254780820

254780820

acetyl-CoA carboxylase subunit beta

GeneID in NCBI database:8209826Locus tag:CLIBASIA_03555
Protein GI in NCBI database:254780820Protein Accession:YP_003065233.1
Gene range:-(435350, 436204)Protein Length:284aa
Gene description:acetyl-CoA carboxylase subunit beta
COG prediction:[I] Acetyl-CoA carboxylase beta subunit
KEGG prediction:accD; acetyl-CoA carboxylase subunit beta (EC:6.4.1.2); K01963 acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
SEED prediction:Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)
Pathway involved in KEGG:Pyruvate metabolism [PATH:las00620]
Propanoate metabolism [PATH:las00640]
Fatty acid biosynthesis [PATH:las00061]
Tetracycline biosynthesis
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVREKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTKSVQ
ccHHHHHcccccccHHHHHcccccccccccccccEEEHHHHcccccHHHHccccccccHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHcccccccEEEEEEEEEccEEEEEEEEccccccEEccHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHccEEEEEEccEEEEEccHHHHHHHHccccccccccccHHHHcccccccccHHHHHHHHHHHHHHHccccc
ccHHHHcccccccccccccccccccEEEccccccEEEHHHHHHHccccccccccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEccccccccEEEEEEEEHHccccHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHccHHcccccEEEEcccHHHHHHHHHHHccccHHHHHHHHHccccccEccHHHHHHHHHHHHHHHccccc
mnwitnfvrprinsvfgrraipenlwvkcpetgamvyhkdlkenqwvisssdfhmkipAKERLKFLFdnakyclldqpqvcqdplkfrdnkKYIDRLKenrsktglIDSIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAekcplvmftasggarMQEGILSLMQLPRTTIAINMLkdaglpyivvltnpttggvtasyamlgdihlaepgaeigFAGRRVIEQTVReklpdgfqrsEYLVEHGMIdrivhrhdipEVVSSLCKILTKSVQ
mnwitnfvrprinsvfgrraipenlwvKCPETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFDNAKYCLLdqpqvcqdplkfrdnKKYIdrlkenrsktglidsIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTvreklpdgfqrSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTKSVQ
MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDFKLVAVVHefsfiggsigiaageaiVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVREKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTKSVQ
MNWIT*******************LWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLK******GLIDSIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVREKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLC*ILT****
MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVREKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTKSVQ
*NWITNF*RPRINS*FGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVREKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILT****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVREKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTKSVQ
MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVREKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTKSVQ
MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAKERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVREKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTKSVQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target284 acetyl-CoA carboxylase subunit beta [Candidatus Liberib
315122043283 acetyl-CoA carboxylase subunit beta [Candidatus Liberib 1 1e-144
222084224303 acetyl-CoA carboxylase, carboxyl transferase, beta subu 1 1e-128
150398431304 acetyl-CoA carboxylase subunit beta [Sinorhizobium medi 1 1e-128
15963783304 acetyl-CoA carboxylase subunit beta [Sinorhizobium meli 1 1e-127
190889663301 acetyl-CoA carboxylase, carboxil transferase, beta subu 1 1e-127
218660979301 acetyl-CoA carboxylase subunit beta [Rhizobium etli IE4 1 1e-127
241206966301 acetyl-CoA carboxylase subunit beta [Rhizobium legumino 1 1e-127
218510003301 acetyl-CoA carboxylase subunit beta [Rhizobium etli Bra 1 1e-126
116249789301 acetyl-CoA carboxylase subunit beta [Rhizobium legumino 1 1e-126
227823890304 acetyl-CoA carboxylase subunit beta [Sinorhizobium fred 1 1e-126
>gi|315122043|ref|YP_004062532.1| acetyl-CoA carboxylase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 283 Back     alignment and organism information
 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 240/281 (85%), Positives = 262/281 (93%)

Query: 1   MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAK 60
           MNWITNFVRPRI+SVFGR +IPENLWVKCPETG M+YHKDL+ENQ VI SS FHMKIPAK
Sbjct: 1   MNWITNFVRPRISSVFGRSSIPENLWVKCPETGEMIYHKDLEENQRVILSSGFHMKIPAK 60

