270-451) Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: TIM44-like
domain: Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  104 bits (260), Expect = 8e-24
 Identities = 27/163 (16%), Positives = 64/163 (39%), Gaps = 3/163 (1%)

Query: 69  DNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNS-YEAIVDSFFEGKVHAIE 127
           D +  +       T +++V+ +I+ V   FD   FL +  N     ++++   G++  ++
Sbjct: 12  DKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILK 71

Query: 128 KLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFISA 187
                  Y      +   K+      S ++ ID++ +    + E    + I    Q +  
Sbjct: 72  DWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMVEQGPVLIITFQAQLVMV 131

Query: 188 SYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPN--WVLIST 228
             +    ++  DP+   +++ +W   R+    NP   W L+  
Sbjct: 132 VRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDI 174


>d2fxta1 d.17.4.13 (A:234-425) Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
d2cw9a1182 Translocase of inner mitochondrial membrane TIMM44 (TIM 100.0
d2fxta1192 Translocase of inner mitochondrial membrane TIMM44 (TIM 100.0
>d2cw9a1 d.17.4.13 (A:270-451) Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: TIM44-like
domain: Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.6e-39  Score=266.86  Aligned_cols=151  Identities=17%  Similarity=0.401  Sum_probs=146.4

Q ss_pred             CCHHHHHHHHHHHCCCCCCHHHHHHHHHH-HHHHHHHHHHCCCHHHHHHHHCHHHHHHHHHHHHHHHHCCCCCEEEEEEH
Q ss_conf             42024577776612676798999999999-99999999842767899973189999999987776443498202366200
Q gi|254780815|r   81 GTRLNKVMRDIVSVYTDFDPKDFLNEARN-SYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGI  159 (232)
Q Consensus        81 ~~~~~~~~~~i~~~~~~Fd~~~Fl~gAk~-af~~I~~A~~~gD~~~L~~lls~~~~~~f~~~i~~r~~~~~~~~~~~v~i  159 (232)
                      .++.+.+++.|++.||+||.++|++|||. +|++|++||++||++.|++|||+++|+.|+++|++|+.+|.+.++++++|
T Consensus        24 ~~~~~~~l~~i~~~Dp~F~~~~Fl~gAk~~~~~~i~~A~~~gD~~~L~~llt~~~~~~f~~~i~~r~~~g~~~~~~~i~i  103 (182)
T d2cw9a1          24 KTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDI  103 (182)
T ss_dssp             HHHHHHHHHHHHHHCTTCCHHHHHHHHHHTHHHHHHHHHHHTCHHHHHHHBCHHHHHHHHHHHHHHHHTTCEECCEEEEE
T ss_pred             CCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             78899999999966889998999999999999999999871679999998509999999999999987798024431465


Q ss_pred             HHHHHHHHCCCCCEEEEEEEEEEEEEEEEECCCCCEECCCCCCCEEEEEEEEEEECCCCCCCC--EEEEEEECC
Q ss_conf             012454211346456999999888777667689968057657848999999999618989986--689576327
Q gi|254780815|r  160 DDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPN--WVLISTKLG  231 (232)
Q Consensus       160 ~~~~i~~~~~~~~~~~itV~F~~~~i~~~~d~~g~vveG~~~~~~~~~e~WtF~R~~~~~~p~--W~L~~iq~~  231 (232)
                      .+++|++++..++.+++||+|.++|++|++|++|+||+|+++.+.+++|+|||+|++++.+||  |+|++||+.
T Consensus       104 ~~~ei~~a~~~~~~~~itV~F~~~qi~~~~D~~G~iveG~~d~i~~v~e~W~F~R~~~s~~Pn~~W~L~~iq~~  177 (182)
T d2cw9a1         104 DNVDLAMGKMVEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISAS  177 (182)
T ss_dssp             EEEEEEEEEEETTEEEEEEEEEEEEECEEECTTSCEEEECTTCCEEEEEEEEEEECTTCSCGGGCEEEEEEEEE
T ss_pred             CCCEEEEEEEECCCEEEEEEEEEEEHHHEECCCCCEECCCCCCCEEEEEEEEEEECCCCCCCCCCEEEEEECCC
T ss_conf             54226788962882499999999812202057998850898873687899999974767898998899986245



>d2fxta1 d.17.4.13 (A:234-425) Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 232 hypothetical protein CLIBASIA_03530 [Candidatus Li
2cw9_A_194 (A:) Translocase of inner mitochondrial membrane; 7e-25
2fxt_A_14-192179 (A:14-192) Import inner membrane translocase subun 2e-21
>2cw9_A (A:) Translocase of inner mitochondrial membrane; structure genomics, TIM, structural genomics, NPPFSA, riken structural genomics/proteomics initiative; HET: 1PE; 1.90A {Homo sapiens}Length = 194 Back     alignment and structure
 Score =  108 bits (271), Expect = 7e-25
 Identities = 27/164 (16%), Positives = 61/164 (37%), Gaps = 3/164 (1%)

Query: 68  KDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNS-YEAIVDSFFEGKVHAI 126
            D +  +       T  ++V+ +I+ V   FD   FL +  N     ++++   G++  +
Sbjct: 22  TDKVTDLLGGLFSKTEXSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAXISGELDIL 81

Query: 127 EKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMKIINASIEENTVYITIRIVGQFIS 186
           +       Y      +   K+      S ++ ID++ +      E    + I    Q + 
Sbjct: 82  KDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAXGKXVEQGPVLIITFQAQLVX 141