Query: 61  ERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDF 120
           ERL FLFDN +Y LLDQPQ CQDPLKFRDNKKYIDRLKENRSKT L+DS++SA+GNV   
Sbjct: 61  ERLNFLFDNGEYSLLDQPQTCQDPLKFRDNKKYIDRLKENRSKTNLVDSVISAIGNVHGL 120

Query: 121 KLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLP 180
           KLVAVVH+FSFIGGS+G+AAGE I+KS E+AI E+CPLVMFTASGGARMQEGILSLMQLP
Sbjct: 121 KLVAVVHDFSFIGGSLGMAAGEIIIKSFEKAIEEQCPLVMFTASGGARMQEGILSLMQLP 180

Query: 181 RTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVR 240
           RTTIA+ MLK+AGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAG+RVIEQTVR
Sbjct: 181 RTTIAVGMLKEAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGKRVIEQTVR 240

Query: 241 EKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTK 281
           EKLPDGFQRSEYLVEHGMID+IVHRHDIP+ + +LCKILTK
Sbjct: 241 EKLPDGFQRSEYLVEHGMIDKIVHRHDIPKTLYTLCKILTK 281


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084224|ref|YP_002542750.1| acetyl-CoA carboxylase, carboxyl transferase, beta subunit [Agrobacterium radiobacter K84] Length = 303 Back     alignment and organism information
>gi|150398431|ref|YP_001328898.1| acetyl-CoA carboxylase subunit beta [Sinorhizobium medicae WSM419] Length = 304 Back     alignment and organism information
>gi|15963783|ref|NP_384136.1| acetyl-CoA carboxylase subunit beta [Sinorhizobium meliloti 1021] Length = 304 Back     alignment and organism information
>gi|190889663|ref|YP_001976205.1| acetyl-CoA carboxylase, carboxil transferase, beta subunit [Rhizobium etli CIAT 652] Length = 301 Back     alignment and organism information
>gi|218660979|ref|ZP_03516909.1| acetyl-CoA carboxylase subunit beta [Rhizobium etli IE4771] Length = 301 Back     alignment and organism information
>gi|241206966|ref|YP_002978062.1| acetyl-CoA carboxylase subunit beta [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 301 Back     alignment and organism information
>gi|218510003|ref|ZP_03507881.1| acetyl-CoA carboxylase subunit beta [Rhizobium etli Brasil 5] Length = 301 Back     alignment and organism information
>gi|116249789|ref|YP_765627.1| acetyl-CoA carboxylase subunit beta [Rhizobium leguminosarum bv. viciae 3841] Length = 301 Back     alignment and organism information
>gi|227823890|ref|YP_002827863.1| acetyl-CoA carboxylase subunit beta [Sinorhizobium fredii NGR234] Length = 304 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target284 acetyl-CoA carboxylase subunit beta [Candidatus Liberib
PRK05654292 PRK05654, PRK05654, acetyl-CoA carboxylase subunit beta 1e-136
TIGR00515285 TIGR00515, accD, acetyl-CoA carboxylase, carboxyl trans 7e-91
CHL00174296 CHL00174, accD, acetyl-CoA carboxylase beta subunit; Re 2e-71
KOG0540536 KOG0540, KOG0540, KOG0540, 3-Methylcrotonyl-CoA carboxy 6e-18
COG0777294 COG0777, AccD, Acetyl-CoA carboxylase beta subunit [Lip 1e-112
pfam01039 487 pfam01039, Carboxyl_trans, Carboxyl transferase domain 5e-14
COG4799 526 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltrans 3e-10
KOG0540 536 KOG0540, KOG0540, KOG0540, 3-Methylcrotonyl-CoA carboxy 1e-05
TIGR03133274 TIGR03133, malonate_beta, malonate decarboxylase, beta 7e-05
TIGR01117 512 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase alpha 6e-09
>gnl|CDD|180184 PRK05654, PRK05654, acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|129606 TIGR00515, accD, acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>gnl|CDD|177079 CHL00174, accD, acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>gnl|CDD|35760 KOG0540, KOG0540, KOG0540, 3-Methylcrotonyl-CoA carboxylase, non-biotin containing subunit/Acetyl-CoA carboxylase carboxyl transferase, subunit beta [Amino acid transport and metabolism, Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31120 COG0777, AccD, Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|144579 pfam01039, Carboxyl_trans, Carboxyl transferase domain Back     alignment and domain information
>gnl|CDD|34408 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|35760 KOG0540, KOG0540, KOG0540, 3-Methylcrotonyl-CoA carboxylase, non-biotin containing subunit/Acetyl-CoA carboxylase carboxyl transferase, subunit beta [Amino acid transport and metabolism, Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132177 TIGR03133, malonate_beta, malonate decarboxylase, beta subunit Back     alignment and domain information
>gnl|CDD|130187 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 284 acetyl-CoA carboxylase subunit beta [Candidatus Liberib
TIGR00515292 accD acetyl-CoA carboxylase, carboxyl transferase, beta 100.0
PRK05654288 acetyl-CoA carboxylase subunit beta; Validated 100.0
CHL00174305 accD acetyl-CoA carboxylase beta subunit; Reviewed 100.0
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabol 100.0
KOG0540536 consensus 100.0
pfam01039 487 Carboxyl_trans Carboxyl transferase domain. All of the 100.0
PRK07189302 malonate decarboxylase subunit beta; Reviewed 100.0
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit. Mem 100.0
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase component ( 99.97
TIGR01117 513 mmdA methylmalonyl-CoA decarboxylase alpha subunit; Int 99.95
pfam01039487 Carboxyl_trans Carboxyl transferase domain. All of the 99.69
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase component ( 99.48
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 99.37
PRK05724318 acetyl-CoA carboxylase carboxyltransferase subunit alph 99.27
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase alpha s 99.25
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabo 98.97
TIGR01117513 mmdA methylmalonyl-CoA decarboxylase alpha subunit; Int 98.73
). It catalyzes the first step in the synthesis of long-chain fatty acids which involves the carboxylation of acetyl-CoA to malonyl-CoA. The acetyl-CoA carboxylase complex () is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase and two non-identical carboxyl transferase subunits (alpha and beta) in a 2:2 association . The reaction involves two steps: Biotin carrier protein + ATP + HCO_3^- -> Carboxybiotin carrier protein + ADP + P_i Carboxybiotin carrier protein + Acetyl-CoA -> Malonyl-CoA + Biotin carrier protein ; GO: 0003989 acetyl-CoA carboxylase activity, 0006633 fatty acid biosynthetic process, 0009317 acetyl-CoA carboxylase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00513">TIGR00513329 accA acetyl-CoA carboxylase, carboxyl transferase, alph 98.16
KOG0540 536 consensus 99.84
KOG0368 2196 consensus 96.65
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subunit. M 98.66
pfam06833234 MdcE Malonate decarboxylase gamma subunit (MdcE). This 98.1
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 98.08
PRK07396273 naphthoate synthase; Validated 98.06
PRK06144262 enoyl-CoA hydratase; Provisional 98.06
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 98.03
PRK07468262 enoyl-CoA hydratase; Provisional 97.98
PRK07629261 consensus 97.9
PRK05980260 enoyl-CoA hydratase; Provisional 97.85
PRK07658257 enoyl-CoA hydratase; Provisional 97.84
PRK07510266 consensus 97.83
PRK06210272 enoyl-CoA hydratase; Provisional 97.82
PRK06127269 enoyl-CoA hydratase; Provisional 97.82
PRK07830267 consensus 97.81
PRK06688263 enoyl-CoA hydratase; Provisional 97.8
PRK07327271 enoyl-CoA hydratase; Provisional 97.76
PRK07511259 enoyl-CoA hydratase; Provisional 97.76
PRK08139265 enoyl-CoA hydratase; Validated 97.76
PRK09674257 enoyl-CoA hydratase-isomerase; Provisional 97.73
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydrata 97.7
PRK07260260 enoyl-CoA hydratase; Provisional 97.69
PRK06143260 enoyl-CoA hydratase; Provisional 97.69
PRK03580262 carnitinyl-CoA dehydratase; Provisional 97.69
PRK09076258 enoyl-CoA hydratase; Provisional 97.68
PRK06142271 enoyl-CoA hydratase; Provisional 97.66
PRK06190258 enoyl-CoA hydratase; Provisional 97.64
PRK05862257 enoyl-CoA hydratase; Provisional 97.62
PRK07659260 enoyl-CoA hydratase; Provisional 97.61
PRK07110257 polyketide biosynthesis enoyl-CoA hydratase; Validated 97.59
PRK08138260 enoyl-CoA hydratase; Provisional 97.55
PRK10949 618 protease 4; Provisional 97.55
PRK08258270 enoyl-CoA hydratase; Provisional 97.53
PRK05674271 gamma-carboxygeranoyl-CoA hydratase; Validated 97.52
PRK05981266 enoyl-CoA hydratase; Provisional 97.51
PRK05864269 enoyl-CoA hydratase; Provisional 97.41
PRK06023248 enoyl-CoA hydratase; Provisional 97.39
PRK08140262 enoyl-CoA hydratase; Provisional 97.39
PRK07799263 enoyl-CoA hydratase; Provisional 97.34
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid met 97.26
cd07021178 Clp_protease_NfeD_like Nodulation formation efficiency 96.81
KOG0368 2196 consensus 96.73
KOG1680290 consensus 96.7
PRK11730 715 fadB multifunctional fatty acid oxidation complex subun 96.69
PRK08321302 naphthoate synthase; Validated 96.61
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficiency D ( 96.29
PRK10949 618 protease 4; Provisional 96.28
PRK07827255 enoyl-CoA hydratase; Provisional 96.1
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptide pep 96.06
cd07015172 Clp_protease_NfeD Nodulation formation efficiency D (Nf 95.89
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [Postt 95.59