Query: 187 ASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPN--WVLIST 228
              +    ++  DP+   + + +W   R+    NP   W L+  
Sbjct: 142 VVRNPKGEVVEGDPDKVLRXLYVWALCRDQDELNPYAAWRLLDI 185


>2fxt_A (A:14-192) Import inner membrane translocase subunit TIM44; mitochondrial translocase, protein transport; 3.20A {Saccharomyces cerevisiae}Length = 179 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target232 hypothetical protein CLIBASIA_03530 [Candidatus Liberib
2cw9_A_194 Translocase of inner mitochondrial membrane; struc 100.0
2fxt_A_14-192179 Import inner membrane translocase subunit TIM44; m 100.0
3k7c_A_114 Putative NTF2-like transpeptidase; structural geno 95.37
1vqq_A_1-110110 Saupbp2A, penicillin-binding protein MECA, low-aff 94.22
3cnx_A_170 Uncharacterized protein; NP_825848.1, NTF2-like pr 93.9
3h3h_A_122 Uncharacterized snoal-like protein; YP_438428.1, s 90.41
3ksp_A_129 Calcium/calmodulin-dependent kinase II association 90.02
>2cw9_A (A:) Translocase of inner mitochondrial membrane; structure genomics, TIM, structural genomics, NPPFSA, riken structural genomics/proteomics initiative; HET: 1PE; 1.90A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.5e-37  Score=258.19  Aligned_cols=157  Identities=17%  Similarity=0.350  Sum_probs=148.9

Q ss_pred             CCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHH-HHHHHHHHHHCCCHHHHHHHHCHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             33345542024577776612676798999999999-99999999842767899973189999999987776443498202
Q gi|254780815|r   75 NELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARN-SYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVK  153 (232)
Q Consensus        75 ~~~~~~~~~~~~~~~~i~~~~~~Fd~~~Fl~gAk~-af~~I~~A~~~gD~~~L~~lls~~~~~~f~~~i~~r~~~~~~~~  153 (232)
                      ....+..+....+++.+++.||+||+++|+++||. +|++||+||++||++.||+|||+++|+.|+.+|++|+.+|.+++
T Consensus        29 ~~~~~~~~~~~~~~~~i~~~d~~Fd~~~F~~~ak~~~~~~iq~A~~~~D~~~lr~~~t~~~~~~~~~~i~~r~~~g~~~~  108 (194)
T 2cw9_A           29 LGGLFSKTEXSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAXISGELDILKDWCYEATYSQLAHPIQQAKALGLQFH  108 (194)
T ss_dssp             TCCTTHHHHHHHHHHHHHHHCTTCCHHHHHHHHHHTHHHHHHHHHHHTCHHHHHHHBCHHHHHHHHHHHHHHHHTTCEEC
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             25666888899999999976889998999999999999999999973679899997099999999999999997798003


Q ss_pred             EEEEEHHHHHHHHHCCCCCEEEEEEEEEEEEEEEEECCCCCEECCCCCCCEEEEEEEEEEECCCCCCCC--EEEEEEECC
Q ss_conf             366200012454211346456999999888777667689968057657848999999999618989986--689576327
Q gi|254780815|r  154 SSLVGIDDMKIINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPN--WVLISTKLG  231 (232)
Q Consensus       154 ~~~v~i~~~~i~~~~~~~~~~~itV~F~~~~i~~~~d~~g~vveG~~~~~~~~~e~WtF~R~~~~~~p~--W~L~~iq~~  231 (232)
                      .+++.|.+++|++++.+++.++|||+|++++++|++|++|+||+|+++++..+.|+|||+|++++.+|+  |+|++||++
T Consensus       109 ~~~i~i~~~~i~~~~~~~~~~~itv~f~~~~i~~~~D~~G~iv~G~~~~~~~~~e~W~f~R~~~~~~~~~~W~L~~i~q~  188 (194)
T 2cw9_A          109 SRILDIDNVDLAXGKXVEQGPVLIITFQAQLVXVVRNPKGEVVEGDPDKVLRXLYVWALCRDQDELNPYAAWRLLDISAS  188 (194)
T ss_dssp             CEEEEEEEEEEEEEEEETTEEEEEEEEEEEEECEEECTTSCEEEECTTCCEEEEEEEEEEECTTCSCGGGCEEEEEEEEE
T ss_pred             EEEECCCCCCHHHHHHCCCCEEEEEEEEEEEEEHEECCCCCEECCCCCCCEEEEEEEEEEECCCCCCCCCCEEEEEECCC
T ss_conf             56402234421110002886089999986720022068998844998873588899999973767898998799973114



>2fxt_A (A:14-192) Import inner membrane translocase subunit TIM44; mitochondrial translocase, protein transport; 3.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3k7c_A (A:) Putative NTF2-like transpeptidase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: PGE; 2.00A {Campylobacter jejuni} Back     alignment and structure
>1vqq_A (A:1-110) Saupbp2A, penicillin-binding protein MECA, low-affinity; beta-lactam, D- transpeptidase, D-carboxypeptidase, biosynthetic protein; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3cnx_A (A:) Uncharacterized protein; NP_825848.1, NTF2-like protein of unknown function, structural genomics, joint center for structural genomics; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} Back     alignment and structure
>3h3h_A (A:) Uncharacterized snoal-like protein; YP_438428.1, snoal-like protein of unknown function, structural genomics; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>3ksp_A (A:) Calcium/calmodulin-dependent kinase II association domain; structural genomics, joint center for structural genomics, JCSG; HET: MSE NHE; 2.59A {Exiguobacterium sibiricum 255-15} Back     alignment and structure