PRK11154 706 fadJ multifunctional fatty acid oxidation complex subun 95.33
TIGR00706224 SppA_dom signal peptide peptidase SppA, 36K type; Inter 94.33
pfam00574182 CLP_protease Clp protease. The Clp protease has an acti 94.33
PRK12553204 ATP-dependent Clp protease proteolytic subunit; Reviewe 94.03
PRK00277197 clpP ATP-dependent Clp protease proteolytic subunit; Re 94.01
PRK05995261 enoyl-CoA hydratase; Provisional 98.03
PRK06495257 enoyl-CoA hydratase; Provisional 98.02
PRK07854243 enoyl-CoA hydratase; Provisional 97.78
PRK07938249 enoyl-CoA hydratase; Provisional 97.72
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Members o 97.6
PRK06951254 consensus 97.57
PRK09120277 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 97.46
PRK05869225 enoyl-CoA hydratase; Validated 97.43
PRK06213229 enoyl-CoA hydratase; Provisional 97.34
PRK05870254 enoyl-CoA hydratase; Provisional 96.53
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydrata 94.92
PRK05617 356 enoyl-CoA hydratase; Provisional 91.79
PRK06494259 enoyl-CoA hydratase; Provisional 97.82
PRK09245266 enoyl-CoA hydratase; Provisional 97.82
PRK07657261 enoyl-CoA hydratase; Provisional 97.76
PRK08272308 enoyl-CoA hydratase; Provisional 97.69
PRK08252254 enoyl-CoA hydratase; Provisional 97.58
PRK12478298 enoyl-CoA hydratase; Provisional 97.56
PRK08150264 enoyl-CoA hydratase; Provisional 97.56
PRK08260293 enoyl-CoA hydratase; Provisional 97.18
PRK08290284 enoyl-CoA hydratase; Provisional 97.08
PRK08259254 enoyl-CoA hydratase; Provisional 97.06
PRK06563255 enoyl-CoA hydratase; Provisional 96.96
PRK07112251 polyketide biosynthesis enoyl-CoA hydratase; Validated 96.93
PRK08788286 enoyl-CoA hydratase; Validated 96.63
pfam00378169 ECH Enoyl-CoA hydratase/isomerase family. This family c 96.51
PRK07509262 enoyl-CoA hydratase; Provisional 95.34
PRK06072240 enoyl-CoA hydratase; Provisional 94.14
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K 96.47
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a serine 96.05
PRK11778317 putative periplasmic protease; Provisional 95.98
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K 95.91
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serin 95.66
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Posttra 95.35
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is an AT 95.28
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 93.26
TIGR00705 614 SppA_67K signal peptide peptidase SppA, 67K type; Inter 92.88
TIGR03549 718 conserved hypothetical protein TIGR03549. This family c 91.24
pfam03255145 ACCA Acetyl co-enzyme A carboxylase carboxyltransferase 96.02
pfam0215035 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit. 93.41
pfam05876552 Terminase_GpA Phage terminase large subunit (GpA). This 92.89
pfam09538104 FYDLN_acid Protein of unknown function (FYDLN_acid). Me 92.76
smart0066152 RPOL9 RNA polymerase subunit 9. 92.4
COG288861 Predicted Zn-ribbon RNA-binding protein with a function 92.23
TIGR02300157 FYDLN_acid conserved hypothetical protein TIGR02300; In 92.11
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transcripti 91.61
PRK10220111 hypothetical protein; Provisional 91.35
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. These sequences are the archaeal DNA-directed RNA polymerase, subunit M (also known as transcription factor S), a protein related in size and sequence to certain eukaryotic RNA polymerase small subunits, and in sequence and function to the much larger eukaryotic transcription factor IIS (TFIIS). Although originally suggested to be a subunit of the archaeal RNA polymerase, it elutes separately from active polymerase in gel filtration experiments and acts, like TFIIs, as an induction factor for RNA cleavage by RNA polymerase . ; GO: 0003677 DNA binding, 0003700 transcription factor activity, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01384">TIGR01384111 TFS_arch transcription factor S; InterPro: IPR006288 DN 91.31
PRK12366649 replication factor A; Reviewed 91.14
PRK1228659 rpmF 50S ribosomal protein L32; Reviewed 90.59
PRK06266178 transcription initiation factor E subunit alpha; Valida 90.32
PRK05580699 primosome assembly protein PriA; Validated 92.36
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit; InterPro: IPR000438 Fatty acid synthesis involves a set of reactions, commencing with carboxylation of acetyl-CoA to malonyl-CoA Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>KOG0540 consensus Back     alignment and domain information
>pfam01039 Carboxyl_trans Carboxyl transferase domain Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit; InterPro: IPR005783 This family describes methymalonyl-CoA decarboxylase alpha subunit in archaea and bacteria Back     alignment and domain information
>pfam01039 Carboxyl_trans Carboxyl transferase domain Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit; InterPro: IPR005783 This family describes methymalonyl-CoA decarboxylase alpha subunit in archaea and bacteria Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit; InterPro: IPR001095 This entry contains the alpha subunit the acetyl coenzyme A carboxylase complex (Back     alignment and domain information
>KOG0540 consensus Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>pfam06833 MdcE Malonate decarboxylase gamma subunit (MdcE) Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK07396 naphthoate synthase; Validated Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07629 consensus Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07510 consensus Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07830 consensus Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>KOG1680 consensus Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type; InterPro: IPR004635 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>pfam00574 CLP_protease Clp protease Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK06951 consensus Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK05617 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>pfam00378 ECH Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK11778 putative periplasmic protease; Provisional Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type; InterPro: IPR004634 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>TIGR03549 conserved hypothetical protein TIGR03549 Back     alignment and domain information
>pfam03255 ACCA Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit Back     alignment and domain information
>pfam02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit Back     alignment and domain information
>pfam05876 Terminase_GpA Phage terminase large subunit (GpA) Back     alignment and domain information
>pfam09538 FYDLN_acid Protein of unknown function (FYDLN_acid) Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300; InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S; InterPro: IPR006288 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target284 acetyl-CoA carboxylase subunit beta [Candidatus Liberib
2f9y_B304 The Crystal Structure Of The Carboxyltransferase Su 3e-86
2f9i_B285 Crystal Structure Of The Carboxyltransferase Subuni 1e-73
1on3_A 523 Transcarboxylase 12s Crystal Structure: Hexamer Ass 1e-22
1x0u_A 522 Crystal Structure Of The Carboxyl Transferase Subun 8e-18
2bzr_A548 Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Ca 1e-06
2a7s_A548 Crystal Structure Of The Acyl-Coa Carboxylase, Accd 4e-08
1on3_A523 Transcarboxylase 12s Crystal Structure: Hexamer Ass 9e-07
3mfm_C530 Crystal Structures And Mutational Analyses Of Acyl- 5e-04
3iav_A530 Propionyl-Coa Carboxylase Beta Subunit, D422v Lengt 3e-04
3ibb_A530 Propionyl-Coa Carboxylase Beta Subunit, D422a Lengt 8e-05
3ib9_A530 Propionyl-Coa Carboxylase Beta Subunit, D422l Lengt 5e-04
1xnw_A530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 3e-04
1xnv_A530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 6e-04
3n6r_B531 Crystal Structure Of The Holoenzyme Of Propionyl-Co 5e-04
1vrg_A527 Crystal Structure Of Propionyl-Coa Carboxylase, Bet 5e-05
1x0u_A522 Crystal Structure Of The Carboxyl Transferase Subun 1e-07
3mfm_C 530 Crystal Structures And Mutational Analyses Of Acyl- 6e-21
3iav_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422v Lengt 6e-21
3ibb_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422a Lengt 6e-21
3ib9_A 530 Propionyl-Coa Carboxylase Beta Subunit, D422l Lengt 6e-21
1xnw_A 530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 6e-21
1xnv_A 530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 6e-21
3n6r_B 531 Crystal Structure Of The Holoenzyme Of Propionyl-Co 1e-20
1vrg_A 527 Crystal Structure Of Propionyl-Coa Carboxylase, Bet 2e-19
2bzr_A 548 Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Ca 6e-17
2a7s_A 548 Crystal Structure Of The Acyl-Coa Carboxylase, Accd 6e-17
gi|122920146|pdb|2F9Y|B Chain B, The Crystal Structure Of The Carboxyltransferase Subunit Of Acc From Escherichia Coli Length = 304 Back     alignment and structure
 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 129/281 (45%), Positives = 181/281 (64%), Gaps = 2/281 (0%)

Query: 1   MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAK 60
           M+WI         +   + +IPE +W KC   G ++Y  +L+ N  V    D HM++ A+
Sbjct: 1   MSWIERIKSNITPT--RKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTAR 58

Query: 61  ERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDF 120
            RL  L D      L      +D LKFRD+KKY DRL   + +TG  D++V   G +   
Sbjct: 59  NRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGM 118

Query: 121 KLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLP 180
            +VA   EF+F+GGS+G   G   V++ E+A+ + CPL+ F+ASGGARMQE ++SLMQ+ 
Sbjct: 119 PVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMA 178

Query: 181 RTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVR 240
           +T+ A+  +++ GLPYI VLT+PT GGV+AS+AMLGD+++AEP A IGFAG RVIEQTVR
Sbjct: 179 KTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVR 238

Query: 241 EKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTK 281
           EKLP GFQRSE+L+E G ID IV R ++   ++S+   L  
Sbjct: 239 EKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMN 279


gi|119389445|pdb|2F9I|B Chain B, Crystal Structure Of The Carboxyltransferase Subunit Of Acc From Staphylococcus Aureus Length = 285 Back     alignment and structure
>gi|31615813|pdb|1ON3|A Chain A, Transcarboxylase 12s Crystal Structure: Hexamer Assembly And Substrate Binding To A Multienzyme Core (With Methylmalonyl-Coenzyme A And Methylmalonic Acid Bound) Length = 523 Back     alignment and structure
>gi|110590693|pdb|1X0U|A Chain A, Crystal Structure Of The Carboxyl Transferase Subunit Of Putative Pcc Of Sulfolobus Tokodaii Length = 522 Back     alignment and structure
>gi|126030147|pdb|2BZR|A Chain A, Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Carboxylase Beta-Subunit From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
gi|90108669|pdb|2A7S|A Chain A, Crystal Structure Of The Acyl-Coa Carboxylase, Accd5, From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>gi|31615813|pdb|1ON3|A Chain A, Transcarboxylase 12s Crystal Structure: Hexamer Assembly And Substrate Binding To A Multienzyme Core (With Methylmalonyl-Coenzyme A And Methylmalonic Acid Bound) Length = 523 Back     alignment and structure
>gi|308387843|pdb|3MFM|C Chain C, Crystal Structures And Mutational Analyses Of Acyl-Coa Carboxylase Subunit Of Streptomyces Coelicolor Length = 530 Back     alignment and structure
>gi|299856690|pdb|3IAV|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422v Length = 530 Back     alignment and structure
>gi|297342946|pdb|3IBB|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422a Length = 530 Back     alignment and structure
>gi|297342944|pdb|3IB9|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422l Length = 530 Back     alignment and structure
>gi|56967176|pdb|1XNW|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #2, Mutant D422i Length = 530 Back     alignment and structure
gi|56967174|pdb|1XNV|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #1 Length = 530 Back     alignment and structure
>gi|304445936|pdb|3N6R|B Chain B, Crystal Structure Of The Holoenzyme Of Propionyl-Coa Carboxylase (Pcc) Length = 531 Back     alignment and structure
>gi|62738152|pdb|1VRG|A Chain A, Crystal Structure Of Propionyl-Coa Carboxylase, Beta Subunit (Tm0716) From Thermotoga Maritima At 2.30 A Resolution Length = 527 Back     alignment and structure
>gi|110590693|pdb|1X0U|A Chain A, Crystal Structure Of The Carboxyl Transferase Subunit Of Putative Pcc Of Sulfolobus Tokodaii Length = 522 Back     alignment and structure
>gi|308387843|pdb|3MFM|C Chain C, Crystal Structures And Mutational Analyses Of Acyl-Coa Carboxylase Subunit Of Streptomyces Coelicolor Length = 530 Back     alignment and structure
>gi|299856690|pdb|3IAV|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422v Length = 530 Back     alignment and structure
>gi|297342946|pdb|3IBB|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422a Length = 530 Back     alignment and structure
>gi|297342944|pdb|3IB9|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422l Length = 530 Back     alignment and structure
>gi|56967176|pdb|1XNW|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #2, Mutant D422i Length = 530 Back     alignment and structure
gi|56967174|pdb|1XNV|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #1 Length = 530 Back     alignment and structure
>gi|304445936|pdb|3N6R|B Chain B, Crystal Structure Of The Holoenzyme Of Propionyl-Coa Carboxylase (Pcc) Length = 531 Back     alignment and structure
>gi|62738152|pdb|1VRG|A Chain A, Crystal Structure Of Propionyl-Coa Carboxylase, Beta Subunit (Tm0716) From Thermotoga Maritima At 2.30 A Resolution Length = 527 Back     alignment and structure
>gi|126030147|pdb|2BZR|A Chain A, Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Carboxylase Beta-Subunit From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
gi|90108669|pdb|2A7S|A Chain A, Crystal Structure Of The Acyl-Coa Carboxylase, Accd5, From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target284 acetyl-CoA carboxylase subunit beta [Candidatus Liberib
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferase subu 2e-71
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase subu 1e-65
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; doma 3e-31
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accase, pc 3e-31
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, struct 1e-28
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid bios 4e-27
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein comple 4e-27
1xny_A 530 Pccase, propionyl-COA carboxylase complex B subunit, PC 6e-24
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase alpha subu 5e-23
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dependen 2e-20
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION tran 9e-20
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltransferas 2e-10
3ff6_A 760 Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder 1e-08
3ff6_A 760 Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder 4e-05
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Length = 304 Back     alignment and structure
 Score =  264 bits (675), Expect = 2e-71
 Identities = 130/280 (46%), Positives = 183/280 (65%), Gaps = 2/280 (0%)

Query: 1   MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQWVISSSDFHMKIPAK 60
           M+WI   ++  I     + +IPE +W KC   G ++Y  +L+ N  V    D HM++ A+
Sbjct: 1   MSWIER-IKSNITPTR-KASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTAR 58

Query: 61  ERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKTGLIDSIVSAVGNVRDF 120
            RL  L D      L      +D LKFRD+KKY DRL   + +TG  D++V   G +   
Sbjct: 59  NRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGM 118

Query: 121 KLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTASGGARMQEGILSLMQLP 180
            +VA   EF+F+GGS+G   G   V++ E+A+ + CPL+ F+ASGGARMQE ++SLMQ+ 
Sbjct: 119 PVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMA 178

Query: 181 RTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGRRVIEQTVR 240
           +T+ A+  +++ GLPYI VLT+PT GGV+AS+AMLGD+++AEP A IGFAG RVIEQTVR
Sbjct: 179 KTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVR 238

Query: 241 EKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILT 280
           EKLP GFQRSE+L+E G ID IV R ++   ++S+   L 
Sbjct: 239 EKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLM 278


>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Length = 285 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Length = 523 Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 1xny_A* 1xnv_A* 1xo6_A Length = 530 Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Thermotoga maritima MSB8} SCOP: c.14.1.4 c.14.1.4 Length = 527 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Length = 548 Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans och 114} Length = 531 Back     alignment and structure
>1xny_A Pccase, propionyl-COA carboxylase complex B subunit, PCC; polyketide, polyketide synthase, acyl-COA carboxylase, carboxyltransferase; HET: 191 BTN; 2.20A {Streptomyces coelicolor} SCOP: c.14.1.4 c.14.1.4 PDB: 1xnv_A* 1xo6_A 1xnw_A Length = 530 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase alpha subunit; lyase; 2.20A {Sulfolobus tokodaii str} Length = 522 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Length = 587 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Length = 588 Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, CT, tepraloxydim, ATP-binding, biotin, cytoplasm, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 1od2_A* 1od4_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Length = 758 Back     alignment and structure
>3ff6_A Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder, fatty acid metabolism, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis; HET: RCP; 3.19A {Homo sapiens} Length = 760 Back     alignment and structure
>3ff6_A Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder, fatty acid metabolism, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis; HET: RCP; 3.19A {Homo sapiens} Length = 760 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target284 acetyl-CoA carboxylase subunit beta [Candidatus Liberib
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase subu 100.0
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferase subu 100.0
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid bios 100.0
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accase, pc 100.0
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein comple 100.0
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; doma 100.0
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, struct 100.0
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase alpha subu 100.0
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION tran 100.0
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dependen 100.0
3iav_A530 Propionyl-COA carboxylase complex B subunit; accase, pc 99.74
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase alpha subu 99.73
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid bios 99.72
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein comple 99.71
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; doma 99.7
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, struct 99.7
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION tran 99.65
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dependen 99.64
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase subu 99.52
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha chain 99.47
3k8x_A758 Acetyl-COA carboxylase; transferase, carboxyltransferas 99.36
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltransferas 99.95
3ff6_A 760 Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder 99.94
3ff6_A 760 Acetyl-COA carboxylase 2; ACC2, ACC, metabolic disorder 99.48
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural geno 98.11
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Escheric 98.04
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; isomer 98.03
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynthetic 97.99
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, structural 97.98
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seattle s 97.96
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, st 97.94
3ome_A282 Enoyl-COA hydratase; ssgcid, structural genomics, struc 97.89
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid 97.89
2gtr_A261 CDY-like, chromodomain Y-like protein; structural genom 97.88
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomics, GK 97.87
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrolase, 97.85
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, 97.84
2fbm_A291 Y chromosome chromodomain protein 1, telomeric isoform 97.84
2iex_A272 Dihydroxynapthoic acid synthetase; crotonase-like famil 97.83
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula 19L} P 97.82
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydratase ho 97.81
3pea_A261 Enoyl-COA hydratase/isomerase family protein; structura 97.8
3h02_A288 Naphthoate synthase; IDP00995, lyase, structural genomi 97.8
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, 97.8
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fold, th 97.79
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP02329, 97.78
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldol 97.76
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crotonase 97.72
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; structura 97.67
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structural g 97.65
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structural g 97.64
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, structural 97.62
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectious di 97.6
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure, str 97.59
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, structu 97.51
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle structura 97.49
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural genom 97.49
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HET: CA 97.47
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hyd 97.44
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-bindin 97.39
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, unkn 97.39
3p85_A270 Enoyl-COA hydratase; ssgcid, mycobacerium avium, struct 97.38
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, isom 97.37
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; 97.34
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; 97.33
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alpha-bet 97.14
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} 97.08
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics center 97.03
1q52_A314 MENB; lyase, structural genomics, PSI, protein structur 97.01
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 hete 96.93
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cl 96.93
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold 96.81
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; HET: Y 96.81
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, membr 96.79
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich, str 96.73
2x58_A 727 Peroxisomal bifunctional enzyme; beta oxidation pathway 96.6
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid metabol 96.51
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); oxid 95.89
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural geno 95.84
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; endopep 91.02
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; serin 90.99
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; structu 90.19
3bpp_A230 1510-N membrane protease; specific for A stomatin homol 97.72
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase 97.57
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, membr 96.87